KEGG   Ottowia oryzae: C6570_00195Help
Entry
C6570_00195       CDS       T05363                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
otk  Ottowia oryzae
Pathway
otk00473  D-Alanine metabolism
otk00550  Peptidoglycan biosynthesis
otk01100  Metabolic pathways
otk01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:otk00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    C6570_00195
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    C6570_00195
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    C6570_00195
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:otk01011]
    C6570_00195
Enzymes [BR:otk01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     C6570_00195
Peptidoglycan biosynthesis and degradation proteins [BR:otk01011]
 Precursor biosynthesis
  Amino acid ligase
   C6570_00195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4 ATPgrasp_ST ATP-grasp CPSase_L_D2 RimK TTL
Motif
Other DBs
NCBI-ProteinID: AVO32854
UniProt: A0A2S0MAE2
LinkDB All DBs
Position
complement(43740..44717)
Genome map
AA seq 325 aa AA seqDB search
MNQQGVQFGKVAVLMGGRSGEREVSLMSGQGVLAALRARGVDAHAFDPAERPMDDLKREG
FARCFIALHGRFGEDGTVQGALELLGIPYTGSGVMASSMAIDKVMTKRVWHAEGLPAPRH
VLLRRGEFTAEEVDAIPGKLGLPLIVKPAREGSSLGVTKVKSTDQIQSAVAAAIALDTDV
LCEQFIAGDEVTCPVLGEGAGATALPVIHIVAPDGEYDYQNKYFTDVTEYRVPCDLPAGE
EAAVQALVVDAYRVLGCRGWGRVDVMIDGATRQPYLLEVNTSPGMTSHSLVPMAAKAAGT
SYEDLCLELLANATLDYSPTAGGAQ
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaacaaggcgttcaattcggaaaagtggcagtgctcatgggcgggcgctcgggt
gagcgcgaggtttcgctcatgtccggccaaggcgttctggcggcattgcgcgcccgcggg
gtggacgcgcacgcgttcgatccggccgagcggccgatggacgacctcaagcgcgagggc
ttcgcccgctgcttcatcgcgttgcacggccgttttggcgaggacggcaccgttcagggt
gcgctggaactgctcggcattccctacaccggctcgggcgtgatggcttccagcatggcg
atcgacaaggtgatgaccaagcgcgtctggcacgccgagggcctgcctgcgccccgccac
gtgctgcttcgccgcggcgaattcaccgccgaagaggtggacgccatccccggcaagctg
ggtctgccgctgatcgtcaagcccgcgcgcgaaggctcgtcgctgggtgtcacgaaagtg
aagagcaccgaccagatccagtccgctgtggcggccgccattgcgctggacaccgatgtg
ctgtgtgagcagttcatcgccggcgacgaagtcacctgcccggtgctgggcgagggcgct
ggcgcgaccgcgctgcccgtcatccacatcgtcgcgcccgacggtgagtacgactaccag
aacaagtacttcaccgacgtcaccgagtaccgtgtgccctgcgatctgccggccggcgaa
gaggcggcggtgcaggcgctggtggtggacgcctaccgcgtgctcggctgccgcggctgg
ggccgtgtggacgtgatgatcgacggcgccacgcgccagccctacctgctggaggtcaac
acctcccccggcatgaccagccattcgctggtgcccatggccgccaaggcggcgggcacc
agctacgaagacctctgcctggaactgctggccaacgccacgctggattacagccccaca
gccggaggcgcgcagtga

DBGET integrated database retrieval system