KEGG   Ostreococcus tauri: OT_ostta06g00890Help
Entry
OT_ostta06g00890  CDS       T01358                                 

Definition
(RefSeq) SET domain
  KO
K11426  [histone H3]-lysine4/36 N-trimethyltransferase SMYD [EC:2.1.1.354 2.1.1.357]
Organism
ota  Ostreococcus tauri
Pathway
ota00310  Lysine degradation
ota01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ota00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    OT_ostta06g00890
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ota03036]
    OT_ostta06g00890
Enzymes [BR:ota01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.354  [histone H3]-lysine4 N-trimethyltransferase
     OT_ostta06g00890
    2.1.1.357  [histone H3]-lysine36 N-dimethyltransferase
     OT_ostta06g00890
Chromosome and associated proteins [BR:ota03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     OT_ostta06g00890
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET
Motif
Other DBs
NCBI-GeneID: 9835545
NCBI-ProteinID: XP_003079708
LinkDB All DBs
Position
6
AA seq 671 aa AA seqDB search
MASSTRPVPARGVALERFDAGMAVMIDGARVVERGVRAREGARAGEVLMVTEPYFAVLRE
RYVDAVSCATFKTIARDDAIVMVHCGIRERGRASDGAFESVVDEWARLLAQSSRGTPAAE
VRMAMGCLLRKRREDEGVIEKREYGLLGERGFAAIEALHEGVSARKDADGSDARRLDRVM
EISSAGVVTAALMAGTMRKGVTEDDIERAMTAMKEKYGIDAKSCVKLLSILEANGFSITQ
GDGDPDRLGFGIYPDASLFNHSSRANAQVSFIGKTLVVLATRDIAAMEEVTISYCDNYMS
QDWRRRNMLAGYGFDTYNAFGVENRKRADEARARAMSSASRRPLDGEVNDGHIEFGESVH
PSWESSMSAMMREECKITDKKDCGLGVHVDLGEDVDWFADELIPDRSLANDASWFALSHD
GVDYDAGVGIMLVKADGGRKDIFVRKDDEIVTWGKFPPGVDRELTALNFAMACDIIFKLR
MEIEEGAFEREDYSNSLPAAGESLAGENALMRLERVSEMLAGNGNDIAGVGSRHEVRKYL
WLTMLPIVYLPGVSKTQRGLTMALGATNSLRILYASCEDTFSPYDSAYMCFVFSCFKLGQ
LALHSDISTPGCDFIRVRSRVKNQILLYNELKTNMSKASAPGMEMHEEWAENYQVWGHDL
EMFYKKFTRRK
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgtcgacgcggcccgtcccggcgcgcggcgtcgcgctcgagcggttcgacgcg
ggaatggcggtgatgatcgacggcgcgcgcgtggtcgagcgcggcgtgcgcgcgcgagaa
ggggcgcgagcgggggaggtgttgatggtgacggaaccgtatttcgccgtcctgcgcgag
cgatacgtcgacgcggtgtcgtgcgcgacgtttaagacgatcgcgcgggacgatgcgatc
gtcatggtgcactgtgggatccgggagcgagggagggcgagcgatggggcgttcgagagc
gtggtggatgagtgggcgcgattgttggcgcaatcgagtcgcgggacgcccgcggcggag
gtgcgtatggcgatgggatgcctgcttcgaaagcgacgagaggacgagggagtgatcgag
aagcgagagtatggactattgggagaacgcgggttcgcggcgatcgaggctttgcacgag
ggcgtgagcgcgaggaaggacgcggatggctcggacgcgcgacggttggaccgggtgatg
gagatttcgtccgcgggcgtcgtcaccgcggcgttgatggcggggacgatgcggaagggg
gtgacggaggatgacatcgagcgcgcgatgacggcgatgaaggagaagtacgggatcgat
gcgaaatcgtgcgtgaagttgttgtcgattttggaggcaaacggattctccatcacgcag
ggtgacggcgatcccgaccgtctcgggtttgggatttatcccgacgcgtcgctgttcaat
cactcatcgcgcgcgaacgcacaggtatctttcatcggtaagacgctcgtcgttctcgcg
acacgagacatcgcggccatggaggaggtgacgatttcgtactgcgacaattacatgtcg
caggattggaggcgacgaaacatgctcgcggggtacggattcgacacgtacaacgcgttc
ggggtcgaaaatagaaaacgtgcggacgaggcaagagcacgcgcgatgagctcagcctcc
cgaaggcccttggacggtgaagtcaacgacggccacatcgaattcggcgagagcgtccat
ccgagctgggagagctcgatgagcgcaatgatgagagaagaatgcaagataaccgacaaa
aaagattgtggtctcggtgtgcacgtcgatttaggcgaggacgtcgattggttcgccgac
gagcttataccagatcgaagtctcgcgaacgacgcgtcgtggttcgcgctctcacacgac
ggcgtcgattacgacgcgggcgtgggaatcatgctcgtcaaagctgacggtggacgtaaa
gacattttcgtgcgtaaggatgacgaaatcgtcacctggggaaaattcccaccgggggtc
gatagagagctcacggcgctgaatttcgccatggcgtgcgacatcatcttcaaactacga
atggaaatagaggagggtgctttcgaacgagaagattattccaatagtcttcccgccgcg
ggagagtccctagctggagagaacgcactgatgagactcgagcgtgttagcgagatgtta
gcggggaacggcaacgacattgcaggcgtcggaagtcgacatgaagtgagaaaatatctg
tggttgacgatgttaccaatcgtgtacttgccaggggttagtaagacgcaacgtggatta
acgatggctttaggtgccactaattctcttcgaatcctctacgcatcctgcgaagatact
ttttcgccgtacgattccgcttacatgtgcttcgtgtttagctgtttcaagttgggacag
ctcgctctccactcggacatttctactccggggtgcgatttcatacgtgtgagatcgcgg
gtgaagaatcagattctgttgtacaacgagttaaagacgaacatgagcaaggcgagcgcg
ccgggaatggagatgcacgaggagtgggcagaaaattatcaagtatggggccacgacctc
gagatgttctacaagaagttcacgagacggaagtag

DBGET integrated database retrieval system