KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112214206
Entry
112214206         CDS       T05605                                 

Definition
(RefSeq) insulin-like growth factor I isoform X1
  KO
K05459  insulin-like growth factor 1
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04068  FoxO signaling pathway
otw04114  Oocyte meiosis
otw04115  p53 signaling pathway
otw04150  mTOR signaling pathway
otw04510  Focal adhesion
otw04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112214206
   04068 FoxO signaling pathway
    112214206
   04150 mTOR signaling pathway
    112214206
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    112214206
   04115 p53 signaling pathway
    112214206
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112214206
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    112214206
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:otw04052]
    112214206
Cytokines and growth factors [BR:otw04052]
 Growth factors
  Growth factors (RTK binding)
   112214206
SSDB
Motif
Pfam: Insulin
Other DBs
NCBI-GeneID: 112214206
NCBI-ProteinID: XP_024228563
LinkDB
Position
15
AA seq 188 aa
MSSGHFFQWHLCDVFKSAMCCVSCTHTLSLLLCVLTLTSAATGAGPETLCGAELVDTLQF
VCGERGFYFSKPTGYGPSSRRSHNRGIVDECCFQSCELRRLEMYCAPVKSGKAARSVRAQ
RHTDMPRTPKVSTAVQNVDRGTERRTAQHPDKTKTKKKPLSGHSHTSCKEVHQKNSSRGN
TGGRNYRM
NT seq 567 nt   +upstreamnt  +downstreamnt
atgtctagcggtcatttcttccagtggcatttatgtgatgtcttcaagagtgcgatgtgc
tgtgtctcctgtacccacaccctctcactgctgctgtgcgtcctaaccctgacttcggcg
gcaacaggggcggggcccgagaccctgtgtggggcggagctggtggacacgctgcagttt
gtgtgtggagagagaggattttatttcagtaaaccaacgggctatggccccagttcacga
cggtcacataaccgtggtattgtggacgagtgctgcttccagagttgcgagctgaggcgg
ctcgaaatgtactgtgcccctgtcaagtctggcaaggcagctcgctctgtgcgcgcacag
cgccacacagacatgccaagaacacctaaggttagtactgcagtgcaaaacgtggacaga
ggcacagagcgtaggacagcacagcacccagacaagacaaaaaccaagaagaaaccttta
tctgggcatagtcacacatcttgcaaggaggtacatcagaagaactcaagtcgaggaaac
acagggggaagaaactaccgaatgtag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112217005
Entry
112217005         CDS       T05605                                 

Definition
(RefSeq) insulin-like growth factor I isoform X1
  KO
K05459  insulin-like growth factor 1
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04068  FoxO signaling pathway
otw04114  Oocyte meiosis
otw04115  p53 signaling pathway
otw04150  mTOR signaling pathway
otw04510  Focal adhesion
otw04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112217005
   04068 FoxO signaling pathway
    112217005
   04150 mTOR signaling pathway
    112217005
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    112217005
   04115 p53 signaling pathway
    112217005
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112217005
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    112217005
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:otw04052]
    112217005
Cytokines and growth factors [BR:otw04052]
 Growth factors
  Growth factors (RTK binding)
   112217005
SSDB
Motif
Pfam: Insulin
Other DBs
NCBI-GeneID: 112217005
NCBI-ProteinID: XP_024232983
LinkDB
Position
17
AA seq 188 aa
MSSGHFFQWHLCDVFKSAMCCISCTHTLSLLLCVLTLTSAATGAGPETLCGAELVDTLQF
VCGERGFYFSKPTGYGPSSRRSHNRGIVDECCFQSCELRRLEMYCAPVKSGKAARSVRAQ
RHTDMPRTPKVSTAVQNVDRGTERRTAQHPEKTKPKKKPLSGNSHTSCKEVHQKNSSRGN
TGGRNYRM
NT seq 567 nt   +upstreamnt  +downstreamnt
atgtctagcggtcatttcttccagtggcatttatgtgatgtcttcaagagtgcgatgtgc
tgtatctcctgtacccacaccctctcactgctgctgtgcgtcctaaccctgacttcggcg
gcaacaggggcggggcccgagaccctgtgtggggcggagctggtggacacgctgcagttt
gtgtgtggagagagaggcttttatttcagtaaaccaacggggtatggccccagttcacgg
cggtcacataaccgtggtattgtggacgagtgctgcttccagagttgcgagctgcggcgg
ctcgaaatgtactgtgcccctgtcaagtctggcaaggcagctcgctctgtgcgcgcacag
cgccacacagacatgccaagaacacccaaggttagtactgcagtgcaaaacgtggaccga
ggcacagagcgtaggacagcacagcacccagagaagacaaaacccaagaagaaaccttta
tctgggaatagtcacacatcttgcaaggaggtacatcagaagaactcaagtcgaggaaac
acggggggaaggaactaccgaatgtag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112217670
Entry
112217670         CDS       T05605                                 

Definition
(RefSeq) vascular endothelial growth factor A-A-like isoform X1
  KO
K05448  vascular endothelial growth factor A
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04020  Calcium signaling pathway
otw04370  VEGF signaling pathway
otw04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112217670
   04370 VEGF signaling pathway
    112217670
   04020 Calcium signaling pathway
    112217670
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112217670
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:otw04052]
    112217670
   00536 Glycosaminoglycan binding proteins [BR:otw00536]
    112217670
Cytokines and growth factors [BR:otw04052]
 Growth factors
  Growth factors (RTK binding)
   112217670
Glycosaminoglycan binding proteins [BR:otw00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   112217670
SSDB
Motif
Pfam: VEGF_C PDGF
Other DBs
NCBI-GeneID: 112217670
NCBI-ProteinID: XP_024233894
LinkDB
Position
18
AA seq 277 aa
MDFKSTFAFGISIMNFVDSLITLFLLTLLYLSAVKSAHIPKEGWRISHDGAPGYNVFSAS
VQKVPNFVGLREGLKEGVSTEAYQSHSERGNERDTLMVISFMEVYNKSLCQPRELLVEIA
QEYPEEVEHIFIPSCVVLTRCAGCCNDEMLECTPTSTHNMTMEIKRIKPQRQENNIFMSF
TEHSACECRPKKEVKEPRHKKLRKGKGQKRKRKKNHDQKNREAQCEPCCDGCSERRKQGF
IQDPLTCQCSCRNSNAHCRARYLELNERTCRCDKPRR
NT seq 834 nt   +upstreamnt  +downstreamnt
atggattttaaatcgacatttgcatttggaatttcaatcatgaactttgttgacagtttg
ataaccttgtttctcctgacgcttctgtatttgtcagctgtcaagagtgcccacataccg
aaagaaggatggaggatttcgcatgacggcgccccaggctacaatgtttttagtgcttca
gtgcagaaggtaccaaactttgtggggctgagagagggattgaaagagggagtcagtaca
gaagcataccagagccacagtgagagaggaaatgagagagacaccttgatggtgatctcc
ttcatggaggtgtacaataagagcctatgtcagcccagggagctgctggtagagatcgca
caggagtacccagaggaggtagaacatatctttatcccatcctgtgtggtgctgacgcgc
tgcgcaggctgctgcaacgatgagatgctagagtgcacgccaacctccacgcataacatg
accatggagataaaaagaataaaaccccaaaggcaagaaaataatatctttatgagtttt
acagaacacagtgcgtgtgaatgcaggccaaagaaagaagtgaaagaaccgagacacaaa
aaactccggaaaggcaaaggccaaaagagaaagcgaaagaaaaaccatgaccaaaagaat
cgtgaagctcagtgcgagccatgttgtgatggctgttcagagaggaggaagcaggggttc
atccaggaccctctgacctgccagtgttcctgcagaaactccaatgcccactgccgggcg
cgttacctggagctcaacgagaggacctgcagatgtgacaagccaagaagatga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112221054
Entry
112221054         CDS       T05605                                 

Definition
(RefSeq) platelet-derived growth factor C-like
  KO
K05450  platelet derived growth factor C/D
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04020  Calcium signaling pathway
otw04510  Focal adhesion
otw04540  Gap junction
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112221054
   04020 Calcium signaling pathway
    112221054
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112221054
   04540 Gap junction
    112221054
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112221054
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:otw04052]
    112221054
Cytokines and growth factors [BR:otw04052]
 Growth factors
  Growth factors (RTK binding)
   112221054
SSDB
Motif
Pfam: CUB PDGF
Other DBs
NCBI-GeneID: 112221054
NCBI-ProteinID: XP_024238891
LinkDB
Position
21
AA seq 359 aa
MVILNVSSTVFCNRCPPLIQMILPLLILFVSLLQQHGSEAESSHASKFQQPSLKEQNGVQ
DFQHEKIITVVGEGMIHSPDFPFTYPRSTVLVWRLMASSDNMRIHLSFDERFGLEDSEDG
ICKYDFVEIDEPSENTILGRWCGSQVPDSHTSKGSQIRVRFISDEYFPSEPGFSIRYSLL
PMSVLKPEVTPAPSLQSSDALSEAVAGLSTVEEVMKYLEPERWQQDMEDLYKPTWHILGK
SFLHNKKSRGVDINLLREEVKLYSCTPRNFSVSLREELKRTDAIFWPSCLLVKRCGGNCA
CCSHRCFDCQCVPTRVVNKYHEVLLLKHRSGGRGLQKSMTDVPMEHHEECACVCKDDWD
NT seq 1080 nt   +upstreamnt  +downstreamnt
atggtgatactaaacgtctcgtcaacagtgttttgtaatcgctgtccgccactaatccaa
atgatccttccattattaatcctgtttgtatcgcttctccaacaacatggctcagaagct
gaatcaagtcatgccagcaaattccaacaaccaagtttaaaggaacaaaacggtgtccaa
gatttccagcatgagaagataatcacagtcgtaggagagggaatgatccatagtccagac
ttcccatttacctaccccaggagtaccgtgctggtctggagactgatggcctccagtgac
aacatgagaatccacttgtccttcgacgagaggttcggcctggaagactcagaggacgga
atatgcaagtatgattttgtggagatcgatgagccttctgagaacaccatcctgggccgc
tggtgcgggtcccaggtacccgacagtcacacatccaaaggcagtcagatccgggtgcga
tttatctccgacgagtacttcccctccgagcccggattcagcattcgctactccctgctc
ccaatgagtgtattgaagcccgaggtaactccagctccatctctgcagagctcagatgcg
ttgtctgaggccgtggctggcctcagcaccgtggaggaggtcatgaagtatctggagccc
gagagatggcagcaggacatggaagacctgtacaagcccacttggcacatcctgggaaag
tcattcctacacaacaagaaatccagaggggtggatatcaacctgttgagagaagaggtg
aaactgtacagctgcacgccgcgcaacttctccgtctccctaagggaggagctcaagagg
acggacgccatcttctggcctagctgcctcctggtgaagcgctgcgggggtaactgtgcc
tgctgctcgcaccgctgcttcgactgccagtgtgtgcccacacgggtagtcaacaagtac
catgaggttctcctgctgaagcaccgaagtgggggccgaggcctgcagaagtccatgacc
gatgtgccaatggaacaccacgaggagtgtgcctgtgtgtgcaaagatgactgggactga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112221165
Entry
112221165         CDS       T05605                                 

Gene name
vegfb
Definition
(RefSeq) vascular endothelial growth factor B
  KO
K05448  vascular endothelial growth factor A
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04020  Calcium signaling pathway
otw04370  VEGF signaling pathway
otw04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112221165 (vegfb)
   04370 VEGF signaling pathway
    112221165 (vegfb)
   04020 Calcium signaling pathway
    112221165 (vegfb)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112221165 (vegfb)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:otw04052]
    112221165 (vegfb)
   00536 Glycosaminoglycan binding proteins [BR:otw00536]
    112221165 (vegfb)
Cytokines and growth factors [BR:otw04052]
 Growth factors
  Growth factors (RTK binding)
   112221165 (vegfb)
Glycosaminoglycan binding proteins [BR:otw00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   112221165 (vegfb)
SSDB
Motif
Pfam: PDGF VEGF_C
Other DBs
NCBI-GeneID: 112221165
NCBI-ProteinID: XP_024239077
LinkDB
Position
21
AA seq 236 aa
MGVLLQVILGMFLLLSRIRTSHAKLAHWRPADTTPKSREVRRWLEVYSRSVCEPRDTLVE
VWQELPGETHHLFVPSCVSVRRCGGCCSDEALECVPSLTQTITMELMKTSFMKHELIELD
FVEHSQCECRLKQDLQSAPTRPAKPLRKGRERDRGKSKRKKIGTIKTTPSNPPTTLFPLP
TTLSSLPGSRCTPCPGRKWTLDLQSCLCRCNVTTESCSQKGRRLNQHFCRCEAMRR
NT seq 711 nt   +upstreamnt  +downstreamnt
atgggggttttgcttcaagttattctaggaatgttcctcttgctctcaagaatacgcacg
tcccatgccaagctagcccactggagacctgcagacaccacccccaaatccagagaagtg
cgtcggtggttggaggtgtactctcgtagtgtttgtgagcccagggataccctggtggag
gtgtggcaggagttgccaggggagacgcatcacctcttcgtgccctcctgtgtgtctgtc
cgccgctgtggcgggtgctgctctgacgaggcactggagtgtgtgccctcacttacacaa
actatcaccatggagctaatgaagacctcctttatgaagcatgagctcatcgagctggac
ttcgttgagcacagccagtgtgagtgcagactaaaacaggatcttcagtcagccccaacc
agacctgcaaagcctctgaggaaaggcagggaaagggacagaggaaaatccaaaagaaag
aaaattggaactatcaaaaccacaccctccaatccccccactaccctatttcctctccct
accaccctgtcttccttgccaggctctcgatgtaccccctgtcctgggaggaagtggacg
ctggatttacagtcttgtctgtgtcgctgcaacgtgaccacagagagctgcagtcagaaa
gggaggagactcaaccagcacttctgcagatgtgaggccatgaggcggtga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112223181
Entry
112223181         CDS       T05605                                 

Definition
(RefSeq) vascular endothelial growth factor A-A isoform X1
  KO
K05448  vascular endothelial growth factor A
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04020  Calcium signaling pathway
otw04370  VEGF signaling pathway
otw04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112223181
   04370 VEGF signaling pathway
    112223181
   04020 Calcium signaling pathway
    112223181
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112223181
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:otw04052]
    112223181
   00536 Glycosaminoglycan binding proteins [BR:otw00536]
    112223181
Cytokines and growth factors [BR:otw04052]
 Growth factors
  Growth factors (RTK binding)
   112223181
Glycosaminoglycan binding proteins [BR:otw00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   112223181
SSDB
Motif
Pfam: PDGF DUF702
Other DBs
NCBI-GeneID: 112223181
NCBI-ProteinID: XP_024241978
LinkDB
Position
23
AA seq 192 aa
MNIGSFVQLLFAALLQLHLYAVKTAHIPKNGEKSKNDVVPFMDVYNKSMCRTREMLVDIF
QEYPDEIEHTYIPSCVVLMRCAGCCNDEALECVPTETKNVTMEVIQVKQRVSQHNFQLSF
TEHRKCECRPKPEVKAKKEKGNDQKRKRKKERDTGTMRSEAYASASSVACLHMGTMSLLT
VGLILEELVCIL
NT seq 579 nt   +upstreamnt  +downstreamnt
atgaacattggcagttttgtacaattattatttgcagcgcttcttcagcttcatttgtat
gcagttaagacagcccacatacccaagaacggggagaagagtaaaaatgacgtggtcccg
ttcatggacgtgtataacaagagcatgtgtcggacacgggagatgctggtggacatcttc
caggagtatccagatgagattgagcacacctacatcccctcgtgcgtggtgctcatgcgc
tgcgccggatgctgcaacgacgaggcgctcgagtgtgtccccacggaaacaaaaaatgtt
accatggaggtaatacaagtgaaacagagagtatcgcagcataattttcagttaagtttc
acagaacatcgaaagtgtgaatgcagaccaaagccagaagttaaggcaaagaaagaaaag
ggcaatgaccaaaagagaaagagaaagaaagagagagacactggcacgatgaggtctgag
gcctatgccagcgcctcttctgtggcgtgtctgcacatgggcactatgtctctcttgacg
gttggcttgattttggaggaacttgtttgtatcttgtaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112229039
Entry
112229039         CDS       T05605                                 

Definition
(RefSeq) vascular endothelial growth factor C-like
  KO
K05449  vascular endothelial growth factor C/D
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04020  Calcium signaling pathway
otw04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112229039
   04020 Calcium signaling pathway
    112229039
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112229039
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:otw04052]
    112229039
Cytokines and growth factors [BR:otw04052]
 Growth factors
  Growth factors (RTK binding)
   112229039
SSDB
Motif
Pfam: PDGF CXCXC
Other DBs
NCBI-GeneID: 112229039
NCBI-ProteinID: XP_024250689
LinkDB
Position
30
AA seq 395 aa
MWILSLVLWILNVTNLTHGYDYDEYPGEEDTKAPLVGEGISGLDTVSNVDELVELLYPEY
SLVQHCLRRKALRTSPPLHAEDDIWAWGKPRELALVKSDSTIEVILEEIQRTMCTPREVC
LEVSKEYPESTSHFYVPRCVSVHRCGGCCPQEGLYCTNTSHIYINKTLVELSHRDRSMVM
VAFVNHTSCECLSKRPLHSVIRRAAAAHLTVCSPPDVPCSTGLVWDPTSCLCVPMDTSPF
SERELEPLESALLELCGPNKVLDEDSCECVCQNGLTEASCGPGWRLDQESCECLCEDQPG
PGTCPPNQRWDPDLCGCVCRAECPRSQPLNPETCLCQCRESPHTCLLQGKRFNAHNCSCY
RLPCRKPHKNCPTGFYYSHYVCQCIPNHMRSEEWN
NT seq 1188 nt   +upstreamnt  +downstreamnt
atgtggatattatctttagtcctttggattctcaatgtcaccaatctcactcatggttat
gactatgatgagtacccgggtgaggaggacacaaaggccccactggttggcgaaggtatt
agtggtttggacaccgtctccaatgtggacgagctggtggagctgttgtacccagagtac
agtctggtgcagcactgcctacgtaggaaagccttgcgcacctcccctcctctccatgct
gaagacgatatctgggcctggggcaagcccagggagctggcactggtcaagtctgacagc
accattgaagtcattctggaggagatccagcgtaccatgtgtactcctcgggaggtgtgt
ctggaggtgtctaaggagtacccggagagcaccagtcacttctacgtgcctcgctgtgtg
tctgtgcaccgctgtgggggctgctgtccccaggagggtctgtactgcaccaacaccagc
cacatctacatcaacaagacgctggtggagttgtctcaccgtgaccgctctatggtgatg
gtggcgttcgtcaaccacacgtcctgtgagtgtctgtccaagaggcccctgcactccgtc
atcaggagggccgctgcagctcacctcaccgtgtgttccccgccagatgttccctgcagt
acaggactggtctgggaccccaccagctgcctgtgtgttcccatggacacaagccccttc
tcagagagagagctagagcccctggagtcagccttgctggagctgtgtggccccaacaaa
gtcctggatgaggacagctgtgagtgtgtgtgtcagaacggtctgacggaggccagctgt
gggccaggctggcgtctagaccaagagtcctgtgagtgtctctgtgaggaccaacccggc
ccagggacctgcccacccaaccaacgctgggacccagatctgtgtggatgtgtgtgccgg
gcagagtgcccccgtagccagcctctcaacccagagacgtgcctgtgccagtgcagggag
agtccccacacctgcctgctgcaaggcaagaggttcaacgcacacaattgcagctgttac
cggctgccctgcagaaagccacacaagaactgtccaactggcttctactacagccactac
gtctgccagtgcatacccaaccacatgaggtcagaggagtggaactga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112231122
Entry
112231122         CDS       T05605                                 

Definition
(RefSeq) vascular endothelial growth factor C-like isoform X1
  KO
K05449  vascular endothelial growth factor C/D
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04020  Calcium signaling pathway
otw04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112231122
   04020 Calcium signaling pathway
    112231122
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112231122
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:otw04052]
    112231122
Cytokines and growth factors [BR:otw04052]
 Growth factors
  Growth factors (RTK binding)
   112231122
SSDB
Motif
Pfam: PDGF CXCXC
Other DBs
NCBI-GeneID: 112231122
NCBI-ProteinID: XP_024253456
LinkDB
Position
33
AA seq 415 aa
MVCLKGTLSTGSSYPHSTGLIVSTLYGAHRIHTLRGSSYPPSTGLIVSTLKAPLVGEGLS
DLDTVSNVDELVELLYPEYSLVQHCLRRKTQRTSTPLHPEDDVWAWGKPREGALYKSDDG
TFDVILEEIQRTMCSPREVCLEVSKEYPESTRHFYMPRCVSVHRCGGCCTHEGLYCTNTS
HTYSNKTLLEMTHREHSVVMVAFVNHTSCECLSKRPQHSVIRRAAAAHLTVCSPPDVPCS
TGLVWDPTSCLCVPMDTSFFSERELEPLESALLALCGPNKVLDEDSCECVCENGLTEASC
GPGWRLDQASCECLCEDQPAPGTCPPNQRWDPELCGCVCRSECPRSQPLNPETCLCQCRD
SPQTCLLEGKRFNAHNCSCYRLPCRKPHNSCPTGFYYSHYVCQCIPNHMRSGEWN
NT seq 1248 nt   +upstreamnt  +downstreamnt
atggtgtgtttgaaaggcactctatctacgggctcatcgtatccacactctacggggctc
atcgtatccacactctacggggctcatcgtatccacactctacggggctcatcgtatcca
ccctctacggggctcatcgtatccacactcaaggccccgctggttggggagggactcagt
gatttagacacagtgtccaatgtggacgagctggtggagctgttgtacccagagtacagt
ctggtgcagcattgcctacgtaggaaaacccagcgcacctccactcctctccatcctgaa
gacgacgtctgggcctggggcaagcccagggagggggcactgtacaagtctgacgacggc
acctttgacgttattctggaggagatccagcgtaccatgtgcagtcctcgggaggtgtgt
ctggaggtgtctaaagagtacccagagagcacccgtcacttctacatgcctcgctgtgtg
tctgtgcaccgctgtgggggctgctgtacccacgagggtctgtactgcaccaacaccagc
catacttacagcaacaagacgctgctggagatgactcaccgtgaacattctgtggtgatg
gtggcgttcgtcaaccacacatcctgtgagtgtctgtccaagaggccccagcactccgtc
atcaggagggctgctgcagcccacctcaccgtgtgttctccgccagatgttccctgcagt
acaggactggtctgggaccccaccagctgcctgtgtgttcccatggacacaagcttcttc
tccgagagagagctggaacccctggagtcggccttgctggcgctgtgtggccccaacaaa
gtcctggacgaggacagctgtgagtgtgtgtgtgagaacggtctgacagaggccagctgt
gggccgggctggcgtctagaccaggcgtcctgtgagtgtctctgtgaggaccagcccgcc
ccggggacctgccctcccaaccaacgctgggacccagagctgtgtggctgtgtgtgccgg
tcagagtgcccccgtagccagcctctcaacccagagacgtgcctgtgccagtgcagggat
agccctcagacctgcctgctagagggcaagaggttcaacgcacacaactgcagctgttac
cggctgccctgcagaaagccacacaacagctgtccaacaggcttctactacagccactac
gtctgccagtgcatacccaaccacatgaggtcaggggagtggaactga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112233191
Entry
112233191         CDS       T05605                                 

Definition
(RefSeq) placenta growth factor-like
  KO
K16859  placenta growth factor
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112233191
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112233191
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:otw04052]
    112233191
Cytokines and growth factors [BR:otw04052]
 Growth factors
  Growth factors (RTK binding)
   112233191
SSDB
Motif
Pfam: PDGF Alpha_adaptinC2
Other DBs
NCBI-GeneID: 112233191
NCBI-ProteinID: XP_024256411
LinkDB
Position
Unknown
AA seq 165 aa
MKPFASFVIQIAVTFQLQLSPAQITPSPSSNSTTGVLMFQEVWGRSFCRTIEKLVEVVQE
YPGEVEHIYSPSCVPLVRCAGCCGDENLECHPTQTSNVSMQLLKIKPGEQGQEYVEMSFV
EHQTCECRIRKAVVKSERRRQRGRGRKRKERQRVKDCDRCQPPRR
NT seq 498 nt   +upstreamnt  +downstreamnt
atgaaaccctttgcttcgttcgtcatccagattgcggtgacgttccaacttcagctttca
cctgctcagattacgccctcacccagctcaaacagcacaactggagtgttaatgttccag
gaggtgtggggtcgtagtttctgccggaccatagagaagctggtggaggtggtccaggag
taccccggggaggtggagcacatctatagtccctcctgtgtgcccctggtgcgctgcgct
ggttgctgtggcgatgagaatctggagtgccatcctactcagacctctaatgtctccatg
cagttgttgaaaatcaagccaggggaacagggtcaagaatacgttgagatgtcttttgtg
gagcaccagacatgtgaatgtagaatcaggaaggctgtggtgaaaagtgaaaggaggaga
caaagaggaagaggaagaaaaagaaaggagagacagagagtgaaagattgtgacaggtgt
cagcctcctcgcaggtaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112234081
Entry
112234081         CDS       T05605                                 

Definition
(RefSeq) vascular endothelial growth factor A-A-like isoform X1
  KO
K05448  vascular endothelial growth factor A
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04020  Calcium signaling pathway
otw04370  VEGF signaling pathway
otw04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112234081
   04370 VEGF signaling pathway
    112234081
   04020 Calcium signaling pathway
    112234081
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112234081
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:otw04052]
    112234081
   00536 Glycosaminoglycan binding proteins [BR:otw00536]
    112234081
Cytokines and growth factors [BR:otw04052]
 Growth factors
  Growth factors (RTK binding)
   112234081
Glycosaminoglycan binding proteins [BR:otw00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   112234081
SSDB
Motif
Pfam: VEGF_C PDGF
Other DBs
NCBI-GeneID: 112234081
NCBI-ProteinID: XP_024257840
LinkDB
Position
3
AA seq 190 aa
MNIGSFVQLLFAALLQLHFYAVKTAHIPKDGEKSKNDVVPFMDVYNKSMCRTREMLVDVF
QEYPDEIEHTYIPSCVVLMRCAGCCNDEALECVPTETKNVTMEVIQVKQRVSQHHFLLSF
TEHRKCECRPKPEVKAKKENHCEPCSERRKRLFVQDPLTCKCSCKFTQLDCKSRQLELNE
RTCRCDKPRR
NT seq 573 nt   +upstreamnt  +downstreamnt
atgaacattggcagttttgtacaattattatttgcagcgctgcttcagcttcatttttat
gcagttaagacagcccacatacccaaggacggggagaagagtaaaaatgatgtggtcccg
ttcatggacgtgtataacaagagcatgtgtcggacacgggagatgctggtggacgtcttc
caggagtatccagatgagattgagcacacctacatcccctcgtgcgtggtgctcatgcgc
tgcgctggatgctgcaacgacgaggcgctcgagtgtgtccccacggaaacaaaaaacgtt
accatggaggtaatacaggtgaagcagagagtatcgcaacatcattttctgttaagtttc
acagaacatcgaaagtgtgaatgcagaccaaagccagaagttaaagcaaagaaagaaaac
cactgtgagccttgctcagagagaagaaagcgcttgtttgtgcaggaccctctcacctgt
aaatgttcctgcaaattcacacaattagactgcaagtccagacaacttgagttaaacgaa
agaacttgcagatgtgacaaaccaaggagatga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112234531
Entry
112234531         CDS       T05605                                 

Definition
(RefSeq) vascular endothelial growth factor C-like isoform X1
  KO
K05449  vascular endothelial growth factor C/D
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04020  Calcium signaling pathway
otw04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112234531
   04020 Calcium signaling pathway
    112234531
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112234531
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:otw04052]
    112234531
Cytokines and growth factors [BR:otw04052]
 Growth factors
  Growth factors (RTK binding)
   112234531
SSDB
Motif
Pfam: PDGF CXCXC
Other DBs
NCBI-GeneID: 112234531
NCBI-ProteinID: XP_024258461
LinkDB
Position
Unknown
AA seq 407 aa
MHLFGISVLLANSAILYANLASESSHEFNHDYYDYDQDQGDAREPSEPDLEQQLRSVASV
EELMRIVYPNYYSVLSCRSKRGARFPLRGEHTATETRSSGELPAFASLNPDTLKSIVSEW
KKTQCMPREVCLDVGKEFGAATNTFYKPPCVSVYRCGGCCNSEALQCMNISTSYISKTLF
EITVSSSTNNNLVTISFANHTVCNCLSKLDAYRQVHSIIRRSLPECLVANKTCPKNHSWS
NRLCRCMAVQRDTPPPPQTQHSDSFEADVCGSDKELDEETCQCVCRRQLRASGACGPHRY
LDKNTCQCVCKTLPSSCGPHQLFNKDTCQCSCARTCPKHQPLNRTKCACECNESPNRCFL
KGKRFHQATCSCHRPPCDVRRSRRCASGFYFSEEVCRCVPTYWRGQD
NT seq 1224 nt   +upstreamnt  +downstreamnt
atgcacttatttggaatatctgttctccttgccaattcagcgattctctacgcaaatcta
gccagtgaatcgagtcatgaattcaatcacgattattatgattatgatcaggatcaaggg
gatgcacgggagccgtcggagccagaccttgagcagcagctgcgctccgtggccagtgtt
gaggaactgatgaggatagtgtaccctaactactacagcgtgctcagttgccggtcgaag
cggggcgcacgcttccccctgagaggggaacacacagccacggaaacgcggtcgagcggc
gaactgccggcgttcgcttccttgaaccctgacacactgaaaagtattgtgtcagagtgg
aaaaagacccagtgcatgccacgagaagtttgtttagatgtggggaaagagtttggggcg
gctacaaacaccttctataaaccaccctgcgtgtctgtctacagatgtgggggctgctgc
aacagcgaggcgctgcagtgtatgaacatcagcacctcctacatcagcaagacgctgttt
gaaatcacagtttccagcagtacaaataacaacctagtgacgatcagctttgccaaccac
accgtgtgcaattgtctgtccaaactggatgcctacagacaagtacactccatcatacga
cgatctctaccagaatgtctggtagccaataaaacctgcccaaagaaccacagctggagc
aaccgcttgtgcagatgtatggcggtgcagcgcgacacccctcccccgccccagacacaa
cactcggactcgtttgaagcagatgtctgcgggtcagataaggagttggacgaggagacg
tgccagtgtgtttgcaggcgacagctccgggcctcgggcgcatgcggaccccaccgctac
ctggataagaacacgtgccagtgtgtgtgtaagacgctcccctcgtcctgtgggccgcac
cagcttttcaataaagacacgtgccagtgctcctgcgccaggacgtgccccaagcaccag
ccrctcaaccgcaccaagtgtgcctgcgagtgcaacgagtcacccaacaggtgcttcctg
aaaggcaaaaggttccaccaggccacctgcagctgccacagaccaccttgtgacgtgcgg
aggagtcgacgctgtgcatcaggtttttacttcagtgaggaggtctgccggtgcgtacca
acatactggagaggacaggattaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112236859
Entry
112236859         CDS       T05605                                 

Definition
(RefSeq) platelet-derived growth factor D-like
  KO
K05450  platelet derived growth factor C/D
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04020  Calcium signaling pathway
otw04510  Focal adhesion
otw04540  Gap junction
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112236859
   04020 Calcium signaling pathway
    112236859
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112236859
   04540 Gap junction
    112236859
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112236859
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:otw04052]
    112236859
Cytokines and growth factors [BR:otw04052]
 Growth factors
  Growth factors (RTK binding)
   112236859
SSDB
Motif
Pfam: CUB
Other DBs
NCBI-GeneID: 112236859
NCBI-ProteinID: XP_024261223
LinkDB
Position
Unknown
AA seq 206 aa
MNISGRVVLALLLALLVGFTGGTQAQVVSAKVMRSSNVRRDDLYRKEEVVTVTAAGGAIQ
SPRFPNAYPRNLQLSWKLLSPHNTRITLEFDSHFALEEPENEVCRYDFVEVEDISETSTI
VWGRWCGQRVPPRLTSKTNTLKVTFKSDDYFVAKPGFKLNYSLLSARAAKDTLKSAPAGS
KTTRKIVPPSKYHPKDALSAFQSITP
NT seq 621 nt   +upstreamnt  +downstreamnt
atgaacatctctgggcgcgtggtacttgcgctgttgctcgccctgctggtgggctttacc
gggggcacacaagcccaagtagtgtccgccaaggtgatgcggtcgtcaaacgtgaggcga
gatgacctgtaccggaaagaagaggtcgtcacggtaactgcagctgggggagccatccag
agcccccgcttcccgaacgcctacccccgaaacctgcagttgtcatggaaactactgtcg
ccccacaacacccgcatcaccctggagtttgactcccactttgcgctggaggaaccagag
aacgaagtctgcaggtatgactttgtggaggtggaggacatctcagagaccagtactatt
gtctgggggagatggtgtggtcagagagtccccccacgcctcacctccaaaaccaacacc
ctcaaagtcaccttcaagtcagacgactacttcgtggccaagcctggcttcaaactcaac
tactctctactgagcgctcgcgccgccaaagacacccttaagagcgccccggccggctca
aagaccacgaggaagatcgtccctccgtccaaataccaccctaaggatgctctctccgcc
ttccaaagtatcactccttaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112237077
Entry
112237077         CDS       T05605                                 

Definition
(RefSeq) platelet-derived growth factor D-like
  KO
K05450  platelet derived growth factor C/D
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04020  Calcium signaling pathway
otw04510  Focal adhesion
otw04540  Gap junction
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112237077
   04020 Calcium signaling pathway
    112237077
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112237077
   04540 Gap junction
    112237077
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112237077
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:otw04052]
    112237077
Cytokines and growth factors [BR:otw04052]
 Growth factors
  Growth factors (RTK binding)
   112237077
SSDB
Motif
Pfam: CUB PDGF YceG_bac
Other DBs
NCBI-GeneID: 112237077
NCBI-ProteinID: XP_024261466
LinkDB
Position
Unknown
AA seq 331 aa
MNSSGRVALALLLALLVGFTRGTQGHVVSAKVVRSSNVRQHDLYRKEEVVTVTATGGVIQ
SPRFPNAYPRNLQLSWKLLSPHNTRITLEFDSHFALEEPENEVCRYDFVEVEDISETSTI
VWGRWCGQRVPPRLTSKTNTLKVSFKSDDYFVAKPGFKLHFSLQDDSLPAVSKTNWETVA
LMEDSLSVLAPAVTDVPLTAAALDQSIAAFNTVEQLLRHLNPDSWRQDLDSLYRETAMYR
PRAYQHNRQNKIDLDRLYDDVKRYSCTPRNYSVNLREELRATNAVFFPRCLLVQRCGGNC
ACGTDNWNSCTCSPAKTSDKLHEVHTPCPVM
NT seq 996 nt   +upstreamnt  +downstreamnt
atgaacagctctgggcgcgtggcactggcgctgttgctcgcgctgctcgtgggctttacc
cggggcacacaaggccatgtagtgtccgccaaggtggtgcggtcttctaacgtgaggcaa
catgacttgtaccggaaagaagaggtcgtcacggtaacggcaacgggaggagtcatccag
agcccccgctttcctaacgcctatcccaggaacctgcagttgtcatggaaactactgtcg
ccccacaacacccgcatcaccctggagtttgactcccactttgcactggaggaaccagag
aacgaagtctgcagatatgactttgtggaggtggaggacatctcagagaccagtactatt
gtctgggggagatggtgtggtcagagagtcccccctcgtcttacctccaaaaccaacacc
ctcaaagtctccttcaagtcggacgactacttcgtggcaaagcctggcttcaaactccac
ttctctctacaggatgattctcttcctgcagtgtcaaagactaactgggagactgtggcc
ctgatggaggacagtctgtcagtgttggctccagcggtgactgatgttcctctgacagca
gcggcgttggaccagagcatagcagccttcaacacagtggagcagctcctccgccacctc
aaccctgacagctggagacaggacctggacagcttgtacagagagacagccatgtacaga
ccccgagcctaccagcacaacagacagaacaagattgacctggaccgtctgtatgatgac
gtgaagcgctacagctgtacacctcggaactactctgtcaacctgagggaggagctgagg
gccaccaacgccgtgttcttcccacgatgcctactggtgcagcgctgtggggggaactgt
gcctgtgggacggacaactggaacagctgtacctgcagcccggccaagaccagtgacaaa
ctacacgaggtacacacaccatgccctgttatgtag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112239316
Entry
112239316         CDS       T05605                                 

Definition
(RefSeq) platelet-derived growth factor subunit A-like
  KO
K04359  platelet-derived growth factor subunit A
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04020  Calcium signaling pathway
otw04510  Focal adhesion
otw04540  Gap junction
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112239316
   04020 Calcium signaling pathway
    112239316
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112239316
   04540 Gap junction
    112239316
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112239316
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:otw04052]
    112239316
   00536 Glycosaminoglycan binding proteins [BR:otw00536]
    112239316
Cytokines and growth factors [BR:otw04052]
 Growth factors
  Growth factors (RTK binding)
   112239316
Glycosaminoglycan binding proteins [BR:otw00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   112239316
SSDB
Motif
Pfam: PDGF PDGF_N
Other DBs
NCBI-GeneID: 112239316
NCBI-ProteinID: XP_024263561
LinkDB
Position
Unknown
AA seq 241 aa
MLIEIINILITFIITVIIIAIVITEDPLPPELLERLSRSEIRSISDLQRILELDLEGDRG
EQTEVPQQGLPPQLLTAEELSDTLQAQEEHRGALPAACKTRTVIYEIPQPVDPTSANFII
WPPCVEVKRCTGCCNTSNMHCLPSRKHHRTVKVAKVEYVRRRPKLKEVLVRLEEHLECIC
TSKRHIKELYDTDNDPPLPPPPPSFTGPSRTKGKGRKRKKLKNLKEFLIPFSGMWKNMSV
Y
NT seq 726 nt   +upstreamnt  +downstreamnt
atgttaatagagatcatcaacatcctcatcaccttcatcatcactgtcatcatcatcgcc
atcgtcatcacagaggacccactccccccggagctgttggagcggctgtcccgcagtgag
atccgcagcatcagcgacctccagcggatcctggagctagacttggaaggtgatcgggga
gaacaaacagaggtaccacaacaaggccttcccccacagctactcacagctgaagagctc
tcagacacactccaggcacaagaggagcatcgaggagcgttacccgcggcgtgtaagact
cgtacggtgatctacgagatccctcagccagtggatcccacctccgctaacttcatcatc
tggcccccctgtgtagaggtgaagagatgtaccggatgctgcaacaccagcaacatgcac
tgcctgccttcccgcaagcaccatcgcactgtcaaggtggctaaggtggagtatgtgagg
aggcgtcctaaactgaaggaggtgctggtgcggctggaggagcaccttgagtgtatatgc
acctccaaacgacacatcaaggaactctacgatacagacaatgacccccctcttccccct
cctcccccttcattcacaggacccagtaggaccaagggtaaagggaggaaacggaaaaag
ctcaaaaacctcaaagaatttctcatacctttctcaggcatgtggaaaaacatgagtgtt
tattag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112240061
Entry
112240061         CDS       T05605                                 

Definition
(RefSeq) platelet-derived growth factor subunit B-like
  KO
K17386  platelet-derived growth factor subunit B
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04020  Calcium signaling pathway
otw04510  Focal adhesion
otw04540  Gap junction
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112240061
   04020 Calcium signaling pathway
    112240061
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112240061
   04540 Gap junction
    112240061
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112240061
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:otw04052]
    112240061
   00536 Glycosaminoglycan binding proteins [BR:otw00536]
    112240061
Cytokines and growth factors [BR:otw04052]
 Growth factors
  Growth factors (RTK binding)
   112240061
Glycosaminoglycan binding proteins [BR:otw00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   112240061
SSDB
Motif
Pfam: PDGF PDGF_N
Other DBs
NCBI-GeneID: 112240061
NCBI-ProteinID: XP_024264202
LinkDB
Position
Unknown
AA seq 193 aa
MNSWVLLLAALAAGCLRFGSAEGDPLPLSLVELVRTSPISSIEDLQQLLEQETDSQEVEP
DEPSANEIHSNDTRGRYRRNLDAQPAQQAVCKVRTEVMEVTRAMLDRRNANFLLWPPCVE
VQRCSGCCNTRMLQCVPTVTQTRYLQVTRIQYIDKRPHYDKAVISVEDHASCRCQTHPSA
TAAARSTSLPPPP
NT seq 579 nt   +upstreamnt  +downstreamnt
atgaactcgtgggtcctgctgctggcggcgctcgccgcggggtgtctgcggtttggaagc
gctgagggagatcctcttccactatcgttagtagagctggtgagaaccagtcccatctcc
tctatagaggacctgcaacagctgctggagcaagagactgactcccaggaggtggagcca
gatgaaccatcggccaatgagattcattcaaatgacacccgtggaagatacaggagaaac
ctagatgcccagccagcccagcaggcggtgtgtaaggtcaggacagaggtcatggaggtc
accagagccatgcttgaccgacgcaacgccaacttcctgttgtggccgccgtgtgtggag
gtgcagcgctgctctggctgctgtaacacccgaatgctacagtgcgtccccacggttact
cagacacgatatctacaggtaacaaggatccagtacatcgataagagaccccactacgac
aaggcggtgatctcagtggaagaccacgcctcctgccgctgccagacacacccctcggcc
acagctgcagccaggtccacctcccttccccctcctccc

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112240982
Entry
112240982         CDS       T05605                                 

Definition
(RefSeq) putative uncharacterized protein DDB_G0291608
  KO
K17386  platelet-derived growth factor subunit B
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04020  Calcium signaling pathway
otw04510  Focal adhesion
otw04540  Gap junction
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112240982
   04020 Calcium signaling pathway
    112240982
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112240982
   04540 Gap junction
    112240982
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112240982
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:otw04052]
    112240982
   00536 Glycosaminoglycan binding proteins [BR:otw00536]
    112240982
Cytokines and growth factors [BR:otw04052]
 Growth factors
  Growth factors (RTK binding)
   112240982
Glycosaminoglycan binding proteins [BR:otw00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   112240982
SSDB
Other DBs
NCBI-GeneID: 112240982
NCBI-ProteinID: XP_024264949
LinkDB
Position
Unknown
AA seq 409 aa
MKANQRFHVYDRGQLERQWQDKYSLSHTQPRTHTQTHPMAGAGTQVVTHTQPHTHTQTHP
MAGSGTQVGTHTQPQTHTQTHPMAGSETQVGTHTDTHTQMGPSHELPIGHGSGYEGGRGE
ERGSQTPHRTHTDTQPNTGERQHIDNTERTQEIGRQQQLQQYYQQQQYLQQQRQYQQQQQ
QHQQHQQQQYQPYSQEPELRTQYKHNAPQSDSSGPPDTKQPANHKPELVHSNTEPTDDND
SSTEVANRDALKDTEVTSQGQAATEVTNHRKEDDKERHSQTELSNQEQRHSESTNQGDSV
TEEESRKKLLELLQRELGQKQQHHPPHPHLPHQDHHHPHHRQSRTQTTTTQRPVPPTLSS
SRAPGWSPSTPSPPPKPPQGPFRPALPRGRRRRKHRSRISKAALRTMIM
NT seq 1230 nt   +upstreamnt  +downstreamnt
atgaaggccaatcagaggttccatgtgtatgacagggggcagctggagagacagtggcag
gacaagtatagcctgtcacacacacagccacggacacacacacagacacacccaatggca
ggggcagggacgcaggtagtgacacacacacagccacacacacacacacagacacaccca
atggcagggtcagggacgcaggtagggacacacacacagccacagacacacacacagaca
cacccaatggcagggtcagagacgcaggtagggacacacacagacacacacacacagatg
ggtccctctcatgagctccctatagggcatggcagtgggtatgagggggggagaggggag
gagagagggtcacaaacacctcaccgcacacacactgacacacagcccaacacaggagag
aggcaacacattgacaacacagagagaacacaggagataggaagacagcaacaactacaa
cagtactaccaacaacaacaatatctacaacaacagcgacaatatcaacaacaacaacag
caacatcaacaacatcaacaacaacagtaccaaccatacagccaagagccagagctcagg
actcaatacaaacacaacgctccccaatccgacagcagcggaccacctgacacaaaacaa
ccggccaatcacaaaccagaactggtccacagcaacacagaaccgaccgatgataatgac
tcaagcacagaggtggccaatagagacgctctaaaggatacagaggtcaccagtcaggga
caggcagcgacagaagtgaccaatcacagaaaggaggacgataaagagcgacacagccag
acagagctgtccaatcaggaacaaagacactcagagtcgaccaatcagggtgactctgtc
acagaggaggagagcaggaagaaacttctwgaactcttacagagagaactgggccagaaa
caacagcatcatcctcctcatcctcatcttcctcatcaagatcatcatcatcctcaccat
cgtcagtctcgaacacaaaccaccaccacacaaagaccagtgccccccacgttgtcctcc
agcagggccccagggtggtcccccagcaccccgtcccctccccccaagcccccgcagggc
ccgttcagaccggcccttccccgcggacgcaggaggaggaaacaccggagccgcatcagc
aaggctgccctccgaaccatgatcatgtag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112241368
Entry
112241368         CDS       T05605                                 

Definition
(RefSeq) platelet-derived growth factor subunit A-like
  KO
K04359  platelet-derived growth factor subunit A
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04020  Calcium signaling pathway
otw04510  Focal adhesion
otw04540  Gap junction
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112241368
   04020 Calcium signaling pathway
    112241368
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112241368
   04540 Gap junction
    112241368
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112241368
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:otw04052]
    112241368
   00536 Glycosaminoglycan binding proteins [BR:otw00536]
    112241368
Cytokines and growth factors [BR:otw04052]
 Growth factors
  Growth factors (RTK binding)
   112241368
Glycosaminoglycan binding proteins [BR:otw00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   112241368
SSDB
Motif
Pfam: PDGF_N PDGF
Other DBs
NCBI-GeneID: 112241368
NCBI-ProteinID: XP_024265250
LinkDB
Position
Unknown
AA seq 243 aa
MRAAFLSFLLACLLCLLRTAAEEDPLPPELLERLSRSEIRSISDLQRILELDLEENEVIG
ENKQRYHNKAFPHSYSQLKSSQTHSRHKRSIGKGALPAACKTRTVIYEIPQPVDPTSANF
IIWPPCVEVKRCTGCCNTSNMHCLPSRKHHRTVKVAKVEYVRRRPKLKEVLVRLEEHLEC
ICTSKRHIKELYDTDNDPPLPPPPPSFTGPSRTKGKGRKRKKLKNLKEFLIPFSGMWKNM
SVY
NT seq 732 nt   +upstreamnt  +downstreamnt
atgagagccgcttttctgagcttcctcctcgcctgcttattgtgcctgttacgcaccgcc
gctgaggaggacccactccccccggagctgttggagcggctgtcccgcagtgagatccgc
agcatcagcgacctccagcggatcctggagctagacttggaagagaatgaggtgatcggg
gagaacaaacagaggtaccacaacaaggccttcccccacagctactcacagctgaagagc
tctcagacacactccaggcacaagaggagcatcggtaaaggagcgttacccgcggcgtgt
aagactcgtacggtgatctacgagatccctcagccagtggatcccacctccgctaacttc
atcatctggcccccctgtgtagaggtgaagagatgtaccggatgctgcaacaccagcaac
atgcactgcctgccttcccgcaagcaccatcgcactgtcaaggtggctaaggtggagtat
gtgaggaggcgtcctaaactgaaggaggtgctggtgcggctggaggagcaccttgagtgt
atatgcacctccaaacgacacatcaaggaactctacgatacagacaatgacccccctctt
ccccctcctcccccttcattcacaggacccagtaggaccaagggtaaagggaggaaacgg
aaaaagctcaaaaacctcaaagaatttctcatacctttctcaggcatgtggaaaaacatg
agtgtttattag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112245248
Entry
112245248         CDS       T05605                                 

Definition
(RefSeq) hepatocyte growth factor-like isoform X1
  KO
K05460  hepatocyte growth factor
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04020  Calcium signaling pathway
otw04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112245248
   04020 Calcium signaling pathway
    112245248
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112245248
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:otw04052]
    112245248
   00536 Glycosaminoglycan binding proteins [BR:otw00536]
    112245248
Cytokines and growth factors [BR:otw04052]
 Growth factors
  Growth factors (RTK binding)
   112245248
Glycosaminoglycan binding proteins [BR:otw00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   112245248
SSDB
Motif
Pfam: Kringle Trypsin PAN_1
Other DBs
NCBI-GeneID: 112245248
NCBI-ProteinID: XP_024269027
LinkDB
Position
Unknown
AA seq 713 aa
MWIYNIIFMLLIVHYSECRRNALQDYQRSDSVRLVQLPDSALQTISRKLSIVKCARGCSR
NKRLLFTCRAFLYDQKNRKCQWLSFDRNSPGVHSQHDFNYQLYQKKSYVQECIVGTGVNY
RGRRSVTASGIKCQAWASPIPHEHNFLPRRNRKKDLRENYCRNPDNATSGPWCFTTDPNV
RHQDCGVPQCSQVECVSCNGESYRGPMDHTETGWECQRWDLEEPHKHLFHPKRYPDKGLV
DNYCRNPDGRQRPWCFTTDPHTLWEYCNITACSTDSVVELEVTTMCFWGQGEGYRGSVAV
TPSGVICQRWDSQYPHNHSYLPQNYRCKDLTENNCRNPDGRDLPWCFTSDPNVRTAFCTN
IPRCGKQNTEPQDCYTGSGENYRGEVSRTRSGLPCSLWSDHSNSGDRDAAVLTVRQEGSF
CRNPDRDTYGPWCYTNSTAIPWDYCSIKLCEPSENTIPQRVEVSKVLCFIHKRTRIVGGA
PIAITDGSWMVSIQKGSSHWCGGSLIREEWVLTDRQCFSSCVPDLSEYRVWLGVSDLRGS
APNGSFRQEVSISHVVCGPEGSNLALIRLAKPALPADSVHTIQLPVAGCSIAEGTMCSMY
GWGETKGTGHEGVLKVVHLPMVSNERCREQHRGNLHITDTKICAGGRRDEGVCERDYGGP
LVCQEGESRVIVGVSVHGRGCARANRPGIFINIPFYTQWIHKVFRHYPEPQIN
NT seq 2142 nt   +upstreamnt  +downstreamnt
atgtggatttacaacatcatttttatgctcttaattgtccactattctgagtgcaggagg
aatgcattgcaggactaccagagaagcgatagtgtgcgattggtccagctgccagactct
gccctccagactataagcaggaagttgagcatagtgaagtgtgcccggggctgcagccgc
aacaagcgactactcttcacctgcagagcatttctgtacgatcagaaaaacaggaaatgc
cagtggctttcattcgacaggaactcaccaggagtccatagccaacacgacttcaactac
caactctaccagaagaaatcctatgtgcaggagtgcatagtagggacaggagtgaactac
agagggaggaggtcagtaacagccagtggaataaagtgccaggcatgggcctctcctatc
cctcacgaacacaatttcctaccaaggaggaacaggaagaaggacctgagagagaactac
tgtcgtaaccctgacaatgctacctcaggaccatggtgtttcactacagaccccaatgtc
agacaccaggactgtggagtacctcaatgctcacaagtggagtgtgtgagctgtaacggg
gagagctacagaggtcccatggatcacacagagacaggatgggagtgtcagcgctgggac
ctggaggaaccacacaaacacctcttccaccccaagaggtatcctgataaaggcctggtt
gataactactgtaggaacccagatggacgtcaacgaccgtggtgtttcaccacggaccca
cacacactctgggagtactgcaacatcacagcctgctccacagacagtgtggtagagttg
gaagtgactactatgtgtttctggggtcaaggtgaaggctacagagggtcagtagcagta
acacccagtggggtgatctgtcaacgctgggactcacagtacccccacaaccactcatac
cttccccagaactaccgctgcaaagacctgacggagaacaactgcaggaacccagatgga
cgtgacctcccatggtgcttcacttcagaccctaacgttcgcacagcgttctgcactaac
atcccccgctgtggcaaacagaacactgaacctcaagactgctacacgggtagtggagag
aactacagaggcgaggtttccaggaccaggtcaggtcttccctgttccctctggagtgac
cacagcaacagtggtgacagagatgcggcggtgctgactgtcagacaggaggggagtttc
tgtaggaacccagacagagatacatacggcccctggtgttacactaacagcactgctata
ccctgggactactgcagcatcaaactatgtgaaccatcagagaacaccattccacagaga
gtagaggtgtccaaggtgttgtgtttcatccataagaggaccaggatagtaggaggagct
ccaattgccattacagacggaagctggatggtcagcatacagaaagggtccagtcactgg
tgtggaggttctcttatacgggaggagtgggttctcactgacagacagtgtttctcctca
tgtgttccagacctgagtgagtaccgtgtttggttgggtgtgtcagacctccgtggctcg
gctcctaacggctccttcagacaggaagtctccatctcccatgtggtctgtggtcctgag
ggctccaacctggccctcatacggctggccaagcctgccctccctgcagacagtgttcac
accattcagctgccggtggctgggtgctctattgctgagggtacgatgtgtagcatgtat
ggatggggcgaaaccaaagggacgggtcatgagggtgttctgaaggtggtccatctgccc
atggtcagtaatgagaggtgtagagaacaacacagagggaacctccacatcacagacacc
aagatctgcgctggggggaggagggatgagggggtctgtgagagggactatggtggcccc
ttagtgtgccaggaaggagagagcagggtcatagtgggagtcagtgtccatggcagaggc
tgtgcccgtgccaaccgccctggcatcttcatcaacatccccttctacacacagtggatc
cacaaggtgttcagacactaccctgaacctcagatcaactag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112246255
Entry
112246255         CDS       T05605                                 

Definition
(RefSeq) vascular endothelial growth factor C-like
  KO
K05449  vascular endothelial growth factor C/D
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04020  Calcium signaling pathway
otw04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112246255
   04020 Calcium signaling pathway
    112246255
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112246255
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:otw04052]
    112246255
Cytokines and growth factors [BR:otw04052]
 Growth factors
  Growth factors (RTK binding)
   112246255
SSDB
Motif
Pfam: PDGF CXCXC
Other DBs
NCBI-GeneID: 112246255
NCBI-ProteinID: XP_024270320
LinkDB
Position
Unknown
AA seq 431 aa
MHLFGISVLLANSAILYANLASESSHEFSHDYYDYDQDQGDAPEPSEPDLEQQLRSVASV
EELMRIVYPNYYRVLSCRSKRGARFPLREEHTATETRSRSELPAYAGAPFNPDTLKSIES
EWKKTQCMPREVCLDVGKEFGAATNTFYKPPCVSVYRCGGCCNSEAHQCLNISTSYISKT
LFEITVSSSTNNNLVTISFANHTVCNCLSKLDAYRQVHSIIRRSLPECLVANKTCPKNHS
WSNRLCRCMAVQRDTPPPPQIQHSDSFEVDVCGSDKELDEETCQCVCRRQLRASGACGLH
RYLDKNTCQCVCKTLPSSCRPHQLFNKDTCQCVCKTLPSSCGPHQLFNKDTCQCSCARTC
PKHQPLNRTKCACECNESPNRCFLKGKRFHQATCSCYGPPCDVRRNRRCASGFYFSEEVC
RCVPTYWRRQD
NT seq 1296 nt   +upstreamnt  +downstreamnt
atgcacttatttggaatatctgttctccttgccaattcagcgattctctacgcaaatcta
gccagtgaatcgagtcatgaattcagtcatgactattatgattatgatcaggatcaaggg
gatgcaccggagccgtcggagccagaccttgagcagcagctgcgctccgtggccagtgtt
gaggaactgatgaggatagtgtaccctaactactacagagtgctcagttgccggtcgaag
cggggcgcacgcttccccctgagagaggaacacacagccacggaaacgcggtcgcgcagc
gaactgccggcgtacgctggtgctcccttcaaccctgacacactgaaaagtattgagtca
gagtggaaaaagacccagtgcatgccacgagaagtttgtttagatgtggggaaagagttt
ggggcggctacaaacaccttctataaaccaccctgcgtgtctgtctacagatgtgggggc
tgctgcaacagcgaggcgcatcagtgtttgaacatcagcacctcctacatcagcaagacg
ctgtttgaaatcacagtttccagcagtacaaataacaacctagtgactatcagctttgcc
aaccacaccgtgtgcaattgtctgtccaaactggacgcctacagacaagtacactccatc
atacgacgatctctaccagaatgtctggtagccaataaaacctgcccaaagaaccacagc
tggagcaaccgcttgtgcagatgtatggcggtgcaacgtgacacccctcccccgccccag
atacaacactcggactcgtttgaagtggatgtctgcgggtcagataaggagttggacgag
gagacgtgccagtgtgtttgcaggcgacagctccgggcctcgggcgcatgcggactccac
cgctacctggataagaacacgtgccagtgtgtgtgtaagacgctcccctcgtcctgtagg
ccgcaccagcttttcaataaagacacgtgccagtgtgtgtgtaagacgctcccctcgtcc
tgtgggccgcaccagcttttcaataaagacacgtgccagtgctcctgcgccaggacgtgc
cccaagcaccagccrctcaaccgcaccaagtgtgcctgcgagtgcaacgagtcacccaac
aggtgcttcctgaaaggcaaaaggttccaccaggccacctgcagttgctacggaccacct
tgtgacgtgcggaggaatcggcgctgtgcatcaggtttttacttcagtgaggaggtctgc
cggtgcgtaccgacatactggagaagacaggattaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112247795
Entry
112247795         CDS       T05605                                 

Definition
(RefSeq) platelet-derived growth factor D-like
  KO
K05450  platelet derived growth factor C/D
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04020  Calcium signaling pathway
otw04510  Focal adhesion
otw04540  Gap junction
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112247795
   04020 Calcium signaling pathway
    112247795
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112247795
   04540 Gap junction
    112247795
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112247795
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:otw04052]
    112247795
Cytokines and growth factors [BR:otw04052]
 Growth factors
  Growth factors (RTK binding)
   112247795
SSDB
Motif
Pfam: PDGF CUB YceG_bac
Other DBs
NCBI-GeneID: 112247795
NCBI-ProteinID: XP_024272388
LinkDB
Position
Unknown
AA seq 283 aa
MSFYVCLAIHQGEPLFSPFLCRYDFVEVEDISETSTIVWGRWCGQRVPPRLTSKTNTLKV
SFKSDDYFVAKPGFKLHFSLQDDSLPAVSKTNWETVALMEDSLSVLAPAVTDVPLTAAAL
DQSIAAFNTVEQLLRHLNPDSWRQDLDSLYRETAMYRPRAYQHNRQNKIDLDRLYDDVKR
YSCTPRNYSVNLREELRATNAVFFPRCLLVQRCGGNCACGTDNWNSCTCSPAKTSDKLHE
VLKYAPEVGGYSRRQTIRVSWALEVHLTHHERCDCVCPSRPPR
NT seq 852 nt   +upstreamnt  +downstreamnt
atgtcgttctacgtatgtctagcgatccatcagggtgagcccctcttctcccccttcctt
tgcagatatgactttgtggaggtggaggacatctcagagaccagtactattgtctggggg
agatggtgtggtcagagagtcccccctcgtcttacctccaaaaccaacaccctcaaagtc
tccttcaagtcggacgactactttgtggcaaagcctggcttcaaactccacttctctcta
caggatgattctcttcctgcagtgtcaaagactaactgggagactgtggccctgatggag
gacagtctgtcagtgttggctccagcggtgactgatgttcctctgacagcagcggcgttg
gaccagagcatagcagccttcaacacagtggagcagctcctccgccacctcaaccctgac
agctggagacaggacctggacagcttgtacagagagacagccatgtacagaccccgagcc
taccagcacaacagacagaacaagattgacctggaccgtctgtatgatgacgtgaagcgc
tacagctgtacacctcggaactactctgtcaacctgagggaggagctgagggccaccaac
gccgtgttcttcccacgatgcctactggtgcagcgctgtggggggaactgtgcctgtggg
acggacaactggaacagctgtacctgcagcccggccaagaccagtgacaaactacacgag
gtgttgaagtatgctcctgaggtgggaggttattcacggcgtcagacaattcgtgtcagc
tgggccctagaggtccatttgacgcaccacgagcgctgtgactgtgtttgtccctccaga
ccaccccgctga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112250395
Entry
112250395         CDS       T05605                                 

Definition
(RefSeq) vascular endothelial growth factor A-A-like
  KO
K05448  vascular endothelial growth factor A
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04020  Calcium signaling pathway
otw04370  VEGF signaling pathway
otw04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112250395
   04370 VEGF signaling pathway
    112250395
   04020 Calcium signaling pathway
    112250395
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112250395
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:otw04052]
    112250395
   00536 Glycosaminoglycan binding proteins [BR:otw00536]
    112250395
Cytokines and growth factors [BR:otw04052]
 Growth factors
  Growth factors (RTK binding)
   112250395
Glycosaminoglycan binding proteins [BR:otw00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   112250395
SSDB
Motif
Pfam: PDGF Peptidase_C37
Other DBs
NCBI-GeneID: 112250395
NCBI-ProteinID: XP_024276266
LinkDB
Position
5
AA seq 195 aa
MNFDSLITLFLLTLLYLSAVKSAHIPKDGGRSAHDGVISFMEVYNKSLCQPRELLVEILQ
EYPEEVEHIFIPSCVVLTRCAGCCNDEMLQCTPTSTHNVTMEIKRIKPHKQQNDIFMSFT
EHNACECRPKNEVKEQKEKEPWKGKGKGQKRKRKKKRDKKNRHSYVSSAFSSLHLHLTVA
FLIIKLVWEELICPF
NT seq 588 nt   +upstreamnt  +downstreamnt
atgaactttgacagtttgataacattatttctcctgacacttctgtatttgtcagctgtc
aagagtgcccacatacctaaggacggagggagaagtgcgcatgacggcgtgatctccttc
atggaggtgtacaataagagcctgtgtcagcccagggagctgctggtagagatcctacag
gagtacccagaggaggtagaacacatcttcatcccatcctgtgtggtgctgacacgctgt
gcaggctgctgcaacgacgagatgctacagtgtacgccaacctccacgcataacgtcacc
atggagataaaaagaataaaaccccacaagcaacaaaatgatatcttcatgagttttaca
gaacacaatgcatgtgaatgcaggccaaagaatgaagtgaaagaacagaaagaaaaagaa
ccctggaaaggcaagggcaaaggccaaaagagaaagcgaaagaaaaagcgtgacaaaaag
aatcgccactcgtatgtcagctcggccttctcctcgctccacctgcacctgactgtggcg
tttctgatcattaagcttgtttgggaggagttaatttgccccttttaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112250555
Entry
112250555         CDS       T05605                                 

Definition
(RefSeq) vascular endothelial growth factor A-like isoform X1
  KO
K16859  placenta growth factor
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112250555
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112250555
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:otw04052]
    112250555
Cytokines and growth factors [BR:otw04052]
 Growth factors
  Growth factors (RTK binding)
   112250555
SSDB
Motif
Pfam: PDGF
Other DBs
NCBI-GeneID: 112250555
NCBI-ProteinID: XP_024276574
LinkDB
Position
5
AA seq 170 aa
MNTFSFKMHVLVGVSQILATLMFHLAPTQTSHSPVEPHSRVMLFREVLGRSLCRSMERLV
EVEQEYPGGVEYIFSPACVPLWRCAGCCGDENLECHPTLTRNVTMQLMRITPTERTGQYV
ELTFVEHQTCECRHRKMHLNESSPRVRIHPRRRKHRKRSKDCGKCQHPHN
NT seq 513 nt   +upstreamnt  +downstreamnt
atgaacactttttccttcaagatgcacgttctcgtcggcgtctcgcagattttggcaact
cttatgttccacttggcacctactcagacttctcactccccagtggaaccacactctaga
gtgatgctgttccgggaggttttggggcggagtttgtgtcgttcgatggagcgattggtg
gaggtggagcaggagtaccctggaggagtggaatatatttttagccctgcctgcgtgccc
ctgtggcgatgcgctggttgctgtggagacgagaacctggagtgtcaccccaccctcaca
cgtaacgtcaccatgcagttgatgaggataactccgactgagaggacagggcagtacgtg
gagctgacgtttgtggagcatcagacttgtgagtgcagacacaggaagatgcatttgaat
gagagcagtcccagagtcaggatccatcccaggaggaggaagcacaggaaaagatccaaa
gactgtggcaagtgtcagcacccacacaattag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112252444
Entry
112252444         CDS       T05605                                 

Definition
(RefSeq) hepatocyte growth factor-like isoform X1
  KO
K05460  hepatocyte growth factor
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04020  Calcium signaling pathway
otw04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112252444
   04020 Calcium signaling pathway
    112252444
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112252444
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:otw04052]
    112252444
   00536 Glycosaminoglycan binding proteins [BR:otw00536]
    112252444
Cytokines and growth factors [BR:otw04052]
 Growth factors
  Growth factors (RTK binding)
   112252444
Glycosaminoglycan binding proteins [BR:otw00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   112252444
SSDB
Motif
Pfam: Kringle Trypsin PAN_1
Other DBs
NCBI-GeneID: 112252444
NCBI-ProteinID: XP_024279434
LinkDB
Position
6
AA seq 713 aa
MWIYNIIFMLLIVHYSECRRNALQDYQRSDSVRLVQLPDSALQTISRKLSIVKCARGCSR
NKRLLFTCRAFLYDQKNRKCQWLSFDRNSPGVHSQHDFNYQLYQKKSYVQECIVGTGVNY
RGRRSVTASGIKCQAWASPIPHEHNFLPRRNRKKDLRENYCRNPDNATSGPWCFTTDPNV
RHQDCGVPQCSQVECVSCNGESYRGPMDHTETGWECQRWDLEEPHKHLFHPKRYPDKGLV
DNYCRNPDGRQRPWCFTTDPHTLWEYCNITACSTDSVVELEVTTMCFWGQGEGYRGSVAV
TPSGVICQRWDSQYPHNHSYLPQNYRCKDLTENNCRNPDGRDLPWCFTSDPNVRTAFCTN
IPRCGKQNTEPQDCYTGSGENYRGEVSRTRSGLPCSLWSDHSNSGDRDAAVLTVRQEGSF
CRNPDRDTYGPWCYTNSTAIPWDYCSIKLCEPSENTIPQRVEVSKVLCFIHKRTRIVGGA
PIAITDGSWMVSIQKGSSHWCGGSLIREEWVLTDRQCFSSCVPDLSEYRVWLGVSDLRGS
APNGSFRQEVSISHVVCGPEGSNLALIRLAKPALPADSVHTIQLPVAGCSIAEGTMCSMY
GWGETKGTGHEGVLKVVHLPMVSNERCREQHRGNLHITDTKICAGGRRDEGVCERDYGGP
LVCQEGESRVIVGVSVHGRGCARANRPGIFINIPFYTQWIHKVFRHYPEPQIN
NT seq 2142 nt   +upstreamnt  +downstreamnt
atgtggatttacaacatcatttttatgctcttaattgtccactattctgagtgcaggagg
aatgcattgcaggactaccagagaagcgatagtgtgcgattggtccagctgccagactct
gccctccagactataagcaggaagttgagcatagtgaagtgtgcccggggctgcagccgc
aacaagcgactactcttcacctgcagagcatttctgtacgatcagaaaaacaggaaatgc
cagtggctttcattcgacaggaactcaccaggagtccatagccaacacgacttcaactac
caactctaccagaagaaatcctatgtgcaggagtgcatagtagggacaggagtgaactac
agagggaggaggtcagtaacagccagtggaataaagtgccaggcatgggcctctcctatc
cctcacgaacacaatttcctaccaaggaggaacaggaagaaggacctgagagagaactac
tgtcgtaaccctgacaatgctacctcaggaccatggtgtttcactacagaccccaatgtc
agacaccaggactgtggagtacctcaatgctcacaagtggagtgtgtgagctgtaacggg
gagagctacagaggtcccatggatcacacagagacaggatgggagtgtcagcgctgggac
ctggaggaaccacacaaacacctcttccaccccaagaggtatcctgataaaggcctggtt
gataactactgtaggaacccagatggacgtcaacgaccgtggtgtttcaccacggaccca
cacacactctgggagtactgcaacatcacagcctgctccacagacagtgtggtagagttg
gaagtgactactatgtgtttctggggtcaaggtgaaggctacagagggtcagtagcagta
acacccagtggggtgatctgtcaacgctgggactcacagtacccccacaaccactcatac
cttccccagaactaccgctgcaaagacctgacggagaacaactgcaggaacccagatgga
cgtgacctcccatggtgcttcacttcagaccctaacgttcgcacagcgttctgcactaac
atcccccgctgtggcaaacagaacactgaacctcaagactgctacacgggtagtggagag
aactacagaggcgaggtttccaggaccaggtcaggtcttccctgttccctctggagtgac
cacagcaacagtggtgacagagatgcggcggtgctgactgtcagacaggaggggagtttc
tgtaggaacccagacagagatacatacggcccctggtgttacactaacagcactgctata
ccctgggactactgcagcatcaaactatgtgaaccatcagagaacaccattccacagaga
gtagaggtgtccaaggtgttgtgtttcatccataagaggaccaggatagtaggaggagct
ccaattgccattacagacggaagctggatggtcagcatacagaaagggtccagtcactgg
tgtggaggttctcttatacgggaggagtgggttctcactgacagacagtgtttctcctca
tgtgttccagacctgagtgagtaccgtgtttggttgggtgtgtcagacctccgtggctcg
gctcctaacggctccttcagacaggaagtctccatctcccatgtggtctgtggtcctgag
ggctccaacctggccctcatacggctggccaagcctgccctccctgcagacagtgttcac
accattcagctgccggtggctgggtgctctattgctgagggtacgatgtgtagcatgtat
ggatggggcgaaaccaaagggacgggtcatgagggtgttctgaaggtggtccatctgccc
atggtcagtaatgagaggtgtagagaacaacacagagggaacctccacatcacagacacc
aagatctgcgctggggggaggagggatgagggggtctgtgagagggactatggtggcccc
ttagtgtgccaggaaggagagagcagggtcatagtgggagtcagtgtccatggcagaggc
tgtgcccgtgccaaccgccctggcatcttcatcaacatccccttctacacacagtggatc
cacaaggtgttcagacactaccctgaacctcagatcaactag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112256330
Entry
112256330         CDS       T05605                                 

Gene name
egf
Definition
(RefSeq) pro-epidermal growth factor
  KO
K04357  epidermal growth factor
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04012  ErbB signaling pathway
otw04020  Calcium signaling pathway
otw04068  FoxO signaling pathway
otw04510  Focal adhesion
otw04540  Gap junction
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112256330 (egf)
   04012 ErbB signaling pathway
    112256330 (egf)
   04068 FoxO signaling pathway
    112256330 (egf)
   04020 Calcium signaling pathway
    112256330 (egf)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112256330 (egf)
   04540 Gap junction
    112256330 (egf)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112256330 (egf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:otw04052]
    112256330 (egf)
Cytokines and growth factors [BR:otw04052]
 Growth factors
  Growth factors (RTK binding)
   112256330 (egf)
SSDB
Motif
Pfam: Ldl_recept_b FXa_inhibition EGF_CA cEGF EGF EGF_3 DUF5050 EGF_MSP1_1 Plasmod_Pvs28 hEGF
Other DBs
NCBI-GeneID: 112256330
NCBI-ProteinID: XP_024285270
LinkDB
Position
8
AA seq 1048 aa
MDLDGGNQKRVVTGVGNSILLDFHYTEGRVYWADKKTGVIYKAAMDGTQRQKLHSSEKGI
SGLAVDWVHNFVIWTSGEVGSIKRVDTDGKNERTLLRHLSQPISIAVAPNDRFIFWLSDG
ITPSIQRSDVAGEMITTVLKIPERLGGLSVDRMDKRLFWVQFSLEGESAIGSCDYNGNVV
NVIDQPLLSQSLGMSVFLEQVFYTDMSSRTIRQVNKYSGVEAENINLKRMTHPPTAVKVV
HPLNQPIEDSMPVFPVCDGRTGVCVNVCSNPADQGICQCTKGFALSKHGNYCEDVNECGL
WDHGCSLGCENIPGSYFCTCPKGYALLPDRKTCHETSPCLANMTQCDNGCIATGEGTICV
CLEGSLLQPDGQTCRGCTSSDRGGCSQQCSPITPGRWECDCLPGYKLHQDGKRCTATGPP
PYLLFANIVNIRRVNLDGTGDQSLVEEPSGTVIALDYDPVQNKVYFASTVLKQIERADLD
GGSREVLLTEELDSPEGLAVDWVNRKLYWTDRGLSTIDRSTLDGFDRETIISKGIQKPRG
IAVHPLAKKLFWTDMGTRPVLESASLEGSDRAVIASADLVSPSGLTIDFTEDRLYWCDSK
RGVLETASLDGSNRQVLTENEVGQPFDLAVFEDRLWITDREQQLLLSVDKWTGMDPERLH
GNMVQPASIVVVHPLAKPGANVCLYRNGGCAQVCESRLGFAHCSCHSHIAQSADGKGCLP
SYRSTGDMNSNSGDGESADPFSLKNKTLNDESMPLPPTLFIETMVSDQDDCFSLRCDVNA
QCLLDGGNPTCHCLEGFTGDGELCLDLDECMLGMALCSIQSSVCVNTAGGYYCQCRPGFS
GEEHHCTDFDECKMGTHKCDERAECINTIGKYRCKCQAGYSGNGHTCQELSTTSSWVTTS
RPMDVTSQWLNTNTVESCPSSHDTYCLYEGVCLYFPEMESYACNCISGYMGERCQFSDLE
WWELQQAEQEKRRNVAIALGMVVLITLLSIAACVTYCYGSRRFVRKHPSVDDMSETSTSD
DTMSETTVPKTPRVSLNPVNGDFRTEKQ
NT seq 3147 nt   +upstreamnt  +downstreamnt
atggaccttgatggagggaatcaaaaaagggttgtgaccggtgttggaaactctatccta
ctggacttccactacacagaggggagagtttactgggccgataaaaagacaggggtcatc
tacaaagcagcgatggatggaacacagagacagaagctgcactcgtctgagaaagggatc
tcaggccttgcggtcgactgggttcacaattttgtcatttggaccagtggagaagtggga
agtatcaaaagagtggatacagatgggaaaaatgagaggactcttctaagacatttatcg
cagccaatctccatagcagttgcaccaaatgacagatttatattctggctgtctgatgga
atcacacccagtattcagaggtcggatgtagcgggagagatgattactacagtgctgaag
attccggagagactgggagggctgtcggtcgaccggatggacaagagactgttctgggtc
cagttcagtctggaaggagaaagtgccattgggtcgtgtgactacaacgggaatgttgtc
aatgtcattgaccagccactactgtctcagtctttggggatgtctgtgttcctggagcaa
gtcttctacactgatatgagttcacggaccatacggcaagtcaataagtactcaggggtt
gaggcagaaaacatcaacctaaagcgaatgacacacccccctactgctgtcaaggtggta
catcccctcaaccagccaattgaagactccatgcctgtctttccagtgtgtgatggtcgt
acaggagtgtgtgtgaatgtgtgctccaacccagctgaccaggggatctgccagtgcact
aaaggctttgcccttagcaaacatgggaactactgtgaagatgtcaatgagtgtggcctg
tgggaccacggctgttccctgggctgtgagaacattccaggctcctacttctgcacctgc
cccaagggttacgctctgcttcctgataggaaaacctgccacgagacctcaccatgtctg
gccaatatgacccagtgcgataatggatgtattgctactggtgaggggaccatctgtgtg
tgtctagaggggtccctactacagccggatggacagacctgcagaggctgcacctcttcc
gaccgagggggctgtagtcagcaatgttcccccatcactcctggtaggtgggagtgtgac
tgtctgcctgggtacaagctccaccaagacggtaaacgctgcacagccactggaccccca
ccttatctgctgtttgccaacatagtaaacatcagacgtgttaatctggatgggactggt
gaccaaagccttgtggaggagccgagcggaacagtaatagctctggactatgatcccgta
caaaacaaagtgtactttgccagtacagtactgaaacagattgagcgtgctgatttggac
ggcgggtccagggaggttttgctcactgaggagttggactcaccagagggcctggctgtg
gactgggtcaaccgcaagctctactggactgaccgaggcctctcaactattgaccgcagc
accttggatggcttcgacagagagaccattattagcaaaggcatacagaaaccaagggga
attgcagttcatcctttagccaagaagttgttctggaccgatatgggtaccaggcctgtg
ttggagagtgcgtctttggaaggaagtgatcgtgcggtcatcgcaagcgccgacttggtg
tctcctagtggtctgaccattgacttcactgaagacaggctgtactggtgtgacagcaag
aggggcgtactggagacggcatccctggatggctccaaccgacaagtcttgacagagaac
gaagtaggtcaaccttttgacctggcagtgtttgaggacaggttgtggatcacggacagg
gagcagcagctgctcctgagcgttgacaaatggacggggatggacccagagcgtctccat
ggcaacatggtccaaccagcatccatagttgtggttcaccccctcgccaagccaggagca
aatgtttgtctctatcgaaatgggggctgtgctcaggtgtgtgagagcaggctaggattc
gcccactgctcctgtcactcacacattgcccaatcagctgatggcaaaggctgcttgcca
tcctacagatcaacaggtgatatgaactccaattctggagatggtgagtctgcagacccg
ttctctctgaaaaacaaaactttgaacgatgagagcatgcctctccctcccacactcttc
attgagacgatggtgtcagaccaggatgactgcttctctctccgctgtgatgtgaatgcg
caatgtctactggatggaggcaaccccacctgccactgcctggaaggtttcactggggat
ggagagctgtgtttggaccttgatgagtgcatgttggggatggccctgtgtagtatccag
agctcagtgtgtgtcaacactgctggtggatattactgccagtgtcgccctggcttcagt
ggagaggagcaccactgtaccgattttgacgagtgtaaaatgggaacacacaaatgtgat
gagcgagcggaatgcatcaatactatagggaagtaccgctgcaagtgtcaagctggctac
agtggtaatggacacacatgccaagagttgtcaactacgtcctcgtgggtgaccaccagt
aggcctatggacgtcaccagccaatggctgaacactaacacagtggagagctgcccctca
tctcatgacacttactgtctctacgagggagtctgcttgtacttcccagagatggagtcc
tatgcctgcaactgtatctcgggctacatgggagagcgctgtcagttcagtgatctggag
tggtgggagctacagcaggccgaacaagagaagagaaggaacgtggccatcgccctgggc
atggtggtcctcatcaccctgctctccattgctgcctgcgtcacctactgctacgggtcc
aggagatttgttcggaaacacccctcggtggatgacatgagcgagacaagcaccagtgat
gacaccatgtcagagaccaccgtccccaagacgccacgggtaagtctgaacccagttaat
ggtgacttccgtacagaaaaacaatga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112256335
Entry
112256335         CDS       T05605                                 

Definition
(RefSeq) platelet-derived growth factor C-like
  KO
K05450  platelet derived growth factor C/D
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04020  Calcium signaling pathway
otw04510  Focal adhesion
otw04540  Gap junction
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112256335
   04020 Calcium signaling pathway
    112256335
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112256335
   04540 Gap junction
    112256335
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112256335
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:otw04052]
    112256335
Cytokines and growth factors [BR:otw04052]
 Growth factors
  Growth factors (RTK binding)
   112256335
SSDB
Motif
Pfam: CUB PDGF
Other DBs
NCBI-GeneID: 112256335
NCBI-ProteinID: XP_024285275
LinkDB
Position
8
AA seq 333 aa
MILPLFILLVSLLQKHGSEAESSHISKFQQPSLKEQNGVQDSQHEKIIPVTGEGVIHSPD
FPLTYPRSTVLVWRLVASNDNMRIQLSFDERFGLEDPEDGICKYDFVELEEPSEDTIVGR
WCGSQVPASHMSKGGQIRVRFRSDEYFPSEPGFSIRYSLLPMPEVTPSLQSADALSEAVA
GLGTVEEVMKYLEPERWQLDMEDLYKPTWHILGKSFLHNKKSRGVDLNLLREEVRLYSCT
PRNFSISLREELKRTDAIFWPSCLLVKRCGGNCACCSHRCTDCQCVPSRVVKKYHEVLLL
KHRSGGRGLQKSMTDVPLEHHEECDCVCKDDWD
NT seq 1002 nt   +upstreamnt  +downstreamnt
atgatccttccattattcatcctacttgtgtcgcttctccaaaaacatggctcagaagct
gaatcaagtcacatcagcaaattccaacaaccaagtttaaaggaacaaaacggagtccaa
gattcccagcatgagaagataatccccgtcacaggagagggagtgatccatagtccggac
ttcccactcacctaccccaggagtaccgtgttggtctggagactagtggcctccaatgac
aacatgagaatccagttatccttcgacgagaggtttggcctggaagacccagaggatgga
atatgcaagtatgattttgtggagctcgaggagccgtccgaggacaccatcgtgggccgc
tggtgcgggtcccaggtacccgccagccacatgtccaaaggcggtcagatccgggtgaga
ttcagatctgatgagtacttcccctccgagcctggcttcagcattcgctactccctgctc
cccatgcccgaggtaactccatctctgcagagcgcagatgcgttgtctgaggccgtggct
ggcctcggtaccgtggaggaggtcatgaagtacctggagcctgagagatggcagcttgac
atggaagacctatacaagcccacgtggcacatcctggggaagtcattcctccacaacaag
aaatccagaggagtggatctcaacctgttgagagaagaggtgagactgtacagctgcacg
ccccgcaacttctccatctccctgcgcgaggagctcaagaggacggacgccatcttctgg
cccagctgcctcctggtgaagcgctgcgggggcaactgtgcctgctgctcgcatcgctgc
accgactgccagtgtgtgccttcccgggtcgtcaagaagtaccacgaggttctcctgctg
aagcaccgaagcgggggccgaggcctgcagaagtccatgaccgatgtgcccttggaacac
cacgaggagtgcgactgtgtttgcaaagacgactgggactga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112256717
Entry
112256717         CDS       T05605                                 

Definition
(RefSeq) placenta growth factor-like
  KO
K16859  placenta growth factor
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112256717
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112256717
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:otw04052]
    112256717
Cytokines and growth factors [BR:otw04052]
 Growth factors
  Growth factors (RTK binding)
   112256717
SSDB
Motif
Pfam: PDGF Alpha_adaptinC2
Other DBs
NCBI-GeneID: 112256717
NCBI-ProteinID: XP_024285932
LinkDB
Position
8
AA seq 165 aa
MKPFASFVIQIAVTLQLQFSPAQSTPSPSANSTTGVLMFQDVWGRSFCRTIEKLVEVVQE
YPGEVEHIYSPSCVPLVRCAGCCGDENLECHPTQTSNVTMQLLKIKPAEQGQEYVEMTFV
EHQTCECRIRKAVVKSERRRQRGRGKKRKERQRVKDCDRCQPPRR
NT seq 498 nt   +upstreamnt  +downstreamnt
atgaaaccctttgcctcgttcgtcatccagattgcagtgacgctccaacttcagttttca
cctgctcagagtactccctcacccagcgcaaacagcacaactggagtactaatgttccag
gatgtgtggggccgtagtttctgccggactatagagaagctggtggaggtggtccaagag
taccctggggaggtggagcacatctacagcccctcctgtgtgcccctggtgcgctgcgct
ggttgctgtggcgatgagaacctggagtgtcatcctactcagacctctaatgtcaccatg
cagctgttgaaaatcaagccagcggagcagggtcaagaatacgttgagatgacttttgtg
gagcaccagacatgtgaatgtagaatcaggaaggctgtggtgaaaagtgaaagaaggaga
cagagagggagaggaaagaaaagaaaggagagacagagagtgaaagattgtgacaggtgt
cagccacctcgcagataa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112261758
Entry
112261758         CDS       T05605                                 

Definition
(RefSeq) placenta growth factor-like
  KO
K16859  placenta growth factor
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112261758
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112261758
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:otw04052]
    112261758
Cytokines and growth factors [BR:otw04052]
 Growth factors
  Growth factors (RTK binding)
   112261758
SSDB
Motif
Pfam: PDGF Alpha_adaptinC2
Other DBs
NCBI-GeneID: 112261758
NCBI-ProteinID: XP_024293121
LinkDB
Position
11
AA seq 165 aa
MKPFASFVIQIAVTFQLQLSPAQITPSPSSNSTTGVLMFQEVWGRSFCRTIEKLVEVVQE
YPGEVEHIYSPSCVPLVRCAGCCGDENLECHPTQTSNVSMQLLKIKPGEQGQEYVEMSFV
EHQTCECRIRKAVVKSERRRQRGRGRKRKERQRVKDCDRCQPPRR
NT seq 498 nt   +upstreamnt  +downstreamnt
atgaaaccctttgcttcgttcgtcatccagattgcggtgacgttccaacttcagctttca
cctgctcagattacgccctcacccagctcaaacagcacaactggagtgttaatgttccag
gaggtgtggggtcgtagtttctgccggaccatagagaagctggtggaggtggtccaggag
taccccggggaggtggagcacatctatagtccctcctgtgtgcccctggtgcgctgcgct
ggttgctgtggcgatgagaatctggagtgccatcctactcagacctctaatgtctccatg
cagttgttgaaaatcaagccaggggaacagggtcaagaatacgttgagatgtcttttgtg
gagcaccagacatgtgaatgtagaatcaggaaggctgtggtgaaaagtgaaaggaggaga
caaagaggaagaggaagaaaaagaaaggagagacagagagtgaaagattgtgacaggtgt
cagcctcctcgcaggtaa

DBGET integrated database retrieval system