KEGG   Ostreococcus tauri: OT_ostta12g02960Help
Entry
OT_ostta12g02960  CDS       T01358                                 

Definition
(RefSeq) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
ota  Ostreococcus tauri
Pathway
ota00620  Pyruvate metabolism
ota00710  Carbon fixation in photosynthetic organisms
ota01100  Metabolic pathways
ota01200  Carbon metabolism
Module
ota_M00168  CAM (Crassulacean acid metabolism), dark
ota_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:ota00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    OT_ostta12g02960
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    OT_ostta12g02960
Enzymes [BR:ota01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     OT_ostta12g02960
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-GeneID: 9836069
NCBI-ProteinID: XP_003082445
UniProt: A0A1Y5IAS9
LinkDB All DBs
Position
12
AA seq 1000 aa AA seqDB search
MATHGVSHRRQGSLFASEEGEALEKLATTSSYLSGRGETKDFNAHDVIEECDALLQTIFF
SVVRETTSEEFLAKLQGVYDGSEAFGKTGEPKDFEAMKKLLETMEVDESLQFASAYSNLL
NLHNISEQVANAMEERHKRLDDIPRGPAKSTNGAIKGLIRSGKTIEEIYAALSRQHVDLV
LTAHPTQALRRSMLKAFGKVREKLLQLQRFRLSRFERAEILDEIRSNIAAAWRTDEIRRT
PPKPQDEMRAGLTYFQQTIWDCVPTFMRRVDTALLANGCGRLPLDRSIVTFGSWMGGDRD
GNPFVTSECTRDVVLLARVQGTNFLFSTIQKLLFELSMWRCNDTVKRLANDILATSETDK
NAIFEERKRRNYDDFWKAIPEHEPYRVILAMLRDKLYNTREALQKCVTDPNVSIDVNDDS
IIRTKEEIYEPLVACYESLIEVKDDQIANSLLLDVIRQVQCFGLGLVKLDIRQESDRHAE
ALDAVTRYIGLGSYIEWSEDQKIEWLTSELMSKRPLIPHDLECSADVREVLDTCKMIAHL
QQTCPGSLGTYVISMATSASDVLAVVLLQRECGCREKDVLRVAPLFERLDDLNDAPRVLR
QLFSVKWYLDHINGFQEVMIGYSDSGKDAGRMAAAWALYEGQERVVAAGNEFNVAMTLFH
GRGGTVGRGGGPAHIAMLSQPPGTVNGSIRVTVQGEVIESDFGERENCFHTLDLYTASVL
EHSLKPPSHPDDKWRAVMDRMSEYSCAHYRKTVFETPEFVQYFAQATPGSELGSLNIGSR
PAKRKPNAGVTALRAIPWIFAWTQSRFHLPVWLGISASFKRLIEEGELQTLRDMYKRWPF
FEVTIDLVEMVLAKADPVVVAYYEKALVDESLHDFGAKLRGELESSIDVILTVSEHIGLL
VQPEKTEENANEARRMQQKLKHKLEKRNLYITPLNVCQVRFLKQARALEHEEDGEKLSMR
KVKITMLEGYPFQDFNYKGAVNDVLKITMKGIAAGMQNTG
NT seq 3003 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgcacggggtgagtcatcgcaggcaagggtcgctgttcgcgagcgaggagggc
gaggcgctggaaaagctggcgacgacgtcgagttatctctcgggacgcggtgagacgaag
gatttcaacgcgcacgatgtgatcgaggagtgtgatgcgttgttgcagacgatattcttc
tccgtggtgagagagacgacgagcgaggagtttttggccaagctgcagggggtgtacgac
gggagcgaagcgttcggtaagactggggagccgaaggactttgaggcgatgaagaagctg
ctggagacgatggaggtggatgaatcgttacagtttgcgtcggcgtactcgaatctctta
aacttgcacaacatctccgagcaagtggcgaacgcgatggaggaaagacataagagattg
gacgacatcccacgagggccggcgaaatcgacaaacggcgcaatcaagggtttgattcga
tcgggaaaaacgatagaggagatctacgccgcgttgtcaaggcaacacgttgacctagtt
ctcaccgcgcatccgacgcaggcacttaggcgatccatgctgaaagctttcgggaaggtt
cgtgagaagctgctgcagctccaacgattccgtctctcacgcttcgaacgggctgaaatt
ttggatgaaattcgctcaaacatcgctgcggcttggcgaacggatgagatccgtcgcact
ccacccaagccacaggatgagatgcgcgctgggttgacgtactttcagcaaaccatctgg
gattgcgtgccgaccttcatgcgtcgcgtcgacaccgcgctcctggccaacggctgcggt
cgattaccgctcgatcgatcaatcgtgacgttcgggtcctggatgggaggtgatcgggac
ggtaacccattcgtgacctctgaatgcactcgggacgtcgtccttctcgcccgcgtccag
gggacaaacttcctcttctccacgatccaaaaattgctctttgagttgtccatgtggcgc
tgcaacgatacggtgaagaggctggctaatgatatcttagcaacctcggagacggacaaa
aatgcgattttcgaagaaagaaagagacgaaactacgatgacttttggaaagccatcccg
gagcacgagccgtatcgagtcattttggccatgcttcgcgacaaactctacaacacgcga
gaggcgctgcaaaaatgcgtcacagatccgaacgtgagcatcgacgtgaacgacgacagc
atcattcgaacgaaagaagagatttacgagcctctcgtggcgtgttacgagtctctcatc
gaggtcaaggacgatcagattgccaactcattactgctcgatgtcattcgtcaggtgcag
tgcttcggcctgggcctcgtgaaattggacattcgacaggaatccgatcgtcacgccgag
gcattggatgctgtgacgcgatacatcggtctcggttcttacatcgaatggagcgaagat
caaaagatagagtggttgacgagcgaactgatgagcaagcgtccgctcattccgcacgac
ctcgagtgctcagctgatgttcgtgaggttctggacacctgcaagatgattgcgcacctt
caacaaacctgcccgggttcgctcggtacctacgtaatttccatggcgacgagcgctagc
gacgtgctcgcagtagttttactgcagcgagagtgtggttgtagagaaaaggatgttctc
cgagtcgctccactcttcgagcgcctcgatgacttgaacgacgccccaagagttttgcgg
cagctcttctcagtgaaatggtatttggaccatatcaacggcttccaagaggttatgatc
ggttattccgatagtggcaaagatgcaggacgaatggccgctgcttgggcgctctacgag
ggacaggagcgcgtcgtggcggcggggaacgagttcaacgttgccatgactctgttccat
ggtcgtggcggcacggttggccgtggtggtggcccggcacacattgccatgctctcacaa
cctcccggaaccgtgaatgggagcattagagtcactgttcagggtgaggtgatcgaatcg
gatttcggcgagagggaaaattgcttccacaccctcgacttgtacacggcatccgtgttg
gagcactcgctcaagccgccgtcgcatcctgacgataagtggcgtgcagtgatggatagg
atgagcgagtattcgtgcgcacactataggaaaacggtgttcgagacgccggagtttgtg
cagtactttgcgcaagccacgccgggctcagaactcggttcgttgaacattggttctcga
ccagcgaagcgcaaaccgaacgcgggcgtcaccgcacttcgagccatcccatggattttc
gcctggacgcagtcgcgatttcatcttcccgtttggcttggaatctctgcttcgtttaag
cgtctcatcgaagagggcgagcttcagacacttcgagatatgtacaaaagatggcctttc
tttgaggtgactattgatctcgtggagatggttctcgccaaggcggatcccgtcgtcgtc
gcgtactacgaaaaggcccttgtcgatgaatctttgcacgattttggcgccaagcttcgc
ggggagcttgaatcgagcatcgatgtcattctgaccgtctccgagcacattggcttgctc
gtccaacccgagaaaacagaggagaacgcgaacgaagctcgaaggatgcagcagaagttg
aagcacaagctcgagaagcgcaacctgtatatcacacctctgaatgtgtgtcaggtccga
ttcctcaagcaagcgcgcgcgctcgagcacgaggaagacggtgaaaaattgagcatgcga
aaagtgaagatcaccatgctggagggatacccgttccaagacttcaactacaagggagcg
gtgaacgacgtgttgaagatcacgatgaaaggcatcgcggcggggatgcagaacacggga
tag

DBGET integrated database retrieval system