KEGG   Ottowia sp. oral taxon 894: ADJ79_10125Help
Entry
ADJ79_10125       CDS       T04031                                 

Definition
(GenBank) dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
oto  Ottowia sp. oral taxon 894
Pathway
oto00020  Citrate cycle (TCA cycle)
oto00310  Lysine degradation
oto00380  Tryptophan metabolism
oto01100  Metabolic pathways
oto01110  Biosynthesis of secondary metabolites
oto01120  Microbial metabolism in diverse environments
oto01130  Biosynthesis of antibiotics
oto01200  Carbon metabolism
Module
oto_M00009  Citrate cycle (TCA cycle, Krebs cycle)
oto_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:oto00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ADJ79_10125
  09105 Amino acid metabolism
   00310 Lysine degradation
    ADJ79_10125
   00380 Tryptophan metabolism
    ADJ79_10125
Enzymes [BR:oto01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     ADJ79_10125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-ProteinID: AKU67485
UniProt: A0A0K1NEH0
LinkDB All DBs
Position
complement(2292303..2293553)
Genome map
AA seq 416 aa AA seqDB search
MAIVEVKVPQLSESITEATLLQWKKKPGEAVQADEILIEVETDKVVLEVPSPAAGVLTEI
IQPDGATVTADQLLAKIDTEAVAGAAAAAPAPASAAAAPAPAASAAAPASNSKAGIAMPA
AAKLMADNNLPAGSVPGTGKDGRVTKGDVLGAVASGAKPAAIPTGVPTASLPQVSGPAAP
DLGSRPEQRVPMTRLRARVAERLLQSQATNAILTTFNEVNMAPVMELRKKFQDAFVKEHG
VKLGFMSFFVKAAVHALKKFPVINASVDGNDIVYHGYFDIGIAVGSPRGLVVPILRNADQ
MSFADIEKKIAEFGQKAKDGKLGIEEMTGGTFSISNGGTFGSMMSTPIINPPQSAILGVH
ATKERAVVENGQIVIRPMNYLAMSYDHRIIDGREAVLGLVAMKEALEDPARLLFDI
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atggcaatcgtcgaagtcaaggtgccccagctttctgaatccatcaccgaagccacgctg
ctgcaatggaagaaaaagccgggcgaagccgttcaggccgatgaaatcctgatcgaagtc
gaaaccgacaaagtcgtgctggaagtgccctctccagccgcaggcgtgctcaccgaaatc
atccagcccgatggcgccaccgtcaccgccgatcaactgctggccaagattgataccgaa
gccgtggcaggcgctgccgcagcggctcccgctcctgcttcagcggcagctgcgcctgct
cccgccgccagcgccgctgccccggccagcaacagcaaggcgggtatcgccatgccggcc
gccgccaagctcatggccgacaacaacctgcccgcaggcagcgtgcccggcaccggcaag
gatggccgcgtgaccaagggcgacgtgctcggcgctgtcgccagcggagccaaacccgcg
gccatcccgaccggcgtgcccacggccagcctgccgcaagtcagcggcccggccgcgccc
gatctgggcagccgccccgagcagcgcgtgcccatgacgcgcctgcgcgcccgtgtggcc
gagcgcctgctgcaatcgcaggctaccaacgccatcctcaccaccttcaacgaagtgaac
atggcccccgtcatggaactgcgcaagaagttccaggacgccttcgtcaaggagcacggc
gtcaagctcggcttcatgtccttcttcgtcaaggcggcggtgcacgcgctcaagaaattc
ccggtcatcaacgccagcgtggacggcaacgacatcgtctatcacggctatttcgacatt
ggcattgccgtgggcagcccgcgcggcctggtcgttcccattctgcgcaacgccgaccag
atgagctttgccgacatcgaaaagaagattgccgaattcggccagaaagccaaggacggc
aagctgggcattgaggaaatgaccggcggcaccttctccatcagcaacggcggcaccttc
ggctccatgatgtccacccccatcatcaacccgccgcaatcggccattctgggcgtgcac
gccaccaaggaacgcgccgtggtggaaaacggccagatcgtcatccgccccatgaactac
ctggccatgagctacgaccaccgcatcatcgacggccgcgaagccgtactggggctggtg
gccatgaaagaggcgctggaagacccggcacgactgctgttcgatatctga

DBGET integrated database retrieval system