KEGG   Ostreococcus tauri: OT_ostta14g00080Help
Entry
OT_ostta14g00080  CDS       T01358                                 

Definition
(RefSeq) Succinate dehydrogenase/fumarate reductase,flavoprotein subunit
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
ota  Ostreococcus tauri
Pathway
ota00020  Citrate cycle (TCA cycle)
ota00190  Oxidative phosphorylation
ota01100  Metabolic pathways
ota01110  Biosynthesis of secondary metabolites
ota01200  Carbon metabolism
Module
ota_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ota_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:ota00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    OT_ostta14g00080
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    OT_ostta14g00080
Enzymes [BR:ota01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     OT_ostta14g00080
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 FAD_binding_3 Thi4 GIDA HI0933_like
Motif
Other DBs
NCBI-GeneID: 9837612
NCBI-ProteinID: XP_003082803
UniProt: Q00WK0
LinkDB All DBs
Position
14
AA seq 681 aa AA seqDB search
MFASTSRRALRRGCVGPVAALATGASAASTAAVSTASMASASSMASASARASVDARGGRS
WTNGARGGGRSRRSRDGFARAYSGTSASSAYEIIDHEYDALVVGAGGAGLRAAIGLGEHG
FKTACVTKLFPTRSHTVAAQGGINAALGNMTEDDWRWHAYDTVKGADWLGDQDAIQYMCR
EAPKAVIELEKYGMPFSRTDDGRIYQRAFGGQSLDFGKGGQAYRCAAAADRTGHAMLHTL
YGAALKHDVQFFVEYFALDLIMDKGECVGVMALCLEDGTLHRFRSHQTILATGGYGRAYF
SATSAHTCTGDGNAMVARAGLPLQDQEFVQFHPTGIYGAGCLITEGSRGEGGILRNSEGE
RFMERYAPSAKDLASRDVVSRAMTMEIREGRGVGKEKDHIYLHLNHLPPELLAERLPGIS
ETAAIFAGVDVTKEPIPVIPTVHYNMGGIPTNYKGEVVAPKNGDMDAIVPGLMAAGEAAC
ASVHGANRLGANSLLDIVVFGRACANTVSEKLKPGTPHRQIAADAGSNAVERLDKIRNSK
GSAPTAMLRRTMQKVMQDDAAVFRTQESLANGCKRIDDVAAQLDNLKLTDRSLVWNTDLV
EALELHNLMPNAQTTMHSAEQRKESRGAHAREDFPDRLDDTWMKHTLAYVENGKVKIDYR
PNHHYTLDDEMEVIPPKARVY
NT seq 2046 nt NT seq  +upstreamnt  +downstreamnt
atgttcgcctcgacgtccagacgcgcgctgcgacgggggtgcgtcggacccgtcgccgcg
ctcgcgacgggcgcgtcggcggcgtcgacggcggcggtgtccacggcgtcgatggcgtcg
gcgtcgtcgatggcatcggcgtcggcgcgcgcgtcggtggacgcgcgcggtggacgctcg
tggacgaacggtgcgcgcggggggggtcgatcgcgacgatcgcgcgatgggttcgcgcgc
gcgtactcggggacgtcggcgtcgtcggcgtacgagatcatcgatcacgagtacgacgcc
ctcgtcgtcggcgcgggcggcgccggtttgcgggcggcgatcggtctgggtgagcacggg
ttcaagacggcgtgcgtcacgaagttgtttccgacgcgatcgcacacggtggcggcgcag
ggtgggatcaacgccgcgctcgggaacatgacggaggacgattggagatggcacgcctac
gacacggtgaagggagcggattggctcggcgatcaagacgcgattcagtacatgtgtcga
gaggcgccgaaggctgtgatcgagctcgaaaagtacgggatgcccttctcgagaacggac
gacgggaggatttatcagcgcgcgtttggtgggcaatcgctcgatttcggcaagggtggg
caggcgtatcgatgcgcggcggcggcggaccgcaccgggcacgccatgttgcacacgctg
tacggcgccgcgttgaagcacgacgtgcaattcttcgtggaatacttcgcgttggatctc
atcatggacaagggtgagtgcgtgggtgtcatggcgctttgcctggaggacggaacgtta
cacagattccgctcgcatcagacaattttagccacgggcgggtacggtcgagcgtacttt
agcgcgacgtcggcgcacacgtgcacgggagatggtaacgccatggtcgctcgtgccggt
ctacccctgcaggaccaagagttcgtgcagttccacccaactggcatttacggcgccggc
tgtctcatcaccgagggttcgcgcggtgagggcggcatcctgcgtaactctgagggagaa
cgcttcatggagcgttatgctccgagcgccaaggatctcgcgagtcgagacgtcgtgtct
cgcgcaatgacgatggagattcgtgagggacgaggcgtgggtaaggagaaagatcacatc
tacttgcacttgaaccacctgcctccggagcttctggctgaacgtttgccgggcatctcc
gagacggcggcgattttcgccggtgtcgacgtcaccaaggagccgatcccggtgattccg
acggtgcactacaacatgggtggtattccgacgaattacaagggcgaggtcgtcgcgccg
aagaatggtgacatggacgccatcgtccccggtctcatggctgccggcgaagctgcgtgc
gcgagcgtgcacggcgccaaccgcctcggcgccaactcgttactcgacatcgtcgtcttc
ggtcgcgcgtgcgcgaacacggtctccgagaaactcaagccgggaacgccgcaccgccag
attgccgccgacgctgggtcgaacgcggtcgaacgtttggacaaaattcgcaactccaag
ggctcggcgccgacggcgatgctgcgcagaaccatgcaaaaggtgatgcaagatgatgcc
gccgtgtttaggactcaggaaagcctcgcgaacgggtgcaagcgcatcgatgacgtcgcc
gcgcagttggacaacctcaagctcaccgatcgatcgcttgtttggaacaccgatctcgtc
gaggcgctcgagttgcacaacctcatgccaaacgcgcagacgacgatgcactccgccgag
cagcgcaaggagagtcgaggcgcgcacgctcgcgaagattttcctgaccgtctcgacgat
acgtggatgaagcacaccctcgcttacgtcgaaaacggcaaggtgaagatcgactaccga
cccaaccaccactacacgctcgacgacgagatggaagtcattccgccaaaggcgcgcgtg
tattaa

DBGET integrated database retrieval system