KEGG   Ottowia sp. KADR8-3: C6570_10640Help
Entry
C6570_10640       CDS       T05363                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
otk  Ottowia sp. KADR8-3
Pathway
otk00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:otk00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    C6570_10640
Enzymes [BR:otk01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     C6570_10640
Transporters [BR:otk02000]
 Other Transporters
  Pores ion channels [TC:1]
   C6570_10640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_2 GST_C_3
Motif
Other DBs
NCBI-ProteinID: AVO34631
LinkDB All DBs
Position
complement(2291179..2291868)
Genome map
AA seq 229 aa AA seqDB search
MPPTSPITVHHLNNSRSQRILWLLEELGLPYEVVRYQRDPQTMLAPPELKKIHPLGKSPV
VTVDGLTLAESGAIIETLVERYGDGRLAPPAGSAEAVRYRYWLHYAEGSAMPPLLLKLVF
GRIKKADMPFFAKPIADGIADKATASFIQPQIDQHLAFMEAELQQRDWFAGPEFTAADVQ
MSFPLEAAQSRAGLTAQSHPRLADWLARIHARPAYQRAVERGGEYALLG
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgccacccaccagccctatcaccgtccaccacctcaacaactcccgctcgcagcgcatc
ctgtggctgctggaagagctgggcctgccctacgaggtggtgcgctaccagcgcgacccg
caaaccatgctggccccgcccgagctgaagaagattcacccgctgggcaagtcgcccgtg
gtcacggtggacgggctgacgctggccgaatccggcgccatcatcgaaaccctggtcgag
cgctatggcgacggccgcctggcaccgccagcgggctcggccgaagcggtgcgctaccgc
tattggctgcactacgccgaaggctcggccatgccgccgctgctgctcaagctggtgttt
gggcgcatcaagaaggccgacatgccctttttcgccaaacccatcgccgacggcattgcc
gacaaggccacggccagcttcatccagccgcaaatcgaccagcacctggccttcatggag
gctgagctgcaacagcgcgactggttcgccggccccgaattcaccgccgccgacgtgcag
atgagcttcccgctggaggccgcgcaatcgcgcgccgggctgacggcgcagagccacccc
cgcctggccgactggctggcgcgcatccacgcccgcccggcgtaccagcgggcggttgag
cgtggcggcgaatacgcgctgcttggctga

DBGET integrated database retrieval system