KEGG   Ottowia sp. KADR8-3: C6570_05885Help
Entry
C6570_05885       CDS       T05363                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
otk  Ottowia sp. KADR8-3
Pathway
otk00564  Glycerophospholipid metabolism
otk01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:otk00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    C6570_05885
Enzymes [BR:otk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     C6570_05885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored Pyr_redox_2 FAD_binding_3 HI0933_like NAD_binding_8 Pyr_redox GIDA 3HCDH_N Pyr_redox_3 Thi4 Lycopene_cycl F420_oxidored
Motif
Other DBs
NCBI-ProteinID: AVO33830
UniProt: A0A2S0MDC9
LinkDB All DBs
Position
1244790..1246415
Genome map
AA seq 541 aa AA seqDB search
MALDSPLPTDRAALLARLAEPKKYDIAIVGGGATGLGVALDAAQRGHSVVLIEARDFAKG
TSSRATKLVHGGVRYLAQGNVHLVREALHERVHILASAPHLAQPLAFVMPSYKLWETPFY
GMGLKMYDALAGSAGLGRTEWLNSRETLRQLPGAQPQGLKGGVKYWDGQFDDARLALAIA
RTAAQHGALLVNYCEAVDVLHDAGRAVGLVARDAETGREFRIQAGCVVNATGVWVDVLRE
RDAEAAGQTAAPLVAPSQGVHLVVDQSFSPGDHALLVPSTADGRVLFAVPWLGQLILGTT
DTPRTDVPLEPGATEPEVDFILREAGKYLKRAPTRADIKSRWAGLRPLVKPTVADGDTAA
ISREHTVLVGKSGMVTVTGGKWTTYRAMAADVLARCTQAGVLLPRGACATAGLHLVGAGG
AGGAQRVSITQPPGLHLYGSEAAQVNALPGADRWLAPGLSEAMVRFAVRHEYARTVEDVL
ARRSRQLFLDAAQAATAAPQVAAVLHEELGADGQLASFLELAAHYGANPRTQSGATIHAK
S
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atggccctcgattcgcccctgcccaccgaccgcgcggccctgttggcgcgcctggccgag
cccaagaagtacgacatcgccatcgtcggcggcggcgctaccggcctgggcgtggccctg
gacgcggctcagcgcgggcacagcgtggtgctgatcgaggcgcgcgacttcgccaagggg
acctcgtcgcgcgccaccaagctggtgcacggcggtgtgcgctacctggcacagggcaat
gtccacctggtgcgcgaagccttgcacgagcgcgtgcacatcctcgccagcgcgccgcac
ctggcgcagccgctggcttttgtcatgccgtcgtacaagctgtgggaaacgcctttctac
ggcatgggcctgaagatgtacgacgcgctggccggcagcgccggcctggggcgcaccgag
tggctcaatagccgcgagacgcttcgccagctgcccggcgcgcagccgcaggggctcaag
ggcggcgtgaaatactgggacggccagttcgacgacgcgcgcctggcgttggccattgcc
cgcacggccgcccagcatggcgcgctgctggtcaattactgcgaagccgtcgatgtgctg
cacgacgcgggccgcgccgtggggctggtcgcgcgcgacgccgagacggggcgcgaattc
cgcatccaggctggctgcgtggtcaacgccaccggcgtttgggtggatgtgttgcgtgag
cgcgacgccgaagcggccgggcaaaccgccgcgccgctggttgcgcccagccagggcgtg
catctggtggtcgaccaatccttctcgcccggcgaccacgccttgctggtgcccagcacc
gccgatggccgcgtgctgttcgccgtgccgtggctgggccagctcatcctgggcaccacc
gacacgccgcgcaccgacgtgcccctggagccgggcgcgaccgagcccgaagtcgacttc
atcctgcgtgaggccggcaaataccttaagcgagcgcctactcgcgcggacatcaagagc
cggtgggccgggctgcgcccgctggtcaagcccacagtcgcggacggcgacaccgctgcg
atcagccgggagcacaccgtcctggtcggcaaatcgggcatggtcaccgtcacgggcggc
aaatggaccacctaccgcgccatggctgccgacgtgctggcacggtgcacccaagcgggc
gtgctgctgccgcgtggcgcctgcgcaacggcgggcttgcacttggtgggggcgggtggc
gcaggaggcgcgcagcgcgtgtccatcacccagccgccggggctgcatctgtatggcagc
gaagccgcccaggtgaacgcgctgcccggcgccgaccgctggctggcgccggggctgagc
gaggcgatggtgcgctttgctgtgaggcatgagtacgcccgcacggtcgaggatgtgctg
gcaaggcgctctcggcagctgtttctggacgccgcccaggccgccacggccgcgccgcag
gtcgctgctgtcctgcatgaagagttgggcgctgacgggcagttggcttcgtttctggaa
ttggccgcgcactacggggcgaacccgcgcacacagtctggcgccacgattcacgcaaag
agttga

DBGET integrated database retrieval system