KEGG   Ostreococcus tauri: OT_ostta10g00640Help
Entry
OT_ostta10g00640  CDS       T01358                                 

Definition
(RefSeq) DNA ligase, ATP-dependent, conserved site
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
ota  Ostreococcus tauri
Pathway
ota03030  DNA replication
ota03410  Base excision repair
ota03420  Nucleotide excision repair
ota03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ota00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    OT_ostta10g00640
   03410 Base excision repair
    OT_ostta10g00640
   03420 Nucleotide excision repair
    OT_ostta10g00640
   03430 Mismatch repair
    OT_ostta10g00640
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ota03032]
    OT_ostta10g00640
   03400 DNA repair and recombination proteins [BR:ota03400]
    OT_ostta10g00640
Enzymes [BR:ota01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     OT_ostta10g00640
    6.5.1.6  DNA ligase (ATP or NAD+)
     OT_ostta10g00640
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     OT_ostta10g00640
DNA replication proteins [BR:ota03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    OT_ostta10g00640
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     OT_ostta10g00640
DNA repair and recombination proteins [BR:ota03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     OT_ostta10g00640
   NER (nucleotide excision repair)
    Other NER factors
     OT_ostta10g00640
   MMR (mismatch exicision repair)
    Other MMR factors
     OT_ostta10g00640
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase DUF3465 DDE_Tnp_IS66_C Presenilin
Motif
Other DBs
NCBI-GeneID: 9832013
NCBI-ProteinID: XP_003081499
LinkDB All DBs
Position
10
AA seq 778 aa AA seqDB search
MGQKTLAGFVTGAAVPEHASPETKSHDENDETTRGVQNVQKENQTKSPVKPSVRDDDVDK
EDEEALVRHRKRSASARSKTVMEEEDTDDDDSEDDEEAEDDEDDIEDVEIGEANVGKMKR
VEKAKKAKKEEAATAGVGDKSVEAADRYLEYDAESKVTWKRGDPTPYLYLANVFESISET
TKRLEIAELLTNAFRTILASRPGDLLAAVYLASNTIHPQHKGIDLGIGDATLIKALAEAT
GRKDESIKNDYRDAGDLGKVAMASRSTQRMMFPPPPLTVSGVLKEFRTIATTEGEKSVDR
KKALIKKLLVSARECEAGYVIRSLQGKLRIGLAQQTVTMALAHAIVLHGEAGKTKKGADL
ADALGAAFDTLKQVFSECPSFDEIVPALLEVGVEGLPERCKFTPGVPVKPMLAKPTTGVL
EVLKRFEDIAFTCEYKYDGERAQIHLQEDGKVSIFSRNQEDNTAKFPDLISGLQRYIKPH
VKSVVIDCEAVAYDREQDKILPFQILSTRGKKNIVESEIKVQVALYAFDCLYLNGEPLLR
EPMSKRREALYSAFEEVPGEFFFVTEKTSRDVEELQVFLDESIQANTEGLIVKTLDATYE
PSKRSLNWLKLKKDYMEGCGDSLDLVPIGAWVGRGKRTGVYGAYLLACYDEDGEEYQSIC
KIGTGFSEVVLEELANAMNPHVIDAPRSYYKVSDAMKPDVWFEPKQVWEVKAADLSISPV
HQAARGLVDPQKGIALRFPRFLRRREDKEPEMATNAEQVADFYNAQANKQEFDGVEED
NT seq 2337 nt NT seq  +upstreamnt  +downstreamnt
atggggcaaaaaacgctcgccgggttcgtcacgggcgccgccgtgcccgagcacgcgtca
ccggagacgaaatcgcacgacgagaacgatgaaacgacgcgaggcgttcaaaatgttcaa
aaggagaatcaaacgaaatcacccgtgaaaccgtccgtgcgcgacgacgacgtggacaag
gaggacgaggaggcgctggtgagacatcggaagcgatcggcgagcgcgcggtcgaagacg
gtgatggaggaggaagacacggatgatgacgattcggaagatgatgaagaggcggaggac
gatgaggacgacatcgaggacgtggagatcggtgaggcgaacgtggggaaaatgaagcga
gtggaaaaggcgaaaaaggcaaagaaggaggaggcggcgacagctggggtcggagataag
tcggttgaggcggcggatcgatatctagagtacgacgccgagtcaaaggttacgtggaag
cgcggagatccgacgccgtatttatacctcgcgaacgtgtttgagtccatatcggagacg
acgaagcggttagagattgcggagttgttgacgaacgcgttccgaacgattttggcgagc
agaccgggggatttgttggcggcggtgtatctggcgtcgaacacgattcatccacagcac
aaagggatcgatttgggaatcggagacgcgacgctcatcaaagccctggccgaggccacg
gggcgcaaagacgagtcgatcaagaacgattatagggacgcgggcgatctcggaaaggtg
gccatggcgagtcgatcgacgcagcgcatgatgtttcctcctccgccattgacagtgagc
ggcgtgcttaaggagtttcgtaccattgccaccacagagggagagaagagcgtcgataga
aagaaggcactcatcaaaaagcttctcgtgtccgcgcgtgagtgcgaggcgggatacgtc
attcgctcgcttcagggcaagctgcgcatcggtcttgcccaacagacggttacaatggcg
ctcgcgcacgccattgtgctccatggcgaagccggtaaaacgaaaaagggtgccgatctc
gccgatgcgctcggtgcggcgttcgacacgctcaagcaagtattcagcgagtgcccgtcg
ttcgacgagatcgtacctgcgcttctcgaggtgggcgtcgagggactacccgagcgatgc
aaattcactccaggcgttcccgtgaaaccgatgcttgccaagcccaccacgggtgtattg
gaggtcttaaagcgtttcgaagacatcgcgttcacgtgtgagtacaagtacgacggcgaa
cgcgcgcagattcacctgcaagaggatggtaaagtgtcaatcttctcgcgcaaccaagag
gacaacacagccaagtttccggatctcatcagcgggctgcagcgctacatcaagccgcac
gtaaaatcggtcgtgatcgattgcgaagccgtcgcgtacgatcgagagcaggacaaaatc
ttgcccttccagattttgagcacgcgcgggaaaaagaacatcgttgagtccgagatcaag
gttcaagttgcgttgtacgcgtttgattgcctgtacctcaacggcgagccgctcctgcgc
gaaccgatgagcaagcgccgcgaggctctgtacagcgcgttcgaagaggtcccgggtgag
ttctttttcgtcactgagaagacttctcgagacgtggaggagttacaggtcttcctggac
gagtccatacaggcaaacaccgaggggttgattgtcaagacgctggacgccacgtacgag
ccgtccaagcgatctctcaactggctcaaactcaagaaggattacatggaaggatgcggg
gactccttggatctggttccaataggcgcctgggtcggacgcggcaagcgcacgggcgtc
tacggcgcctacttgctcgcatgttacgacgaagatggagaggagtaccagtccatctgc
aaaataggcaccggtttctccgaagtcgtcctcgaggagttggcgaatgcgatgaatccg
cacgtcatcgacgccccgcgttcgtattacaaagtgtcggatgccatgaaaccggacgtg
tggttcgaacccaagcaagtgtgggaggtcaaggcggcggatttatccatctcgcccgtg
caccaagccgcgcgcggtttggttgatccgcaaaagggcatcgcgcttcgcttcccgcgc
ttcttacgtcgtcgagaggataaggagcccgaaatggcgacaaatgccgaacaggtggcc
gacttttacaacgcccaggcgaacaagcaggagttcgacggcgtggaagaggactaa

DBGET integrated database retrieval system