KEGG   Ottowia sp. oral taxon 894: ADJ79_02165Help
Entry
ADJ79_02165       CDS       T04031                                 

Definition
(GenBank) malate dehydrogenase
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
oto  Ottowia sp. oral taxon 894
Pathway
oto00020  Citrate cycle (TCA cycle)
oto00270  Cysteine and methionine metabolism
oto00620  Pyruvate metabolism
oto00630  Glyoxylate and dicarboxylate metabolism
oto00680  Methane metabolism
oto01100  Metabolic pathways
oto01110  Biosynthesis of secondary metabolites
oto01120  Microbial metabolism in diverse environments
oto01130  Biosynthesis of antibiotics
oto01200  Carbon metabolism
Module
oto_M00009  Citrate cycle (TCA cycle, Krebs cycle)
oto_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:oto00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ADJ79_02165
   00620 Pyruvate metabolism
    ADJ79_02165
   00630 Glyoxylate and dicarboxylate metabolism
    ADJ79_02165
  09102 Energy metabolism
   00680 Methane metabolism
    ADJ79_02165
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    ADJ79_02165
Enzymes [BR:oto01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     ADJ79_02165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_N Ldh_1_C Glyco_hydro_3_C
Motif
Other DBs
NCBI-ProteinID: AKU66335
UniProt: A0A0K1NB78
LinkDB All DBs
Position
complement(513201..514187)
Genome map
AA seq 328 aa AA seqDB search
MSKKPVRVAVTGAAGQIGYALLFRIASGEMLGKDQPVILQLLEIPDEKAQKALKGVMMEL
QDCAFPLLAGMQAHSDPMTAFKDADYALLVGARPRGPGMERSDLLAANAQIFTAQGKALN
AVASRNVKVLVVGNPANTNAYIAMKSAPDLPAKNFTAMLRLDHNRAASQIAEKTGKPVKD
IKKLTVWGNHSPTMYADYRFATIDGQSVKDMINDQEWNANVFLPTVGKRGAAIIEARGLS
SAASAANAAIDHMRDWALGTNGEWVTMGIPSQGWYGIPQGVVFGFPVTCENGEYKVVEGL
EIDAFSQERINKTLAELQGEQEGVKHLL
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaaaacccgtccgtgttgccgtgactggcgcagcaggccagattggctatgcc
cttctgtttcgcatcgcttctggcgaaatgctgggcaaagatcagcctgtcatcctgcaa
ttgcttgaaattcccgatgaaaaagcccaaaaggccctcaagggcgtgatgatggagctg
caagactgcgctttccctttgctggcaggcatgcaggcgcattctgatccgatgacggcc
ttcaaggatgcggattacgccctgctggtgggcgcgcgcccgcgcggccccggcatggaa
cgctccgacttgctggccgccaatgcacaaatcttcacggcccaaggcaaggcgctgaac
gccgtcgccagccgcaacgtgaaagtgctcgtggtcggcaaccccgccaacaccaatgcc
tacatcgccatgaaatcggcccctgatctgccggccaagaacttcaccgccatgctgcgg
ctggatcacaaccgcgccgccagccagattgccgaaaaaacgggcaagccggtcaaggac
atcaaaaagctcactgtctggggcaaccactcccccaccatgtatgccgattaccgcttc
gccaccattgacgggcagagcgtgaaagacatgatcaacgaccaggaatggaacgccaat
gttttcctgcccaccgtgggcaagcgcggcgcggccatcatcgaagcgcgcggcctgtct
tcggcagccagcgctgccaacgcggccattgaccacatgcgcgactgggcgctgggcacg
aatggcgaatgggtcaccatgggcattccctcgcaaggctggtacggcattccgcaaggc
gtggtcttcggttttcccgtgacctgcgaaaacggcgaatacaaagtggtcgaggggctg
gaaatcgacgctttcagccaggagcgcatcaacaagacgctggccgaactacaaggcgag
caagaaggcgtcaagcacttgctgtaa

DBGET integrated database retrieval system