KEGG   Odoribacter splanchnicus: Odosp_3321
Entry
Odosp_3321        CDS       T01428                                 

Definition
(GenBank) Glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
osp  Odoribacter splanchnicus
Pathway
osp00564  Glycerophospholipid metabolism
osp01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osp00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Odosp_3321
Enzymes [BR:osp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Odosp_3321
SSDB
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored Lycopene_cycl Pyr_redox_2 HI0933_like GIDA NAD_binding_8 Pyr_redox_3 Pyr_redox FAD_binding_3 GMC_oxred_N
Other DBs
NCBI-ProteinID: ADY34280
UniProt: F9Z9L3
LinkDB
Position
3946762..3948327
AA seq 521 aa
MKREDLLSKISDPSKVWDVVVIGGGATGLGVAVDAVTRGYSVALFEWEDFAKATSSRSTK
LVHGGVRYLAQGDVSLVLEALYERGLLQQNAPHLVKNQSFLIPNYRYWDNFLYTVGLTIY
DILAGRLSLGRSKYVSKKKTTSYLPTVRVDGLKGGVVYHDGQFDDSRLAVNLAQSCVENG
GCPINRMKVTAILHGSDGRARGVKVQDLMNGQEYEVKAKAVINATGIFVDSIMEMDVPTH
EHMVKPSQGVHLVLDKSFLQSDYAIMIPKTDDGRVLFAVPWHDKVVVGTTDTLREHPELE
PQALESEIEFILNTAGRYLTRKPQRSDVLSVFAGLRPLAAPKKEGKSTKEISRSHKIFVS
ENKLITITGGKWTTYRRMAEDTVDKAIELNLLEKKACVTKKFRIHGYQLNPDLNNHLYIY
GSDIQAIKTLMQSDPAMAEKLHPKYDYTVAEVVWAVREEMALNVEDILARRVRLLFLDAR
VAAEVAPKVARIVAKELGYDQAWIDGQVKEFTDLAGHYILE
NT seq 1566 nt   +upstreamnt  +downstreamnt
atgaaacgagaagatttattatccaaaatctctgatccgtccaaagtctgggatgttgtc
gttatcggaggaggtgcaaccggtttgggagttgccgtagatgcagttacaagagggtat
agtgtcgctttattcgaatgggaagattttgcaaaagcaacttccagtcgtagtaccaag
ttggtgcatggaggagtccggtatttggctcagggagatgtttcattggtattggaggct
ttgtacgaaagaggattactccaacagaatgctccgcatctggtaaaaaatcaatctttt
ctgattccgaattatcgttattgggataactttctttatacagtcggactgacgatatac
gatatcctcgccggccgtcttagtctggggcgttctaaatatgtatccaaaaagaagact
acgtcttatttaccgacggtccgggtggatggtttgaagggaggggtagtctatcatgac
ggtcaattcgacgattcccgcctggcagtcaatctggctcagtcctgtgtcgaaaatggc
ggatgtccgatcaaccgtatgaaagtaacggcgatattacacggatccgatggccgggca
agaggggtgaaggttcaggatttgatgaacgggcaggaatatgaagtgaaagccaaagcg
gtgattaatgcgaccggcatctttgtggatagcattatggaaatggatgtgccgactcac
gagcatatggtgaaaccgagccaaggggtacatttggtcctggataagtcgtttctgcaa
agtgattacgctatcatgatccccaagaccgacgatggccgggtattgtttgccgtgccc
tggcatgacaaagtggttgtcggaacgaccgatactttacgggaacatccggaattggag
ccacaagctctggagtcggaaatcgaatttatcctgaatacggccggacgttacctgact
cgtaaacctcaacggagcgatgtcctttcggtatttgccggattacgtccattagcggct
cccaaaaaggaaggtaaaagtacgaaagaaatttcccggagtcataagatttttgtttct
gaaaataagctgattaccatcaccggagggaaatggaccacctatcggagaatggcagaa
gatacggtggataaggcgatcgaattgaatctgctggaaaagaaagcatgtgtgacaaaa
aaattccggattcatggttatcaattaaatccggatctcaataatcatttgtatatttat
ggctcggatattcaggcgatcaaaaccttgatgcagtccgatccggctatggccgaaaaa
ctgcatcccaaatatgattacactgtggccgaggtggtatgggcggttcgggaagagatg
gcattgaatgttgaggatatactggccaggcgtgtcaggttattgttcctggatgcccgg
gtggctgccgaagttgcccctaaagtggcccggatcgttgccaaagaattgggatacgat
caggcctggatcgatgggcaggtaaaagagtttaccgatttggccggacactatatttta
gagtaa

DBGET integrated database retrieval system