KEGG   Ottowia oryzae: C6570_03085Help
Entry
C6570_03085       CDS       T05363                                 

Definition
(GenBank) glutathione transferase GstA
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
otk  Ottowia oryzae
Pathway
otk00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:otk00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    C6570_03085
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:otk02000]
    C6570_03085
Enzymes [BR:otk01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     C6570_03085
Transporters [BR:otk02000]
 Other Transporters
  Pores ion channels [TC:1]
   C6570_03085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_N_3 GST_N GST_N_2 GST_C_2 GST_C_3 GST_C_6
Motif
Other DBs
NCBI-ProteinID: AVO33350
UniProt: A0A2S0MC05
LinkDB All DBs
Position
655144..655749
Genome map
AA seq 201 aa AA seqDB search
MKLYYSPGACSLSPHIALEETGLPYEAILAPTKTKVLPDGSDYRKVNPLGYVPYLVVDDG
TGLREGPAIVQYIADQAPDKKLAPANGTMARYQLQSWLNFIGTEIHKGFGPLFNPAYPAE
VKKMATDKLLERLTWVDGELASKPYLMGEDFTVADGYLFTVTNWAKPMHIDLSGLKNLSA
YRERIAARPAVQRAMKAEGLI
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaaactttattactcccccggcgcctgttcgctgtcgccccacatcgcgctggaagaa
accggcctgccttacgaagccatcctggcgcccaccaagaccaaggtgctgcccgacggc
tcggactaccgcaaggtcaacccgctgggttacgtgccctacctggtggtggacgacggc
accggcctgcgcgaaggcccggccatcgtgcaatacatcgccgaccaggcgcccgacaag
aagctggcccccgccaacggcaccatggcgcgctaccagttgcaaagctggctgaacttc
atcggcaccgagatccacaaaggtttcggcccgctgttcaaccccgcctaccccgccgag
gtgaaaaagatggccaccgacaagctgctggaacgcctgacctgggtggacggcgagctg
gccagcaagccctacctgatgggcgaagatttcaccgtggcagacggctacctgttcacc
gtcaccaactgggccaagccgatgcacatcgacctgtcgggcctgaaaaacctgagcgcc
taccgcgaacgcatcgccgcgcgccccgccgtgcagcgcgccatgaaggccgaaggcctg
atctga

DBGET integrated database retrieval system