KEGG   Opitutus terrae: Oter_4094
Entry
Oter_4094         CDS       T00689                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K20370  phosphoenolpyruvate carboxykinase (diphosphate) [EC:4.1.1.38]
Organism
ote  Opitutus terrae
Pathway
ote00620  Pyruvate metabolism
ote01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ote00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Oter_4094
Enzymes [BR:ote01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.38  phosphoenolpyruvate carboxykinase (diphosphate)
     Oter_4094
SSDB
Other DBs
NCBI-ProteinID: ACB77368
UniProt: B2A032
LinkDB
Position
5303653..5307090
AA seq 1145 aa
MPATPTPSHQQLLAYVNLKLRELSQPGVPVADNGLGDLVGNLLAVSRERSRALARHLAPV
DQRIQNFLFDYLESHVETPRLPATTLILDRQGIARTISLPVSRDDHQSPILTSRRVRQGV
LHNPRADRRTTQGIFHVAEGGLPVPADKKAVPVAVFGRLLKVALHPPAEFLRLPFTAGEP
EQAECFVSLHLRPTVVPAVPGFTPQRAMETRFFVPGSLVANLDFVESIFGNAGDPNLPEN
DAALDPERWTGHTGCVILAPHLNQLRKSDLGLPPWDQATERQRREGMCWKSPDELYNDGG
AFKITARNASGVIVTVISDNYFGYCKKEVKTQISFAANLLGRAEEEHAGGAIVFPSYDLG
EDFQLSTYVPVVDHTFAAALALLGNRVELQPDGWAKDRTNPTICYVPEDSRFDLRTQRIS
WSDGRGGSRTLKLLPDFTYVLPSGYKVEMLKPDRGRRWRLRGTTAEGVLCHKPCTVSGGG
KSEISKSIADATFNGPVFVNDLAHDLDTVDSILRRNYGDRFRDPSRKRPDGRPLLSPERS
LGSVVKLLSQSPDYTDAYNEWVGTIPGYIRDFVLIVKRAHKPEWGDDWRSHFSVDTINAR
PGNELKFERQRLLTHYLRVGFMRDGGWRTFTLRKDFIPAEKIQAEDDITASIVAPRDRVQ
GIPATATAPSLKLVHNCEERLFQRPDDAIIRGYDKHTERDFSRTGNFFSNYEPLDRAFAK
SVVEDTLAFEDFTAPIRRIFHDFLEQPGPDYLVSPAHPRLVDGKPSKNPRYLQRRPDLED
PRATYLAQMGARLYRRIPADQPVTFPVGAVLMGRRLNPPEPGVLPLCVYGPIHYQELPEA
FMDLISSLTGKSPSTTGAGSEGALTKGPFNALPPIFDLNAALVSYALTGLPVFSTAAGWV
GPHLRVDHDVSLLVPEIWARMSPAERDPQYLIEHGYLERCTDFEHAGQRVLASRLGWRIT
GRFVQAFCGRVLGNPSTVFEERFLRPEQQDRDIFVAGVSNIVEAMRTAAERYFTDGSIEQ
ACPPLRALLHLMRDGTWEGRDVEDPVVRALFTRESVLASDWYRARLEAQRSVDANLWERH
ARYLERFLKRRNYAAVAAELDVRGKFERVSALARAAQDPAYVDGLVGTLGVDPFLAAELA
KFPPQ
NT seq 3438 nt   +upstreamnt  +downstreamnt
atgcctgccacaccgacgccctcccaccagcagttgcttgcttatgtgaatctgaagctg
cgcgagctttcccaaccgggcgtgccggtggcggataacggcctcggcgatttggtgggc
aatctgctggcggtttcacgggaacgcagtcgcgcgctggcccggcacctcgcgcccgtc
gaccaacgcatccagaatttcctgttcgattatctcgaaagccacgtggagacgccgcgg
ctgccggcgaccacgttgattctggaccggcaggggatcgcgcgcaccatctcactgccg
gtctcgcgcgacgatcaccaaagcccgatcctcacctcgcgccgcgtacgccagggcgtg
ctgcacaacccacgtgccgaccgccgtaccacgcagggaatttttcacgtcgccgagggc
ggactgccggtgccggcggacaaaaaagccgtgccggtcgcggttttcggccggttgctc
aaggtcgcgctgcatccgcccgccgagttcctgcggttgccattcaccgccggcgaaccg
gaacaggccgaatgcttcgtgtccctgcacctccgcccgaccgtcgtgcccgccgtcccg
ggattcacgccgcagcgcgcgatggagacgcggtttttcgtccctggcagcctcgtagcc
aacctcgacttcgtcgagagcatcttcggcaacgcgggcgatccgaatctccccgagaat
gatgccgcgctcgatccggaacggtggaccggccacaccggctgcgtcattctcgcgccg
catctgaaccagctgcgcaaatcggatctgggtttgccgccgtgggatcaggccaccgaa
cggcagcgccgcgagggcatgtgctggaaatcgcccgacgagctctacaacgacggcggt
gctttcaagatcaccgcccgcaacgcctccggcgtgatcgtcacggtcatctccgacaac
tattttggctactgcaagaaggaggtgaagacccagatcagcttcgccgccaatctgctc
ggccgcgccgaggaggaacacgccggcggcgcgatcgtgttcccgagctacgacctcggc
gaagattttcaactcagcacgtatgtgccggtcgtcgatcacacctttgccgccgcgctc
gcgctgctgggcaatcgcgtggagttgcagccggacggctgggcgaaggaccgcaccaat
ccgacgatctgctacgtgcccgaggactcgcgctttgacctgcgcacgcagcgcatcagc
tggtccgatgggcgcggcggttcgcgcacgctgaagctcctgcccgatttcacctacgtg
ctgccctcgggctacaaggtcgagatgctcaagcccgaccgcggccgccgctggcggctg
cgcggcaccaccgcggaaggcgtgctctgccacaagccgtgcaccgtctccggcggcggc
aagtcggagatctcgaagtcgatcgccgacgcgacgttcaacggaccggttttcgtcaac
gacctcgcgcacgatctcgacaccgtggactcgattctccggcgcaattacggcgatcgc
ttccgtgatccgtcacgcaagcgccccgatggccggccgctgctgagccccgagcgctcg
ctcggctcggtcgtgaaactgctcagccagagccccgactacaccgacgcctacaacgag
tgggtcggcacgatccccggctacatccgcgacttcgtgctgatcgtgaagcgcgcgcac
aagccggaatggggcgacgactggcgcagccatttcagcgtagacacgatcaacgcccgc
ccgggcaacgaactgaagttcgagcggcagcgattgctcacgcactacctgcgcgtcggc
ttcatgcgcgacggcggctggcggaccttcacactgcgcaaggacttcatccccgcggaa
aagattcaggccgaggacgacatcaccgcgtcgatcgtcgccccccgcgaccgcgtgcag
ggaatcccggcgaccgcgaccgcgccgtcgctgaagctcgtccacaactgcgaggagcgg
ctgttccagcggccggacgacgcgatcatccgcggctacgacaagcacaccgagcgagac
ttcagccgaaccggcaactttttctcgaactacgaaccactcgatcgcgccttcgcaaaa
tccgtcgtcgaagacacgctggcattcgaggacttcacggcgccgatccgccggatcttt
cacgattttctcgagcagcccggaccggactacctcgtttcgcccgcgcatccgcgcctg
gtcgacggcaagccatccaagaatccgcgctatctgcagcgccggcccgatctcgaggat
ccgcgcgcgacctacctcgcgcaaatgggtgcgaggctctaccgccggatccccgccgat
cagcccgtgacgtttcccgtcggcgccgtgttgatgggccggcggctgaacccgcccgag
cccggcgtgctgccgctctgcgtttacggcccgattcactatcaggagttgccggaagcg
ttcatggacctgatttcgagcctcaccggcaagtcaccctcgaccacgggcgcgggctcc
gagggcgcgctcaccaaaggcccgttcaatgcgctccccccgatctttgatctcaacgcg
gcgctcgtgtcctacgcgctgaccggtctgccggtgttctccaccgccgccggctgggtc
ggaccgcatctgcgcgtcgaccacgacgtcagcctgctcgtcccggagatctgggcgcgc
atgtcgccagcggaacgcgacccgcaatatctgatcgagcacggttatctcgagcggtgc
accgattttgaacacgccggccaacgggtgctcgcgagtcggctgggctggcggatcacc
ggccggttcgtgcaggcgttctgcgggcgcgtgctgggcaatcccagcacggtcttcgag
gagcgctttctccggccggagcaacaggaccgcgacatcttcgtcgccggcgtgagcaac
atcgtcgaagcgatgcgcacggccgcggagcgttacttcaccgacggctcgatcgagcag
gcttgtccgccgctgcgcgcgctgctgcacctcatgcgcgacggcacgtgggaagggcgc
gacgtcgaggatccggtggtgcgcgcgctcttcacgcgtgaatcggtgctggcgagcgac
tggtatcgcgcgcggctcgaggcgcagcgcagcgtcgatgcgaacctctgggaacgccac
gcacgctacctcgaacgtttcctgaagcgccgcaactacgccgcggtcgccgctgagctg
gatgtgcgcggcaagttcgagcgcgtgtccgcgctcgcgcgggccgcacaggatccggcg
tatgtggacggccttgtcggcacgctcggcgtcgatcccttcctcgccgccgagctagcg
aagttcccgccgcagtag

DBGET integrated database retrieval system