KEGG   Ostreococcus tauri: OT_ostta05g02130Help
Entry
OT_ostta05g02130  CDS       T01358                                 

Definition
(RefSeq) Inosine/uridine-preferring nucleoside hydrolase
Organism
ota  Ostreococcus tauri
SSDB OrthologParalogGFIT
Motif
Pfam: IU_nuc_hydro
Motif
Other DBs
NCBI-GeneID: 34945827
NCBI-ProteinID: XP_022838992
LinkDB All DBs
Position
5
AA seq 375 aa AA seqDB search
MSHARRKLIVDTDPGIDDAFALAIAAQTMREEIEIVGVTTMFGNVRRDEATRNAKLMTQL
TSIPGDERGFKVPVVDGSRVPIGMLAHGDREGRGAHDADDSQVFVADFVHADDGFGGARA
RVETEAFEKEKAYAYEAGKEAADFIAETCARYPGEVTVLALASLTNVALAFRRYPECLHT
MGELVVLGGAFSVNGNVNPAAEANILGDPNAADEVFRTFERTYVVGLDVTTRVQLHSSDL
ARLARPFHSDGNGDLNDGKKCSDRVRLFLHDAAQFYKEYHLNAAGLDGIYMHDPTALLLA
VPSIRNRVFTLHEGAVRVVTEGISRGQTILDVRRKWHVPNEWTSAPKCRVALDVDVDAAL
VELRSRLGCAPEDER
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgtcacacgcacgtcgcaagctcatcgtggataccgaccctgggatcgacgatgccttc
gcgctcgccatcgccgcacagacgatgcgcgaggagatcgaaatcgtgggcgtcacgacc
atgttcgggaacgttcgaagagacgaggcgacgcgaaacgccaagctcatgacgcagttg
acctcgattccgggagatgagcgcgggtttaaggtgccggtcgtggatggatcgagggta
ccgatcgggatgctcgcgcacggggaccgcgagggacgaggggcgcacgacgcggatgat
tcacaggtgttcgtggcggactttgttcacgcggacgacggcttcggcggcgctcgggcg
agagtggaaacggaggcgttcgagaaagagaaggcgtacgcgtacgaggctgggaaagag
gcggcggatttcatcgcggagacgtgcgcgaggtatccgggagaggtgacggtgctcgcg
ttggcttcgttgaccaacgtagcgttggcgtttcggcgctatccggagtgcttgcacacg
atgggagagctcgtcgtcctcggtggggcgttttctgtgaacggtaacgtgaatccagcc
gcagaggcgaacattttgggcgacccgaacgcggcagacgaggtgtttcgaacgtttgag
aggacgtacgtcgtcggactggacgtgacgacgcgtgtgcagttgcactcctctgatctc
gctcggttagcgcgtcctttccacagcgacggcaatggcgatttaaacgatggtaagaag
tgcagcgatcgcgtgcggcttttcctgcacgatgccgcgcaattctacaaggagtaccac
ctcaatgctgccggtttggacggcatatacatgcacgaccccacggcgctacttctggcc
gttccaagcattcgaaatcgcgttttcaccctccatgagggtgccgttcgcgtcgtcacc
gagggcatatcccgcggacagaccatattagacgtccgccgcaaatggcacgtccccaac
gagtggacctcggctccgaagtgccgcgtcgcgctcgacgtcgacgtcgacgccgccctc
gtagagctccgctccaggctcggttgcgcccccgaggacgagcgttga

DBGET integrated database retrieval system