KEGG   Ottowia sp. oral taxon 894: ADJ79_03980Help
Entry
ADJ79_03980       CDS       T04031                                 

Definition
(GenBank) cell division protein
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
oto  Ottowia sp. oral taxon 894
Pathway
oto00550  Peptidoglycan biosynthesis
oto01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:oto00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ADJ79_03980
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    ADJ79_03980
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:oto01011]
    ADJ79_03980
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:oto03036]
    ADJ79_03980
Enzymes [BR:oto01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     ADJ79_03980
Peptidoglycan biosynthesis and degradation proteins [BR:oto01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   ADJ79_03980
Chromosome and associated proteins [BR:oto03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    ADJ79_03980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: AKU68000
UniProt: A0A0K1NG18
LinkDB All DBs
Position
936121..937842
Genome map
AA seq 573 aa AA seqDB search
MKTPVWRSRFIMAGLALVFLGLVGRAIHVQVLSKEFLQQKGEVHLVTTMSLPATRGRILD
RNGQILASSIVTVSVAARPRQVREEDGIKRAQLAKILDVPQAELDRKLDDVSKNFVWLKR
YLDASVAAEVAALKMKGLEVQRDFFRKYPEGAAAAHVVGFAGDSNVGLEGAERLYEKELA
GRPGSRRVIRDQLGHVIEVVGEEEPPVDGQDVYLSIDARIQAYAYRKLRDAVMQHKARAG
SVVALDALTGEIIAMVNYPSYEPEEWPNREKWKKAGQERFRNMALAEAFEPGSSMKPVTV
AMALDAGQVTPQTLINTAPGYYQLDRFTIRDVHNYGTLTVEGVIKKSSNVGSLKISQKLQ
PQQMWDSYTALGFGQRPEIGLKGAALGRLRPWKQWRPTEKATMSYGYGLSASLVQLARAY
SAFAGDGHVTRLRLNRVDENHPLEQGARVFTAKTAGAIRKMLQMATGPGGTGQQAQTDSY
SVGGKSGTARKLVGRSYGDGKYRSWFVGMAPVSDPKLVIVVMIDEPSSGGYYGGLVAAPL
FSLVTEQALRTLGVQPDLKVKPQIVSDAAEESM
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgcccgtgtggcgcagccgcttcatcatggccggcctggccctggtctttctg
gggctggtcgggcgcgccattcatgtgcaggtgctgagcaaggaatttctccagcaaaaa
ggcgaggtgcacttggtcaccacgatgagcctgcctgccacgcgcgggcgcattctggac
cgcaatgggcaaatcctggcctcttccatcgtgaccgtgagcgtggcggcgcgcccgcgc
caggtgcgcgaggaagacggcatcaagcgcgcgcagctggcaaaaattctggacgtgccg
caggccgagctggaccgcaagctcgacgacgtgagcaagaacttcgtctggctgaagcgc
tatctggacgcctcggtggccgccgaagtggccgcgctcaagatgaaggggctggaagtg
cagcgcgacttcttccgcaaataccccgaaggcgctgccgccgcccacgtggtggggttt
gcgggagacagcaatgtggggctggaaggcgccgagcgcctgtatgaaaaggagctggcg
ggccgtcccggctcgcgccgcgtcatccgtgaccagctgggccacgtgatcgaggtggtg
ggcgaagaagagccgccggtggacgggcaggatgtgtatctgtccattgacgcgcgcatc
caggcctacgcctaccgcaagctgcgcgatgccgtcatgcagcacaaggcgcgcgccggc
agcgtggtggcgctggatgcgctgacgggcgaaatcatcgccatggtcaattaccccagc
tacgagccggaagagtggccgaaccgcgagaagtggaaaaaggccgggcaggagcgcttt
cgcaacatggcgctggccgaagcgttcgagcctggctccagcatgaagcccgtgacggtg
gccatggcgctggacgccgggcaagtgacgccgcagacgctcatcaacaccgcgcccggc
tactaccagctggaccgcttcaccatccgcgacgtgcataactacggcacgctcacggtg
gaaggcgtgatcaagaagtccagcaacgtcggctcgctcaagatttcgcaaaagctccag
ccccagcaaatgtgggacagctacaccgcgctgggcttcggccagcggcccgaaatcggc
ctcaagggcgcggcgctgggccgcttgcgcccctggaagcagtggcggcccacggaaaag
gccaccatgtcgtacggctacggcctctcggcctccctggtgcagctggcgcgcgcctat
tcggcctttgccggagacgggcatgtcacgcgcctgcgcctgaaccgcgtggacgaaaac
cacccgctggagcagggcgcgcgggtgttcaccgccaagacggccggcgccatccgcaag
atgctgcaaatggccaccggcccaggcggcacggggcagcaggcgcagactgacagctac
tccgtgggcggcaaatccggcacggcccgcaagctggtgggccgctcttatggcgatggc
aaataccgctcgtggttcgtgggcatggcgcccgtcagcgacccgaagctggtcatcgtc
gtgatgattgacgagccaagcagcggcggctactacggcggcctggtggccgcgcccctg
ttcagcctggtcaccgagcaggcgctgcgcacgctgggcgtgcagcccgacctgaaagtc
aagccgcaaatcgtgagcgacgcggcagaggagtccatgtga

DBGET integrated database retrieval system