KEGG   Orientia tsutsugamushi Boryong: OTBS_2173Help
Entry
OTBS_2173         CDS       T00531                                 

Gene name
pbpA1
Definition
(GenBank) Penicillin-binding protein
  KO
K05515  penicillin-binding protein 2 [EC:3.4.16.4]
Organism
ots  Orientia tsutsugamushi Boryong
Pathway
ots00550  Peptidoglycan biosynthesis
ots01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:ots00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    OTBS_2173 (pbpA1)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    OTBS_2173 (pbpA1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ots01011]
    OTBS_2173 (pbpA1)
Enzymes [BR:ots01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     OTBS_2173 (pbpA1)
Peptidoglycan biosynthesis and degradation proteins [BR:ots01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   OTBS_2173 (pbpA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer PPTA
Motif
Other DBs
NCBI-ProteinID: CAM81268
UniProt: A5CFP8
LinkDB All DBs
Position
2118743..2120491
Genome map
AA seq 582 aa AA seqDB search
MLNNKVHQNRLINRRAFLLLIGKLGLLCMLAGRLFHLQIFQSSKYKILSDKNRINIVLLI
ARRGKILDCNGNVLAFNKRAYQIKANKKTLAQNQYFALDLLYDILNFSHEKREKINQKIL
ASKNLYEVLIMDNISWDELAAIEENSLNLPGIYIDCMEYRTYTYPLSTSHILGYTAWPND
AERVNLNIEHTRIQIGKRGLEKHFEEDLRGTCGFEKIEVDARGLKVRELDTIPSIPGKDI
ALSIDVNLQNKLYEMFDDRVGAAILTDVNTGKIKALVSVPGYNINAFPRRISTKDWKALL
DNPNLPLVSRASQSLYPPGSIFQLVTVLAALEAGVNSKLTVYCNGKSFMNETNFSCWNHR
GHGNIDMLSAIKYSCNSYIYHLASLIGYNAILAMARKLGFWRRAVVNLPNELVGNLPTPE
WKKRKTKQRWMLGDTLNMAIGQGYITTTPLQLARMITSIANGKQLLQLSLTLDEDGYHKN
LNINACYIDFIHQALKAVINNESSGTAYSLDSDKTKLMISGKTGSAQVGSSLQSQAHGLF
VGFSTTNKPEYAVAVILEHGGQIGIKSAATIAKSILIEASTL
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atgttgaataacaaagtacatcaaaatagattgattaatcgcagagcttttctattattg
atagggaaattaggtctattatgtatgttagctggtagactttttcacttgcaaattttt
caatctagtaaatataaaattttatcagataaaaataggattaatattgtattattaata
gctaggagaggcaaaattttagattgtaatggtaatgttttagcatttaataagcgtgct
tatcaaattaaagcaaataagaagactctagctcaaaatcaatattttgctcttgattta
ctatatgatattttaaattttagtcacgaaaagcgcgaaaaaattaaccaaaaaatactt
gctagtaaaaatctttatgaagttcttattatggataatatttcatgggatgagctagct
gcaatagaagaaaattcattaaatttaccaggtatatacattgattgtatggaatataga
acctatacttatccattatcaacatcacatattttaggttatacagcatggcctaatgat
gctgaaagggtaaatttaaatatagaacacactaggattcaaattggaaaaagaggtctt
gaaaaacattttgaagaggatcttaggggaacttgtggctttgaaaagattgaagtagat
gctagaggcctaaaggttagagagcttgatactatacctagtattcctggtaaggatata
gcattaagcattgatgttaatttgcaaaataaactttatgagatgtttgatgatagagta
ggggctgcaatattaactgatgtaaatactggaaagattaaagctctagtttcagttcca
ggttataatattaatgcctttcctagaagaattagtacaaaggactggaaagcgcttcta
gataatcctaatctaccattggttagtcgtgcttcacaatcattatatcctcctggttca
atatttcaattagtaaccgtacttgcagctttagaagcaggagttaattctaagttaact
gtgtattgtaatggtaaaagctttatgaatgagactaattttagctgttggaatcatcgt
gggcatggtaatattgatatgcttagtgcaattaaatattcgtgtaatagttatatttat
catcttgctagtttgattggctataatgctattttagcaatggctagaaagttaggattt
tggagaagggctgtagtaaatcttccgaatgagctagttggaaatttacctacgccagaa
tggaaaaaacgaaaaacaaaacaacgatggatgttaggtgatacactgaatatggctatt
gggcaaggatatattactactactcctttgcaattagcaagaatgattactagcattgct
aatggcaagcaattattgcagttaagtttgactttagatgaagatggttatcataaaaat
ttgaatattaatgcatgttatattgactttattcatcaagctttaaaggctgttattaat
aatgaaagtagtggtactgcttattctttggatagtgataaaactaagctaatgatttca
ggtaaaacaggtagtgctcaagtaggatcatctttgcaaagtcaagctcatgggttattt
gttggattctctactactaataagcctgaatatgctgttgcagtgattttagaacatggt
ggacaaatcggaattaaatctgcagctacaattgctaaaagtattttgattgaagcatca
actttataa

DBGET integrated database retrieval system