KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112214224
Entry
112214224         CDS       T05605                                 

Definition
(RefSeq) G1/S-specific cyclin-D2-like isoform X1
  KO
K10151  G1/S-specific cyclin-D2
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04110  Cell cycle
otw04115  p53 signaling pathway
otw04218  Cellular senescence
otw04310  Wnt signaling pathway
otw04340  Hedgehog signaling pathway
otw04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    112214224
   04340 Hedgehog signaling pathway
    112214224
   04068 FoxO signaling pathway
    112214224
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112214224
   04115 p53 signaling pathway
    112214224
   04218 Cellular senescence
    112214224
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112214224
SSDB
Motif
Pfam: Cyclin_N Cyclin_C K-cyclin_vir_C
Other DBs
NCBI-GeneID: 112214224
NCBI-ProteinID: XP_024228586
LinkDB
Position
15
AA seq 301 aa
MELLCFEDKVVLAQIDPNILYDDRVLQSLLTIEDRFLPQCSYFKCVQKDIQPHMRRMVAG
WMHEVCEEEKSEEDVFPLAINYLDRFLAVAPTRKCYLQLLGAVCMLLATKLKESRPLTAE
KLCMYTDNSITPRELLEWELVVLGKLKWNMAAVIPNDFVDHILHRLPLPKEKLSVIRKHT
QTFIALCATDFSFAMNPPSMIATGSVGAAVCGLQLDQSDQALSRDRLTDLLAKITNTEVD
CLKACQEQIERVLASSLQQEQQQQRQEALGRSGSKAMEQQDQSRTPTDVSSTPTDVRDVN
L
NT seq 906 nt   +upstreamnt  +downstreamnt
atggaacttctttgcttcgaggacaaagtcgtgcttgcccaaattgaccccaacattctc
tatgacgacagagtattgcaaagtctgctaaccatagaagacaggtttctaccgcaatgt
tcgtattttaaatgtgtccagaaggacattcagccacatatgaggcgaatggttgcagga
tggatgcacgaggtttgtgaagaggagaagagtgaggaagacgttttccccttggctatt
aattatttggacagatttttagcggtggcgcccactagaaagtgttatttgcaacttcta
ggagctgtatgcatgctccttgcaacaaagttaaaggagagtcgtccattaactgcagaa
aagctgtgcatgtacacagacaactccatcacaccaagggagctgctggagtgggagttg
gtggtcctagggaagttgaagtggaacatggcggcagtcatcccaaacgactttgtggat
cacatcctacacagactgcccctgcccaaagagaagctatctgtgatccgcaagcacaca
cagacattcatcgccttgtgtgccacagatttcagcttcgccatgaaccccccctccatg
atcgctacgggaagcgtgggggcggccgtctgcggcctgcagctggaccaatcagaccag
gccctgagtcgagaccgtctgactgacctgctggccaagatcaccaacacagaggtggac
tgtctgaaggcgtgtcaggagcagatagagagggtgttggccagtagcctgcagcaggag
caacagcagcagaggcaggaggccctaggcaggtctggcagcaaggccatggagcagcaa
gaccagtccagaaccccaacagacgtatccagcaccccaacagacgtacgcgacgtcaac
ctatga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112216983
Entry
112216983         CDS       T05605                                 

Definition
(RefSeq) G1/S-specific cyclin-D2-like
  KO
K10151  G1/S-specific cyclin-D2
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04110  Cell cycle
otw04115  p53 signaling pathway
otw04218  Cellular senescence
otw04310  Wnt signaling pathway
otw04340  Hedgehog signaling pathway
otw04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    112216983
   04340 Hedgehog signaling pathway
    112216983
   04068 FoxO signaling pathway
    112216983
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112216983
   04115 p53 signaling pathway
    112216983
   04218 Cellular senescence
    112216983
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112216983
SSDB
Motif
Pfam: Cyclin_N Cyclin_C K-cyclin_vir_C
Other DBs
NCBI-GeneID: 112216983
NCBI-ProteinID: XP_024232936
LinkDB
Position
17
AA seq 301 aa
MELLCFEDKVVLAQIDPNILYDDRVLQSLLTIEDRFLPQCSYFKCVQKDIQPHMRRMVAG
WMHEVCEEEKSEEDVFPLAINYLDRFLAVAPTRKCYLQLLGAVCMLLATKLKESRPLTAE
KLCMYTDNSITPRELLEWELVVLGKLKWNMAAVIPNDFVDHILHKLPLPKEKLSVVRKHT
QTFIALCATDFSFAMNPPSMIATGSVGAAVCGLQLDQSDQALSRDRLTDLLAKITNTEVD
CLKACQEQIERVLASSLQQEQQQQRQMAQGRPGSKAMEQQDQSRTPTDVSSTPTDVRDVN
L
NT seq 906 nt   +upstreamnt  +downstreamnt
atggaacttctttgcttcgaggacaaagtcgtgcttgcccaaattgaccccaacattctc
tatgacgacagagtattgcaaagtctgctaaccatagaagacaggtttctaccgcaatgt
tcgtattttaaatgtgtccagaaggacattcagccacatatgaggcgaatggttgcagga
tggatgcacgaggtttgtgaagaggagaagagtgaggaagacgttttccccttggctatt
aattatttggacagatttttagcggtggcgcccactagaaagtgttatttgcaacttcta
ggagctgtatgcatgctccttgcaacaaagttaaaggagagtcgtccattaactgcagaa
aagctgtgcatgtacacagacaactccatcacaccaagggagctgctggagtgggagttg
gtggtcctagggaagttgaagtggaacatggcggcagtcatcccaaacgactttgtggat
cacatcctgcacaaactgcccctgcccaaagagaagctatctgtggtccgcaagcacaca
cagacattcatcgccctgtgtgcaacagatttcagcttcgctatgaaccccccctccatg
atcgctacgggcagcgtgggggcggccgtctgcggcctgcagctggaccaatcagaccag
gccctgagtcgagaccgtctgactgacctgctggccaagatcaccaacacagaggtggac
tgtctgaaggcgtgtcaggaacagatagagagggtgttggccagtagcctgcagcaggag
caacagcagcagaggcagatggcccaaggcagaccgggcagcaaggccatggagcagcaa
gaccaatccagaaccccaacagacgtttccagcaccccaacagacgtacgcgacgtcaac
ctatga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112218786
Entry
112218786         CDS       T05605                                 

Definition
(RefSeq) G1/S-specific cyclin-D2-like isoform X1
  KO
K10151  G1/S-specific cyclin-D2
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04110  Cell cycle
otw04115  p53 signaling pathway
otw04218  Cellular senescence
otw04310  Wnt signaling pathway
otw04340  Hedgehog signaling pathway
otw04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    112218786
   04340 Hedgehog signaling pathway
    112218786
   04068 FoxO signaling pathway
    112218786
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112218786
   04115 p53 signaling pathway
    112218786
   04218 Cellular senescence
    112218786
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112218786
SSDB
Motif
Pfam: Cyclin_N Cyclin_C Herp-Cyclin
Other DBs
NCBI-GeneID: 112218786
NCBI-ProteinID: XP_024235687
LinkDB
Position
19
AA seq 299 aa
MELLCLEMDTILRARPDPNILCDDRVLQSLLTIEERFIPQCSYFKCVQKDIQPFMRRMVA
TWMLEVCEEQKCEEEVFPLAMNYLDRFLAVVPTRKCDLQLLGAVCMFLASKLKETRPLTA
DKLCIYTDNSIRPQELLEWELVVLGKLKWNLAAVTPNDFIEHIVRKLPLPEDKLALIRKH
VQTFIALCATDFNFAMYPPSMIATGSVGAAICGLQLDSGDQSQWGDSLTDLLAKITNTEV
DCLKECQEQIERVLVSSLREGRQQQQQQHQQQVQHGPSSKTMDELDQSSTPTDVRDINL
NT seq 900 nt   +upstreamnt  +downstreamnt
atggagctgctttgcctcgaaatggacaccattttaagagctcgtcctgatccgaatatt
ctgtgtgatgatagggtattacaaagcctgttgaccattgaagaacgatttattccccaa
tgttcttatttcaagtgcgttcagaaagatattcagccatttatgcggaggatggttgca
acttggatgctggaggtttgtgaagaacagaagtgtgaggaagaggtttttcccttggca
atgaactacttagacagatttttagctgtggttccaaccagaaagtgtgatctgcaactt
cttggagcagtttgcatgttccttgcatccaaattgaaagaaactcgtccattaactgca
gacaaactctgcatctacactgataactccatcagaccacaggagctgctggagtgggag
ctggtggtgttggggaagttgaagtggaacctggcggctgtcacaccaaacgacttcatc
gaacacatcgtgaggaagctgccgttgcccgaggacaagctggcgctgatacgtaaacat
gtgcagaccttcatcgccctctgcgccacggacttcaatttcgcgatgtaccccccatcg
atgatcgccacgggcagtgttggagcggctatctgtgggcttcagctggactcgggtgac
cagtctcagtggggggacagtcttacagacctgctggccaaaatcacaaacacagaagtg
gactgtctgaaggagtgtcaggagcagattgagagggtcttggtgagcagcctgcgcgag
gggcgacagcagcaacaacagcagcatcagcagcaggtccagcatggccccagcagtaag
accatggacgagctggatcagtcaagcaccccaacagacgttcgcgacatcaacttgtga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112218887
Entry
112218887         CDS       T05605                                 

Definition
(RefSeq) G1/S-specific cyclin-D1-like
  KO
K04503  G1/S-specific cyclin-D1
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04110  Cell cycle
otw04115  p53 signaling pathway
otw04218  Cellular senescence
otw04310  Wnt signaling pathway
otw04340  Hedgehog signaling pathway
otw04371  Apelin signaling pathway
otw04510  Focal adhesion
otw04530  Tight junction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    112218887
   04340 Hedgehog signaling pathway
    112218887
   04371 Apelin signaling pathway
    112218887
   04068 FoxO signaling pathway
    112218887
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112218887
   04115 p53 signaling pathway
    112218887
   04218 Cellular senescence
    112218887
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112218887
   04530 Tight junction
    112218887
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 112218887
NCBI-ProteinID: XP_024235883
LinkDB
Position
19
AA seq 291 aa
MERQLLCCEVETIRRAYQDSNLLNDRVLQTMLKAEDSYLPATNYFKCVQKEIVPCMRRIV
STWMLEVCEEQKCEEEVFPLAMNFLDRYLSVEPTKKTRLQLLGATCMFLASKMKETIPLT
AEKLCIYTDNSIRPIDLLQMELLVLNKLKWDLASVTAHDFIDHFLSKLPIHQDTEQILRK
HAQTFVALCATDVKFIANPPSMIAAGSVAAAVQGLHLKMDDAMSSQQLTYFLSQVIRSDP
DCLRACQEQIESLLETSLRQAQQHAVSTDTKSMDEEVDLSCTPTDVRDVNI
NT seq 876 nt   +upstreamnt  +downstreamnt
atggaacgtcagttgctgtgctgtgaagtggagaccatccggagagcttaccaagactcg
aacctgctcaacgatagagttttgcagacaatgctaaaagccgaagacagttatctccca
gcaacgaactacttcaaatgtgtacagaaagagattgtaccttgcatgaggagaattgtt
tctacatggatgctagaggtgtgtgaagaacagaaatgcgaagaggaggtttttcccctc
gctatgaattttttggacagatatttgtctgttgaaccgacaaagaagacccgactacaa
ttattgggagctacctgcatgtttctggcgtctaaaatgaaggagaccattcctctaacc
gcagagaagttgtgcatatacactgacaattccatccgaccaatcgatttgctgcaaatg
gaactactagtattgaacaaactgaaatgggatctagcctcagtgactgcgcacgatttc
atagaccatttcctctccaaactacccatccatcaggacaccgagcaaatcctgcgcaag
catgcccagacctttgtggccctctgtgctacagatgtcaaattcattgccaaccctccg
tcaatgattgcagcgggcagtgtggcggctgctgtgcaggggctgcatctgaagatggac
gatgcaatgtcatcccagcaactgacttacttcctgtcccaagtcatcagaagtgacccg
gactgtctacgggcgtgtcaggaacagatcgagtccttattggagaccagtctccgtcag
gcacagcaacatgctgtttccacagacaccaagagcatggatgaggaggtggacctctcg
tgcacgcctacggacgtgagagatgtgaacatctga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112249039
Entry
112249039         CDS       T05605                                 

Definition
(RefSeq) G1/S-specific cyclin-D1-like
  KO
K04503  G1/S-specific cyclin-D1
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04110  Cell cycle
otw04115  p53 signaling pathway
otw04218  Cellular senescence
otw04310  Wnt signaling pathway
otw04340  Hedgehog signaling pathway
otw04371  Apelin signaling pathway
otw04510  Focal adhesion
otw04530  Tight junction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    112249039
   04340 Hedgehog signaling pathway
    112249039
   04371 Apelin signaling pathway
    112249039
   04068 FoxO signaling pathway
    112249039
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112249039
   04115 p53 signaling pathway
    112249039
   04218 Cellular senescence
    112249039
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112249039
   04530 Tight junction
    112249039
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 112249039
NCBI-ProteinID: XP_024274408
LinkDB
Position
4
AA seq 292 aa
MEHQLLCCEVETIRRAYQDANLLNDRVLQTMLKAEENYLPSPNYFKCVQKEIIPKMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSVEPTNKTRLQLLGATCMFLASKMKETVPLT
AEKLCIYTDNYIRPSDLLQMELLTLNKLKWDLASVTPHDFIDHFLSKLPIQQHTKQILRK
HAQTFVALCATDVKFIANPPSMIAAGSVAAAVQGLYLKSKDGALSSQNLTNFLSQVIRSD
PDCLKSCQEQIESLLESSLRQAQQHSVSAETKRVEEDVDLSCTPTDVRDINI
NT seq 879 nt   +upstreamnt  +downstreamnt
atggagcaccagctgctgtgctgtgaagtggaaaccatcagaagagcttaccaagacgcc
aacttactaaatgaccgagttctacagacaatgctcaaagcagaggaaaattatctcccg
tctccgaattacttcaagtgtgtccagaaagaaataatacctaaaatgaggaaaattgtg
gctacatggatgttagaggtctgcgaggaacagaaatgcgaggaggaggtttttcccctg
gctatgaactacttggatagatttttgtctgtggagcccacaaataaaaccagattacaa
ctcctgggagctacttgtatgtttttggcctcaaagatgaaggaaacggtccctttaact
gcagagaagttgtgcatttacaccgacaactacatccggcccagcgatctattgcaaatg
gaactactgactctaaacaagttgaaatgggatctagcatcagtaacacctcacgatttc
atagaccatttcctctccaagctaccaatccagcagcacacgaagcagattctgcgcaag
catgcccagacattcgtggctctctgtgcaacagatgtcaaattcatcgccaaccctccc
tccatgatcgcagcgggcagtgtggcagcagcggtccaggggctgtacctaaagagcaaa
gatggtgcactgtcatcccagaacctaaccaactttctgtcccaagtcatcaggagtgac
ccggactgcctgaagtcgtgtcaggaacagattgagtctctgcttgagtctagtctgaga
caggcacagcaacatagtgtctccgcagaaacaaaaagggtagaggaggatgtggacctg
tcctgcacccctacagatgtgagggacattaacatttga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112252585
Entry
112252585         CDS       T05605                                 

Definition
(RefSeq) G1/S-specific cyclin-D2 isoform X1
  KO
K10151  G1/S-specific cyclin-D2
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04110  Cell cycle
otw04115  p53 signaling pathway
otw04218  Cellular senescence
otw04310  Wnt signaling pathway
otw04340  Hedgehog signaling pathway
otw04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    112252585
   04340 Hedgehog signaling pathway
    112252585
   04068 FoxO signaling pathway
    112252585
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112252585
   04115 p53 signaling pathway
    112252585
   04218 Cellular senescence
    112252585
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112252585
SSDB
Motif
Pfam: Cyclin_N Cyclin_C Herp-Cyclin K-cyclin_vir_C
Other DBs
NCBI-GeneID: 112252585
NCBI-ProteinID: XP_024279695
LinkDB
Position
6
AA seq 297 aa
MELLCLEVDTIVRASLDPNLLCDDRVLQSLLTIEERFLPQCSYFKCVQKDIQPFMRRMVA
TWMLEVCEEQKCEEEVFPLAMNYLDRFLAVVPTRKCNLQLLGAVCMFLASKLKETRPLTA
EKLCIYTDNSIRPQELLEWELVVLGKLKWNLAAVTPNDFIEHIVRKLPLPEEKLVLIRKH
VQTFIALCATDFNFAMYPPSMIATGSVGAAICGLQLDSGDQSQWGDSLTDLLAKITNTEV
DCLKECQEQIERVLVSSLREGRQQQQQQQQVQRGPSSKTMDELDQSSTPTDVRDINL
NT seq 894 nt   +upstreamnt  +downstreamnt
atggagctgctttgcctcgaagtggacaccatcgtcagagctagtcttgatccgaatctt
ctgtgtgatgacagggtattacaaagcctgttgaccattgaagaacgttttcttccacaa
tgttcttatttcaagtgcgttcagaaagatattcagccatttatgaggaggatggttgcg
acttggatgctggaggtttgtgaagaacagaagtgtgaggaagaggtttttcccttggca
atgaactacttggacagatttttagccgtggttccaaccagaaagtgtaatctgcaactt
cttggagcagtttgcatgttccttgcatccaaactgaaagaaactcgtccattaactgca
gagaaactctgcatctacacagataactccatcagaccacaggagttactggagtgggag
ctggtggtgctggggaagttgaagtggaacctggcggctgtcactccaaatgacttcata
gagcacattgtgaggaagctgccattgcccgaagagaagttagtgctgatacgcaaacac
gtgcagaccttcattgccctctgtgctacagacttcaacttcgcaatgtaccccccgtcc
atgatcgccacaggcagtgtgggagcggctatctgtggcctccagttggactcgggtgac
cagtcacagtggggggacagtctcacagacctgctggccaaaatcaccaacactgaagtg
gactgtctgaaggagtgtcaggagcagattgagagggtcttggtgagcagcctgcgagag
ggacggcagcagcaacagcagcagcagcaggtccagcgtggccccagcagtaagaccatg
gacgagctggatcagtccagcaccccaacggatgttcgcgacatcaacttgtga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112252678
Entry
112252678         CDS       T05605                                 

Definition
(RefSeq) G1/S-specific cyclin-D1-like isoform X1
  KO
K04503  G1/S-specific cyclin-D1
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04110  Cell cycle
otw04115  p53 signaling pathway
otw04218  Cellular senescence
otw04310  Wnt signaling pathway
otw04340  Hedgehog signaling pathway
otw04371  Apelin signaling pathway
otw04510  Focal adhesion
otw04530  Tight junction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    112252678
   04340 Hedgehog signaling pathway
    112252678
   04371 Apelin signaling pathway
    112252678
   04068 FoxO signaling pathway
    112252678
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112252678
   04115 p53 signaling pathway
    112252678
   04218 Cellular senescence
    112252678
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112252678
   04530 Tight junction
    112252678
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 112252678
NCBI-ProteinID: XP_024279896
LinkDB
Position
6
AA seq 292 aa
MEHLLLCCEVETIRRAYQDSNLLNDRVLQTMLKAEDNYLPATNYFKCVQKEIVPCMRRIV
ATWMLEVCEEQKCEEEVFPLAMNFLDRYLSVEPTKKTRLQLLGATCMFLASKMKETIPLT
AVKLCIYTDNSIRTGELLQMELLVLNKLKWDLASVTPHDFIDHFLSKLPIHQDTKQILCK
HAQTFVALCATDVKFIANPPSMIAAGSVAAAVQGLNLKSMDDALSSQQLTDFLSQVIRSD
PDCLRACQEQIESLLETSLRQAQQHTVSIDTKSMDEEVDLSCTPTDVRDVNI
NT seq 879 nt   +upstreamnt  +downstreamnt
atggaacacctgttgctgtgctgtgaagtggagaccatccggagagcttaccaagactcg
aacctgctcaacgacagagttctgcagaccatgctaaaagcggaagacaattatctcccc
gcaacgaactacttcaaatgtgtacagaaagagattgtaccctgcatgaggagaattgtt
gctacgtggatgctggaggtctgtgaggaacagaaatgcgaagaggaggtttttccccta
gctatgaattttttagacagatatttgtctgttgaacccacaaagaagactcgactacag
ttattgggcgctacatgcatgtttctggcgtctaaaatgaaggagaccattcctctaaca
gctgtgaagttgtgcatatacacagacaattccatccggacgggcgagttgctgcaaatg
gaactactggtattgaacaagctgaaatgggatctagcatcagttactccgcacgatttc
atagaccacttcctctccaagctacccatccatcaggacaccaagcaaatcctgtgcaag
catgcccagacctttgtggctctctgtgctacagatgtcaaattcattgccaaccctccg
tcaatgatcgcagcaggcagtgtggcggctgctgtccaggggctgaatctgaagagcatg
gacgatgcactgtcatcccagcaactcactgacttcctgtctcaagtcatcagaagtgac
ccggattgtctacgggcatgtcaagaacagatcgagtccttattggagaccagtctccgt
caggcacaacaacacactgtttccattgacaccaagagcatggatgaggaggttgacctg
tcgtgcacgccaacggacgttagagatgtgaacatctga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112259254
Entry
112259254         CDS       T05605                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: G1/S-specific cyclin-D1-like
  KO
K10151  G1/S-specific cyclin-D2
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04110  Cell cycle
otw04115  p53 signaling pathway
otw04218  Cellular senescence
otw04310  Wnt signaling pathway
otw04340  Hedgehog signaling pathway
otw04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    112259254
   04340 Hedgehog signaling pathway
    112259254
   04068 FoxO signaling pathway
    112259254
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112259254
   04115 p53 signaling pathway
    112259254
   04218 Cellular senescence
    112259254
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112259254
SSDB
Motif
Pfam: Cyclin_N Cyclin_C K-cyclin_vir_C
Other DBs
NCBI-GeneID: 112259254
NCBI-ProteinID: XP_024289755
LinkDB
Position
9
AA seq 300 aa
MSVSVSLWCEEEQGQARGXSQLRAPWDPSVSGQRIIQRLLQVEERYLPSALXVALIQREP
ERREELAKWAMEVCXERGCEETVFPLSVSMLDXFLSASLSLPVSPYCLAAACILIASKLT
ECDTISADSLCAAAEYSFLPSNIREMERVILATLRWDVAVVTAQDFIPHFLPPVGERKDG
KTDTEEFFSTLRRHSDTLVAMCVXDYRFLGAPPSLVAAAXLNSALRGLGXKGPGHLGHMS
ATLAELCQTDLMVLQCYSELIEAALKQRLRGGLQDSAMEKDGEIEDERAGTPTDMREIDF
NT seq 903 nt   +upstreamnt  +downstreamnt
atgtctgtgtctgtgtctctgtggtgtgaggaggaacagggccaggccaggggccamtca
cagctccgggccccctgggaccccagtgtgtctgggcagcggatcatccagaggctgcta
caggtggaggagagatatctgccctccgccctctargtcgccctcattcagagagagccg
gagcgsagagaggagctcgccaagtgggctatggaagtatgctstgagcgtggctgtgar
gaaacagtgtttcccctgtctgtctctatgttggacrgcttcctgtctgcctccctgtct
ctccctgtctcaccctactgcctggctgcagcctgcatcctcatcgcctccaaactaaca
gagtgtgacacaatctctgctgactctctttgtgctgcagctgagtacagcttcctgccc
tccaacatacgggagatggaacgtgtcatccttgcgactcttcgatgggacgttgctgtg
gtaaccgctcaggacttcattccacatttccttccccctgtaggggagaggaaggatgga
aagacagacacagaggagttcttctccacactgcgtcggcatagtgacaccctggttgcc
atgtgtgtctgrgactaccgtttcctgggagcccctccatccctggttgctgcggcagrg
ctgaactctgccctrcggggtttgggcaasaagggtccaggtcatctgggtcatatgagt
gctacactggcagaactgtgtcagactgacctgatggtgttgcagtgttacagtgaattg
atagaagctgccctcaaacaacggctcagaggtggactccaagacagtgccatggagaag
gatggagaaatagaggatgaaagagcaggcactcctactgatatgagagagattgatttc
taa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112263573
Entry
112263573         CDS       T05605                                 

Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04110  Cell cycle
otw04115  p53 signaling pathway
otw04218  Cellular senescence
otw04310  Wnt signaling pathway
otw04340  Hedgehog signaling pathway
otw04371  Apelin signaling pathway
otw04510  Focal adhesion
otw04530  Tight junction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    112263573
   04340 Hedgehog signaling pathway
    112263573
   04371 Apelin signaling pathway
    112263573
   04068 FoxO signaling pathway
    112263573
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112263573
   04115 p53 signaling pathway
    112263573
   04218 Cellular senescence
    112263573
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112263573
   04530 Tight junction
    112263573
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 112263573
NCBI-ProteinID: XP_024295754
LinkDB
Position
12
AA seq 292 aa
MEHQLLCCEVETIRRAYQDANLLNDRVLQTMLKAEENYLPSPNYFKCVQKEIIPKMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSVELTNKTRLQLLGATCMFLASKMKETVPLT
AEKLCIYTDNSIRPSDLLQMELLTLNKLKWDLASVTPHDFIDHFLSKLPVHQNTKQILRK
HAQTFVALCATDVKFIANPPSMIAAGSVAAAVQGLYLKSKDGALSSQNLTNFLSQVIRSD
PDCLRSCQEQIESLLESSLRQAQQHNVSTETKMVDEDVDLSCTPTDVRDINI
NT seq 879 nt   +upstreamnt  +downstreamnt
atggaacaccagctgctgtgctgtgaagtggaaaccatcagaagagcttaccaagacgcc
aacttactaaatgaccgagttctacagacaatgctcaaagcagaggaaaattaccttccg
tctccgaattatttcaagtgtgtccagaaagaaataatacctaaaatgaggaaaattgtg
gctacatggatgttagaggtctgcgaggaacagaaatgcgaggaggaggtttttcccctg
gctatgaactacttggatagatttttgtctgtggagctcacaaataaaaccagattacaa
ctcctgggagctacttgtatgtttttggcctcaaagatgaaggaaacggtccctttaact
gcagagaagttgtgcatttacaccgacaactccatccggcccagcgatctattgcaaatg
gaactactgactctaaacaagttgaaatgggatctagcatcagtaacaccgcacgatttc
atagaccatttcctctccaagctaccagtccatcagaacacgaagcagattctgcgcaag
catgcccagacattcgtggctctctgtgcaacagatgtcaaattcatcgccaaccctccc
tccatgatcgcagcgggcagtgtggcagcagcggtccaggggctgtacctaaagagcaaa
gacggtgcactgtcatcccagaacctaaccaactttctgtcccaagtcatcaggagtgac
ccggactgcctgaggtcgtgccaggagcagattgagtctctgcttgagtctagtctgaga
caggcacagcaacataatgtctccacagaaacaaaaatggtagatgaggatgtggacctg
tcctgcacccctacagatgtgagggacattaacatttga

DBGET integrated database retrieval system