KEGG   Octadecabacter temperatus: OSB_23790Help
Entry
OSB_23790         CDS       T04001                                 

Gene name
tdk
Definition
(GenBank) Thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
otm  Octadecabacter temperatus
Pathway
otm00240  Pyrimidine metabolism
otm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:otm00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    OSB_23790 (tdk)
Enzymes [BR:otm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     OSB_23790 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_30 AAA_22 AAA_14
Motif
Other DBs
NCBI-ProteinID: AKS46915
UniProt: A0A0K0Y7M3
LinkDB All DBs
Position
2326928..2327524
Genome map
AA seq 198 aa AA seqDB search
MAKLYFNYSTMNAGKSTVLLQAAHNYAERGMQTYLLTAQFDNRAGEGRIASRIGIGEAAD
TFSISDDLFRKIEGRLGKGPCACVFIDEAQFLSSDQVWQLARAVDDLGVPVMAYGLRVDF
QGELFPGSATLLALADEMREVRTICFCGKKATMVVRKDANGDVVTGGNQVQIGGNESYVS
LCRRHWREAMDDGDDTLV
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggctaaactttatttcaactactcaacgatgaacgctggcaaatcgactgttttgctc
caagcggcgcataactatgccgaacgcggcatgcagacctacctgcttacggcgcaattc
gacaaccgcgcgggcgaaggacgaatcgccagtcggatcgggattggcgaagcagcagat
acgttttccatcagcgatgatcttttccgcaaaatcgagggccgccttggcaaaggccct
tgcgcttgcgtgtttatcgacgaggcacagttcctgagttccgatcaagtctggcagctt
gcccgcgcggttgatgaccttggcgttccggtcatggcatacggtctgcgtgttgatttc
caaggagagctattccccggctctgcaacgcttctcgcgctggctgatgaaatgcgcgaa
gtcaggactatctgtttttgcggtaaaaaagccacgatggtggtgcgcaaagatgcgaat
ggcgatgtggttaccggcggcaatcaagttcagattgggggcaacgagtcctacgtcagc
ctgtgccgccgtcattggcgcgaagcgatggacgatggcgacgacacgttggtttaa

DBGET integrated database retrieval system