KEGG   Orientia tsutsugamushi Ikeda: OTT_1955Help
Entry
OTT_1955          CDS       T00705                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
ott  Orientia tsutsugamushi Ikeda
Pathway
ott00020  Citrate cycle (TCA cycle)
ott00190  Oxidative phosphorylation
ott00650  Butanoate metabolism
ott01100  Metabolic pathways
ott01110  Biosynthesis of secondary metabolites
ott01120  Microbial metabolism in diverse environments
ott01130  Biosynthesis of antibiotics
ott01200  Carbon metabolism
Module
ott_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ott_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ott_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ott00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    OTT_1955 (sdhA)
   00650 Butanoate metabolism
    OTT_1955 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    OTT_1955 (sdhA)
Enzymes [BR:ott01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     OTT_1955 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     OTT_1955 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: BAG41413
UniProt: B3CVL6
LinkDB All DBs
Position
complement(1993097..1994884)
Genome map
AA seq 595 aa AA seqDB search
MKAYKIINHEFDVVVVGAGGAGLRAIVGMAESGLRAACITKLFPTRSHTVAAQGGISAAL
GNIQPDKWQWHAYDTIKGSDWLGDQDAIAYMCKEAPAAIIELEHYGVPFSRTTDGKIYQR
PFGGMTTEFGDGAAAVRTCAAADRTGHAILHTLYQQALKHKAKFFIEYIALDLIMDNGAC
KGIVAWNLDDGTIHCFRSHIVVLATGGYGRAYFSATSAHSCTGDGNAMCARAGIALQDME
FVQFHPTGIYGAGCLITEGARGEGGYLVNSEGERFMERYAPSAKDLASRDVVARAMTMEI
NAGRGVGIYKDHIFLHLNHLDSKTIQQRLPGISETAMIFAGVDVTKQPIPVIPTVHYNMG
GIPTNYHGQVVTKTENGDMEIVPGLMAIGEAACVSVHGANRLGSNSLLDLIIFGRAAANK
AKEIIAISTKHQPLGNNIVDAIIERFDQTRFLNGNMPIAELRLTMQRAMQNYAGVFRSYD
KLTEGMKIIKQNFNSRTDIKLTDHSLIWNTDLVEAIELQNLLYQAAITMFCAANRQESRG
AHAREDYPNRDDDNWLKHTLATIDEEGNVDIDYRNVVLDPKDDEMMAIVPKKRVY
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggcttataaaattataaatcatgaatttgatgttgtagtagttggagctggtgga
gcaggactaagggctatagttggtatggctgaatctggtctccgtgctgcttgtattacc
aaattgtttcctactcgtagtcatactgttgcagctcaaggtggtattagtgctgcacta
ggtaatatacaaccagataaatggcaatggcatgcttatgatactattaaaggatctgat
tggcttggagatcaagatgcaattgcttatatgtgcaaagaagctccagctgctattatt
gaattagagcattatggagtcccattttcacgcacaacagatggaaaaatttatcaaaga
ccttttgggggtatgacaactgagtttggtgatggtgcggctgctgtacgaacctgcgca
gcggctgataggactggtcatgctatattacatactttatatcagcaagcgttgaaacat
aaagctaaatttttcattgagtatatagctcttgatttaattatggataatggagcttgt
aaggggatagttgcttggaaccttgacgatggtactattcattgctttagatcacatata
gtagtcttagcaactggagggtatggaagggcttacttttcagcaacatcagcccacagt
tgtactggtgatggaaatgctatgtgcgctagagctggcatagctttacaagatatggaa
tttgttcaatttcatcctacaggaatttatggtgcaggatgtttaatcactgaaggagct
agaggagaaggtgggtacttagttaactcagaaggtgagcgttttatggaaagatatgct
ccatcagccaaagatcttgcttcacgagatgtagttgcaagggctatgactatggaaatc
aatgctggccgcggagtaggtatatataaagatcatatatttttgcatttaaatcatctt
gatagtaaaacgatacaacaaaggttacctggaatatctgaaactgcaatgatctttgct
ggagttgatgttacaaagcagcctataccagtaattccaactgtacattataatatgggt
ggtataccaacaaattatcatggccaagtagtaactaaaacagaaaatggtgatatggaa
atagtacctggattaatggcgattggagaagctgcttgcgtatcagttcatggagctaat
agactaggatccaactctctacttgatctaataatctttggtcgagctgcagccaataaa
gcaaaagaaattatcgctatatcaacaaaacatcaaccgttaggcaataacattgttgat
gctattatagaaagatttgaccaaacaaggtttttaaatggtaatatgccaattgctgag
ttaagattaactatgcaacgtgctatgcaaaactatgctggagtatttcgtagctatgat
aagttaacagaaggtatgaaaataataaaacaaaattttaattctagaacagatattaaa
ttaacagatcattcactaatttggaacactgatttagttgaggcaattgaattacaaaat
ttattatatcaagctgcaataactatgttttgtgctgctaaccgtcaagaaagccgagga
gcccatgctcgagaagattaccctaatagagatgatgataattggctcaaacatacatta
gccacaattgatgaagaaggtaacgtagatatagattataggaacgtagtattagatcca
aaagatgatgaaatgatggctatagttcctaaaaagcgagtatattaa

DBGET integrated database retrieval system