KEGG   Ottowia oryzae: C6570_10930Help
Entry
C6570_10930       CDS       T05363                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
otk  Ottowia oryzae
Brite
KEGG Orthology (KO) [BR:otk00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    C6570_10930
Enzymes [BR:otk01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     C6570_10930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 HI0933_like FAD_oxidored NAD_binding_8 DAO Thi4 Glutaredoxin FAD_binding_3 NAD_binding_7 K_oxygenase Thioredoxin_4 AlaDh_PNT_C NAD_binding_9 DSBA VGPC1_C
Motif
Other DBs
NCBI-ProteinID: AVO34680
UniProt: A0A2S0MFP6
LinkDB All DBs
Position
complement(2369385..2370989)
Genome map
AA seq 534 aa AA seqDB search
MLDDDIKQQLAAYLERVQQPFEMVATLGTDAKSTEMRELLQEIAGMRPDKITLRTDGQDA
RVPSFSLNRVGSDMKLRFAAIPLGHEFTSLILALLWTGGHPPKVEADVLEQIQNLDADLN
FEIYMSLSCHNCPDVVQALSLMAIYNPRVKTTVIDGGMFQKEIEEREIMGVPTVYLNGEF
FANGRMSVEEIVQKVDTGAAKRDAEKLSAKAPYEVLIVGGGPAGAAAAIYAARKGIRTGV
VAERFGGQVNDTMEIANYPGVPETDGPHYAAALEQHVRNYEVDIMNTQRVAELVPAAQPG
GLITVKLDNGGTLKSRTVILATGARWRNVNVPGEQEYKTKGVAYCPHCDGPLFKGKDVAV
IGGGNSGVEAAIDLAGVVKHVHVVEFMPELKADQVLVKKLHSLPNVTVHTNKQTTEIHGT
DGKVSSLDFKCREKGTLTQVPLEGVFVQIGLVPNTEWLGTTVERSKFGEIVIDAKGTTSV
PGVFAAGDCTTVPYKQIVVAAGSGSTAALSAFDYLIRTPAPAASAPAAAETVAA
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgacgacatcaagcaacaacttgccgcctatctggagcgcgtgcagcaaccg
ttcgagatggtggccacgctgggcacggacgccaagtccaccgaaatgcgcgaactgctg
caagaaattgccggcatgcgccccgacaagatcaccctgcgcaccgacgggcaggacgcg
cgcgtgccctccttcagcctgaaccgcgtgggcagcgacatgaagctgcgctttgccgcg
attccgctggggcatgagttcacatcgctgatcctggcgctgctgtggacgggcggccac
ccgcccaaagtggaggccgacgtgctggagcagatccagaacctcgacgcagacctcaac
ttcgagatctacatgagcctgtcgtgccacaactgcccagacgtggtgcaggcgctgtcg
ctgatggccatctataacccgcgcgtcaagacgacggtcatcgacggcggcatgttccag
aaggaaatcgaagagcgcgagatcatgggcgtgcccaccgtgtacctgaacggcgaattc
ttcgccaacgggcgcatgagcgtcgaagagatcgtgcaaaaagtggacacgggcgccgcc
aagcgcgacgccgagaagctgagcgccaaggcgccctatgaagtgctgatcgtcggcggt
ggccctgctggcgccgcagcggccatctacgcggcacgcaaaggcattcgcaccggcgtg
gtggccgagcgctttggcggccaggtgaacgacacgatggaaatcgccaactaccccggc
gtgcccgaaaccgacggcccccactacgccgccgcgctggagcagcacgtgcgcaactac
gaggtggacatcatgaacacccagcgcgtggccgaactggtgcccgcggcgcagccgggc
ggcctgatcaccgtgaagctggacaacggcggcacgctgaagagccgcaccgtgatcctg
gccaccggcgcgcgctggcgcaacgtgaacgtgccgggcgagcaggaatacaagaccaag
ggcgtggcctactgcccgcactgcgacggccccttgttcaagggcaaggacgtggcggtg
atcggcggcggcaactccggcgtggaagcggctattgacctggctggcgtggtcaagcac
gtgcacgtggtcgagttcatgcccgagctgaaggccgaccaggtgctggtcaaaaagctg
cacagcctgcccaacgtgacggtgcacaccaacaagcagaccacagagatccacggcaca
gacggcaaagtcagctcgctggacttcaaatgccgcgaaaaaggcacgctgacccaggtg
ccgctggaaggcgtattcgtgcagatcggcctggtgcccaacaccgaatggctgggcacg
acggtggagcgcagcaagttcggcgagatcgtgatcgacgccaaaggcaccaccagcgtg
ccgggtgtgttcgcggccggcgactgcaccacggtgccgtacaagcagatcgtggtggcg
gccggctcgggttcaaccgccgcgctgagcgcgttcgactacctgatccgcacgcctgcg
ccggccgccagtgcgcctgcagccgccgagacagtggctgcctga

DBGET integrated database retrieval system