KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112214206
Entry
112214206         CDS       T05605                                 

Definition
(RefSeq) insulin-like growth factor I isoform X1
  KO
K05459  insulin-like growth factor 1
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04068  FoxO signaling pathway
otw04114  Oocyte meiosis
otw04115  p53 signaling pathway
otw04150  mTOR signaling pathway
otw04510  Focal adhesion
otw04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112214206
   04068 FoxO signaling pathway
    112214206
   04150 mTOR signaling pathway
    112214206
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    112214206
   04115 p53 signaling pathway
    112214206
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112214206
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    112214206
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:otw04052]
    112214206
Cytokines and growth factors [BR:otw04052]
 Growth factors
  Growth factors (RTK binding)
   112214206
SSDB
Motif
Pfam: Insulin
Other DBs
NCBI-GeneID: 112214206
NCBI-ProteinID: XP_024228563
LinkDB
Position
15
AA seq 188 aa
MSSGHFFQWHLCDVFKSAMCCVSCTHTLSLLLCVLTLTSAATGAGPETLCGAELVDTLQF
VCGERGFYFSKPTGYGPSSRRSHNRGIVDECCFQSCELRRLEMYCAPVKSGKAARSVRAQ
RHTDMPRTPKVSTAVQNVDRGTERRTAQHPDKTKTKKKPLSGHSHTSCKEVHQKNSSRGN
TGGRNYRM
NT seq 567 nt   +upstreamnt  +downstreamnt
atgtctagcggtcatttcttccagtggcatttatgtgatgtcttcaagagtgcgatgtgc
tgtgtctcctgtacccacaccctctcactgctgctgtgcgtcctaaccctgacttcggcg
gcaacaggggcggggcccgagaccctgtgtggggcggagctggtggacacgctgcagttt
gtgtgtggagagagaggattttatttcagtaaaccaacgggctatggccccagttcacga
cggtcacataaccgtggtattgtggacgagtgctgcttccagagttgcgagctgaggcgg
ctcgaaatgtactgtgcccctgtcaagtctggcaaggcagctcgctctgtgcgcgcacag
cgccacacagacatgccaagaacacctaaggttagtactgcagtgcaaaacgtggacaga
ggcacagagcgtaggacagcacagcacccagacaagacaaaaaccaagaagaaaccttta
tctgggcatagtcacacatcttgcaaggaggtacatcagaagaactcaagtcgaggaaac
acagggggaagaaactaccgaatgtag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112217005
Entry
112217005         CDS       T05605                                 

Definition
(RefSeq) insulin-like growth factor I isoform X1
  KO
K05459  insulin-like growth factor 1
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04068  FoxO signaling pathway
otw04114  Oocyte meiosis
otw04115  p53 signaling pathway
otw04150  mTOR signaling pathway
otw04510  Focal adhesion
otw04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112217005
   04068 FoxO signaling pathway
    112217005
   04150 mTOR signaling pathway
    112217005
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    112217005
   04115 p53 signaling pathway
    112217005
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112217005
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    112217005
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:otw04052]
    112217005
Cytokines and growth factors [BR:otw04052]
 Growth factors
  Growth factors (RTK binding)
   112217005
SSDB
Motif
Pfam: Insulin
Other DBs
NCBI-GeneID: 112217005
NCBI-ProteinID: XP_024232983
LinkDB
Position
17
AA seq 188 aa
MSSGHFFQWHLCDVFKSAMCCISCTHTLSLLLCVLTLTSAATGAGPETLCGAELVDTLQF
VCGERGFYFSKPTGYGPSSRRSHNRGIVDECCFQSCELRRLEMYCAPVKSGKAARSVRAQ
RHTDMPRTPKVSTAVQNVDRGTERRTAQHPEKTKPKKKPLSGNSHTSCKEVHQKNSSRGN
TGGRNYRM
NT seq 567 nt   +upstreamnt  +downstreamnt
atgtctagcggtcatttcttccagtggcatttatgtgatgtcttcaagagtgcgatgtgc
tgtatctcctgtacccacaccctctcactgctgctgtgcgtcctaaccctgacttcggcg
gcaacaggggcggggcccgagaccctgtgtggggcggagctggtggacacgctgcagttt
gtgtgtggagagagaggcttttatttcagtaaaccaacggggtatggccccagttcacgg
cggtcacataaccgtggtattgtggacgagtgctgcttccagagttgcgagctgcggcgg
ctcgaaatgtactgtgcccctgtcaagtctggcaaggcagctcgctctgtgcgcgcacag
cgccacacagacatgccaagaacacccaaggttagtactgcagtgcaaaacgtggaccga
ggcacagagcgtaggacagcacagcacccagagaagacaaaacccaagaagaaaccttta
tctgggaatagtcacacatcttgcaaggaggtacatcagaagaactcaagtcgaggaaac
acggggggaaggaactaccgaatgtag

DBGET integrated database retrieval system