KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112214239
Entry
112214239         CDS       T05605                                 

Definition
(RefSeq) mitogen-activated protein kinase 12-like isoform X1
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04068  FoxO signaling pathway
otw04114  Oocyte meiosis
otw04218  Cellular senescence
otw04261  Adrenergic signaling in cardiomyocytes
otw04370  VEGF signaling pathway
otw04620  Toll-like receptor signaling pathway
otw04621  NOD-like receptor signaling pathway
otw04622  RIG-I-like receptor signaling pathway
otw04625  C-type lectin receptor signaling pathway
otw04912  GnRH signaling pathway
otw04914  Progesterone-mediated oocyte maturation
otw05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112214239
   04370 VEGF signaling pathway
    112214239
   04068 FoxO signaling pathway
    112214239
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    112214239
   04218 Cellular senescence
    112214239
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    112214239
   04621 NOD-like receptor signaling pathway
    112214239
   04622 RIG-I-like receptor signaling pathway
    112214239
   04625 C-type lectin receptor signaling pathway
    112214239
  09152 Endocrine system
   04912 GnRH signaling pathway
    112214239
   04914 Progesterone-mediated oocyte maturation
    112214239
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112214239
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112214239
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112214239
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     112214239
Protein kinases [BR:otw01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   112214239
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH Kinase-like
Other DBs
NCBI-GeneID: 112214239
NCBI-ProteinID: XP_024228613
LinkDB
Position
15
AA seq 364 aa
MSVRTRTGFYRQEVNKTAWEVPERYRELKQVGTGAYGTVCSAQDRRTGVRVAIKKLHRPF
QSKLFAKRAYRELRLLKHMKHENVIGLLDVFTSEISLDRFHDFYLVMPFMGTDLGKLMKM
ERLSQDRVQFLVYQILKGLKYIHSAGIIHRDLKPGNLSVNEDCELKILDFGLARQTDTEM
TGYVVTRWYRAPEVILNWMHYTQTVDIWSVGCIMAEMLLGKPLFKGNDHLDQLKEIMKIT
GTPTADFVTKLQSQDAKNYIRSLPKVPKKDLHFIFSKASSDAVCVLERMLLLDPERRVSA
SEALAMPFFSEFREPEEETEAQSYDHSMDNTDLPLEQWKRHTFTEILSFRPASTETKDPK
ETSL
NT seq 1095 nt   +upstreamnt  +downstreamnt
atgtcggttcgcacgcggacaggattttaccgtcaggaggtaaacaaaacggcatgggag
gttccagagcgataccgcgagctaaagcaggtggggactggcgcctatgggacagtatgc
tccgcccaggaccgcaggactggggtgagggtggccatcaagaagctccacagacccttc
cagtcaaagctcttcgccaagagggcctacagagagctccggctcctcaagcacatgaag
cacgaaaatgtgattggactgctggatgtgttcacttctgagatctcattggacaggttt
catgacttttacctggtaatgccattcatgggtactgatctggggaaactgatgaagatg
gagagattgtcacaggacagggtgcaattccttgtctatcaaatcctgaaaggactcaag
tatatccactctgcagggatcatccacagggatctcaaacctggaaatttgtctgtcaac
gaagactgtgagctgaagatccttgacttcgggctggctcggcagacggacacagagatg
actgggtacgtcgtcactcgctggtacagagcccccgaggtaatcctcaattggatgcac
tatacccagactgtggatatctggtcggtgggctgcatcatggcggagatgctgctgggg
aagccgctgttcaaaggaaatgaccacctggaccaactgaaagagatcatgaagattact
ggtacacccactgcagactttgttacgaagctacaaagccaagatgccaaaaactacata
cggagccttcccaaagtaccaaagaaagatttgcactttattttttccaaagctagctca
gatgcggtgtgtgtgctggagcgcatgctgttgctggaccctgagaggcgggtgagtgcg
tcggaggcactggccatgccctttttcagcgagttcagagaaccagaggaggagactgag
gcccagtcctacgatcactccatggacaacacagacctgcccctggaacagtggaaacgt
cacacattcacagagatcctgtccttcaggcctgcatcaacagagaccaaggaccccaaa
gagacatcactctga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112214240
Entry
112214240         CDS       T05605                                 

Definition
(RefSeq) mitogen-activated protein kinase 11-like isoform X1
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04068  FoxO signaling pathway
otw04114  Oocyte meiosis
otw04218  Cellular senescence
otw04261  Adrenergic signaling in cardiomyocytes
otw04370  VEGF signaling pathway
otw04620  Toll-like receptor signaling pathway
otw04621  NOD-like receptor signaling pathway
otw04622  RIG-I-like receptor signaling pathway
otw04625  C-type lectin receptor signaling pathway
otw04912  GnRH signaling pathway
otw04914  Progesterone-mediated oocyte maturation
otw05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112214240
   04370 VEGF signaling pathway
    112214240
   04068 FoxO signaling pathway
    112214240
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    112214240
   04218 Cellular senescence
    112214240
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    112214240
   04621 NOD-like receptor signaling pathway
    112214240
   04622 RIG-I-like receptor signaling pathway
    112214240
   04625 C-type lectin receptor signaling pathway
    112214240
  09152 Endocrine system
   04912 GnRH signaling pathway
    112214240
   04914 Progesterone-mediated oocyte maturation
    112214240
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112214240
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112214240
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112214240
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     112214240
Protein kinases [BR:otw01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   112214240
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo RIO1 APH Kinase-like
Other DBs
NCBI-GeneID: 112214240
NCBI-ProteinID: XP_024228615
LinkDB
Position
15
AA seq 348 aa
MFRSNAFHFCKLLSLSLSLSFAPHSSAYDVRLRQKVAVKKLSRPFQSLIHSRRSYRELRL
LKHMKHENVIGLLDVFSPAASLEDFHEVYLVTNLMGADLNNIVKFQRLSDEHVQFLIYQL
LRGLKYIHSAGLIHRDLKPSNVAVNEDCELRILDFGLARQTDDEMTGYVATRWYRAPEIM
LNWMHYNQTVDIWSVGCIMGELLKGKVLFPGNDYIDQLKRIMEVVGTPTPDLLQKISSEH
AQKYIQSLPFMPQQDLEKIFRGANPMAVDLLKRMLVLDCDGRVSASEALSHPYFSQYHDP
DDEPDALPYDQTLESKDRTLEEWKELVFEEMNGIKAPVSETSSLQVEQ
NT seq 1047 nt   +upstreamnt  +downstreamnt
atgtttagaagcaatgcatttcatttttgtaagctgctctctctctctctctctctctcc
tttgctccccacagctcagcatatgacgtgcggctacgacagaaggtggcggtgaagaag
ctgtctcggcctttccagtcccttatccacagtaggcgctcgtaccgcgagctccggcta
ctcaagcacatgaaacatgagaatgtaataggactactggatgtattctcccctgctgca
tcgctagaggacttccatgaagtctacctggtaaccaacttgatgggggcagacctgaac
aacatagtcaaattccagcgtctctctgatgagcatgtgcagtttcttatttaccagctg
ctcaggggcctcaagtacatccattcagcaggactgatccacagagacctgaaaccaagt
aacgtggcagtgaacgaggattgcgagctgaggatccttgactttggattggccagacag
acggatgatgagatgacggggtacgtggcgactcgctggtatcgagcgccagagatcatg
cttaactggatgcactacaatcagacagtggatatctggtcagtgggatgcatcatggga
gagctgctgaaggggaaggtcctgtttccaggcaacgactatatcgaccagctaaagagg
attatggaggtggtgggcaccccgacccctgaccttctacagaagatctcctctgaacat
gctcagaaatatatccagtctctacccttcatgccccagcaggacttagagaagatattc
agaggagccaacccaatggctgtggatctactgaagcgcatgctggttctggactgtgac
gggcgtgtctcggccagtgaggctctctcccacccttatttctcccagtaccacgacccg
gatgacgaaccagatgccctgccctacgaccagacgctggagagcaaggaccgcacgcta
gaggagtggaaagagctggtgttcgaggagatgaatggaatcaaagcgcctgtcagcgaa
acgagcagtctacaggtggaacagtga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112215918
Entry
112215918         CDS       T05605                                 

Definition
(RefSeq) mitogen-activated protein kinase 13-like isoform X1
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04068  FoxO signaling pathway
otw04114  Oocyte meiosis
otw04218  Cellular senescence
otw04261  Adrenergic signaling in cardiomyocytes
otw04370  VEGF signaling pathway
otw04620  Toll-like receptor signaling pathway
otw04621  NOD-like receptor signaling pathway
otw04622  RIG-I-like receptor signaling pathway
otw04625  C-type lectin receptor signaling pathway
otw04912  GnRH signaling pathway
otw04914  Progesterone-mediated oocyte maturation
otw05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112215918
   04370 VEGF signaling pathway
    112215918
   04068 FoxO signaling pathway
    112215918
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    112215918
   04218 Cellular senescence
    112215918
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    112215918
   04621 NOD-like receptor signaling pathway
    112215918
   04622 RIG-I-like receptor signaling pathway
    112215918
   04625 C-type lectin receptor signaling pathway
    112215918
  09152 Endocrine system
   04912 GnRH signaling pathway
    112215918
   04914 Progesterone-mediated oocyte maturation
    112215918
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112215918
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112215918
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112215918
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     112215918
Protein kinases [BR:otw01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   112215918
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo
Other DBs
NCBI-GeneID: 112215918
NCBI-ProteinID: XP_024231185
LinkDB
Position
16
AA seq 363 aa
MESQTQYTREEINSTIWEVPEKYTRLKQIGTGAYGSVCSVINVKTTEKVAIKKLHRPFQS
EIFAKRAYRELRLLKHMKHENVIGLLDVFTPAAGLDEFTDFYLVMPYMFTDLSKVKGLLT
EDRVQFLVYQMLCGLRYIHKAGIIHRDLKPGNLAVNQDCELKILDFGLARHAEAEMTGYV
VTRWYRAPEVILNWMHYTQTVDIWSVGCIMGEMINGKTLFKGKDYMDQLTQIMKVTGVPG
PDFIQKLDSQEAKSYVRSLPHFPRKDFSKLFPRASAQAIDLLEKMLVLDGETRLTAESAL
THPYFDGLRDPEDCPEPQPYDDSHDNATLPLEDWRRLSFKEVKSFVPFPRRDSKRRNTLT
ISP
NT seq 1092 nt   +upstreamnt  +downstreamnt
atggagtcgcagacacagtacacccgagaggagatcaacagcacgatatgggaagtgccg
gagaagtacacgcgattgaagcaaattgggacaggggcgtacggttccgtatgctcggta
ataaatgtgaaaaccactgagaaagtggccattaagaagcttcaccggcccttccagtct
gagatttttgcaaagagggcttatcgggagcttcgactgctcaagcacatgaaacatgaa
aatgtgatagggcttctggatgtgtttactcctgctgctgggcttgatgaattcacagat
ttctacctggtgatgccttacatgttcaccgacctctccaaagtcaaaggacttctcact
gaagacagagtgcagttccttgtctatcagatgctgtgtggactaaggtacattcacaaa
gctggcatcatccacagggacctgaagcctggtaacttggctgtcaatcaagactgtgaa
ttaaagatcctggactttggtcttgctcgccatgccgaggcggagatgacgggctatgtt
gtgacccgctggtaccgggcaccagaggtcattctaaactggatgcactacacccagact
gtggacatctggtctgtgggctgtatcatgggagagatgatcaatgggaagacgcttttc
aaagggaaagactacatggaccagctgactcagatcatgaaagtaactggagtacccggt
cctgacttcattcagaaactggacagtcaggaggcaaaaagctatgtgcggtccctccct
cactttcccagaaaagacttctctaagttgttccccagagcaagtgcacaggcgattgac
cttcttgagaagatgctggttttggatggtgagactcggcttactgctgagagtgctctg
acacacccgtattttgatggcttgagagatccagaggactgccctgagccacagccatat
gatgacagtcacgacaatgccacgctgcctctggaggactggaggcggttatccttcaaa
gaggtgaagagctttgtgccattcccacgacgggactccaagaggcgaaacacactgaca
atttctccgtga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112216384
Entry
112216384         CDS       T05605                                 

Definition
(RefSeq) mitogen-activated protein kinase 14A-like isoform X1
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04068  FoxO signaling pathway
otw04114  Oocyte meiosis
otw04218  Cellular senescence
otw04261  Adrenergic signaling in cardiomyocytes
otw04370  VEGF signaling pathway
otw04620  Toll-like receptor signaling pathway
otw04621  NOD-like receptor signaling pathway
otw04622  RIG-I-like receptor signaling pathway
otw04625  C-type lectin receptor signaling pathway
otw04912  GnRH signaling pathway
otw04914  Progesterone-mediated oocyte maturation
otw05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112216384
   04370 VEGF signaling pathway
    112216384
   04068 FoxO signaling pathway
    112216384
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    112216384
   04218 Cellular senescence
    112216384
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    112216384
   04621 NOD-like receptor signaling pathway
    112216384
   04622 RIG-I-like receptor signaling pathway
    112216384
   04625 C-type lectin receptor signaling pathway
    112216384
  09152 Endocrine system
   04912 GnRH signaling pathway
    112216384
   04914 Progesterone-mediated oocyte maturation
    112216384
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112216384
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112216384
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112216384
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     112216384
Protein kinases [BR:otw01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   112216384
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH Kinase-like
Other DBs
NCBI-GeneID: 112216384
NCBI-ProteinID: XP_024232120
LinkDB
Position
16
AA seq 361 aa
MSQKERPTFYRQEVTKTIWEVPERYQTLSPVGSGAYGSVCSSYDQKTGMKIAVKKLSRPF
QSFIHAKRTYRELRLLKHMKHENVIGLLDVFTPATSLEEFNDVYLVTHLMGADLNNIIKC
QKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEM
TGYVATRWYRAPEIMLNWMHYNMTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLIMMLV
GTPEPELLMKISSSSARNYIKSLPQMPKRNFSDVFIGANPQAVDLLEKMLVLDTDKRITA
AEALAHPYFSQYHDPDDEPEADPYDQSFESRDLDIEEWKRLTFEAVCDFEPPVFDGNDME
S
NT seq 1086 nt   +upstreamnt  +downstreamnt
atgtcgcagaaagaaagacctacgttttatcggcaggaggtgacaaagacgatttgggag
gtaccagaacgctaccagaccctgtctccagtcggttccggggcctacggatcagtttgc
tcgtcgtatgatcagaagacgggtatgaagatcgctgtgaagaagctctcccggcctttc
cagtcctttattcacgccaagagaacctacagagagctacggctgctcaagcacatgaag
catgagaatgtgatcggccttctagatgttttcacacctgctactagtctggaggagttc
aatgatgtgtacctggtgacccacctgatgggggcagacctcaacaatataatcaagtgt
cagaagctgacagacgaccatgtgcagttcctcatataccagatcctccgggggttaaag
tatatccactcagcagatatcattcacagagacctgaaacccagcaacctggctgtgaat
gaggactgtgagctgaagattcttgactttgggctggcgcggcacacagacgatgagatg
actggttacgttgccactcgctggtacagagccccagagataatgctaaactggatgcat
tacaacatgacagtggacatttggtctgtgggatgtatcatggctgaactcctcactggc
agaactctgtttcccggtactgaccacattgatcagttgaagctaataatgatgctcgtt
gggacgccagagcctgagctcttgatgaaaatctcctcttcgtctgcaaggaactacatc
aaatccttgcctcagatgcccaagaggaatttttctgacgtgttcattggagccaacccc
caagctgtggacctgctggagaagatgttggttctggacacagataagaggatcacggct
gccgaggctctggcccacccctacttctcccagtaccacgacccagacgacgagcctgag
gctgacccctacgaccagagctttgagagccgcgatctggacatcgaagaatggaaacgg
ctgacctttgaggcggtatgtgattttgagccacccgtcttcgatggaaacgacatggaa
tcgtga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112216970
Entry
112216970         CDS       T05605                                 

Definition
(RefSeq) mitogen-activated protein kinase 12-like isoform X1
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04068  FoxO signaling pathway
otw04114  Oocyte meiosis
otw04218  Cellular senescence
otw04261  Adrenergic signaling in cardiomyocytes
otw04370  VEGF signaling pathway
otw04620  Toll-like receptor signaling pathway
otw04621  NOD-like receptor signaling pathway
otw04622  RIG-I-like receptor signaling pathway
otw04625  C-type lectin receptor signaling pathway
otw04912  GnRH signaling pathway
otw04914  Progesterone-mediated oocyte maturation
otw05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112216970
   04370 VEGF signaling pathway
    112216970
   04068 FoxO signaling pathway
    112216970
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    112216970
   04218 Cellular senescence
    112216970
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    112216970
   04621 NOD-like receptor signaling pathway
    112216970
   04622 RIG-I-like receptor signaling pathway
    112216970
   04625 C-type lectin receptor signaling pathway
    112216970
  09152 Endocrine system
   04912 GnRH signaling pathway
    112216970
   04914 Progesterone-mediated oocyte maturation
    112216970
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112216970
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112216970
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112216970
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     112216970
Protein kinases [BR:otw01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   112216970
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH Kinase-like FTA2
Other DBs
NCBI-GeneID: 112216970
NCBI-ProteinID: XP_024232912
LinkDB
Position
17
AA seq 364 aa
MSVRTRTGFYRQEVNKTAWEVPERYRELKQVGTGAYGTVCSAQDHRTGVRVAIKKLHRPF
QSKLFAKRAYRELRLLKHMKHENVIGLLDVFTSEISLDRFHDFYLVMPLMGTDLGKLMKM
ERLSQERVQFLVYQMLKGLKYIHSAGIIHRDLKPGNLSVNEDCELKILDFGLARQTDTEM
TGYVVTRWYRAPEVILNWMHYTQTVDIWSVGCIMAEMLLGKPLFKGNDHLDQLKEIMKIT
GTPTADFVTKLQSQDAKNYIRSLPKVLKKDLHFLFSKASSDAVCVLERMLLLDPERRVSA
SEALAMPFFSEFREPEEETEAQPYDHSMDNTDLLLEQWKRHTFTEILSFRPAATETKDPK
ETSL
NT seq 1095 nt   +upstreamnt  +downstreamnt
atgtcggtccgcacgcggacaggattttaccgtcaggaggtaaacaaaacggcatgggag
gttccagagcgataccgtgagctaaagcaggtggggactggcgcgtatgggacagtatgt
tccgcccaggaccacaggactggggtgagggtggccatcaagaagctccacagacccttc
cagtcaaagctcttcgccaagagggcctacagagagctccggctcctcaagcacatgaag
cacgaaaatgtgattggactgctggatgtgttcacttctgagatctcattggacaggttt
catgacttttacctggtaatgccactcatgggtactgatctggggaaactgatgaagatg
gagagattgtcacaggagagggtgcaattccttgtctatcaaatgctgaaaggactcaag
tatatccactctgcagggataatccacagggatctcaaacctggaaatttatctgtcaat
gaagactgtgagctgaagatccttgacttcgggctggctcggcagacagacacagagatg
actgggtacgtcgtcactcgctggtacagagcccccgaggtaatcctcaattggatgcac
tatacccagactgtggatatctggtcggtgggctgcatcatggcagagatgctgctgggg
aagccactgttcaaaggaaatgaccacctggaccaactgaaagagatcatgaagattact
ggtacacccactgcagactttgttacgaagctacaaagccaagatgccaaaaactacata
cggagccttcccaaagtactaaagaaagatttgcactttcttttttccaaagctagctca
gacgcggtgtgtgtgctggagcgcatgctgttgctggaccctgagaggcgggtgagtgcg
tcggaggcgctggccatgccctttttcagcgagttcagagaaccagaggaggagacggag
gcccagccctacgatcactccatggacaacacagacctgctcctggagcagtggaaacgt
cacacattcacagagattctgtccttcaggcctgcagcaacagagaccaaggaccccaaa
gagacatcactctga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112216971
Entry
112216971         CDS       T05605                                 

Definition
(RefSeq) mitogen-activated protein kinase 11-like
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04068  FoxO signaling pathway
otw04114  Oocyte meiosis
otw04218  Cellular senescence
otw04261  Adrenergic signaling in cardiomyocytes
otw04370  VEGF signaling pathway
otw04620  Toll-like receptor signaling pathway
otw04621  NOD-like receptor signaling pathway
otw04622  RIG-I-like receptor signaling pathway
otw04625  C-type lectin receptor signaling pathway
otw04912  GnRH signaling pathway
otw04914  Progesterone-mediated oocyte maturation
otw05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112216971
   04370 VEGF signaling pathway
    112216971
   04068 FoxO signaling pathway
    112216971
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    112216971
   04218 Cellular senescence
    112216971
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    112216971
   04621 NOD-like receptor signaling pathway
    112216971
   04622 RIG-I-like receptor signaling pathway
    112216971
   04625 C-type lectin receptor signaling pathway
    112216971
  09152 Endocrine system
   04912 GnRH signaling pathway
    112216971
   04914 Progesterone-mediated oocyte maturation
    112216971
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112216971
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112216971
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112216971
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     112216971
Protein kinases [BR:otw01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   112216971
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo RIO1 APH Kinase-like
Other DBs
NCBI-GeneID: 112216971
NCBI-ProteinID: XP_024232914
LinkDB
Position
17
AA seq 361 aa
MSARPGYYRQELNKTVWEVPERYQNLTPVGSGAYGSVCSAYDVRLRQKVAVKKLSRPFQS
LIHSRRSYRELRLLKHMKHENVIGLLDVFSPAASLEDFHEVYLVTNLMGADLNNIVKFQR
LSDEHVQFLIYQLLRGLKYIHSAGLIHRDLKPSNVAVNEDCELRILDFGLARQTDDEMTG
YVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMGELLKGKVLFPGNDYIDQLKRIMEVVGT
PTPDLLQKISSEHAQKYIQSLPFMPQQDLEKIFRGANPMAVNLLKRMLVLDCDGRISASE
ALSHPYFSQYHDPDDEPEALPYDQTLESKDRTLEEWKELVFGEMKGIKAPVSETSSLQVE
Q
NT seq 1086 nt   +upstreamnt  +downstreamnt
atgtcggccagaccaggctactatcggcaggagctgaacaagactgtatgggaggttccc
gagcggtaccagaacctgactcccgtaggctcgggggcctacggttcggtatgctcagca
tatgacgtgcggctacgacagaaggtggcggtgaaaaagctgtctcggcctttccagtcc
cttatccacagtaggcgctcgtaccgtgagctccggctactcaagcacatgaaacatgag
aacgtaataggactactggatgtattctcccctgctgcatcgctagaggacttccatgaa
gtctacctggtaaccaacttgatgggggcagacctgaacaacatagtcaaattccagcgt
ctctctgatgagcatgtgcagtttcttatttaccagctgctcagaggcctcaagtacatc
cattcagcaggactgatccacagagacctaaaaccaagtaacgtggcagtgaacgaggac
tgcgagctgaggatccttgactttggattggccagacagacggatgatgagatgacgggg
tacgtggcgactcgctggtatcgagcgccagaaatcatgcttaattggatgcactacaat
cagacagtggatatctggtcagtgggatgcatcatgggagagctgctgaaggggaaggtc
ctgtttccaggcaacgactatatcgaccagctgaagaggattatggaggtggtgggcacc
ccgacccctgaccttctacagaagatctcttctgaacatgctcagaaatatatccagtct
ctacccttcatgccccagcaggacttagagaagatattcagaggagccaacccaatggct
gtgaatctactgaagcgcatgctggttctggactgtgatgggcgtatctctgccagtgag
gctctctcccacccttatttttcccagtaccacgacccggacgacgaaccagaggccctg
ccctacgaccagacgctggagagcaaggaccgcacactagaggagtggaaagagctggtg
ttcggggagatgaaaggaatcaaagcgcctgtcagcgagacgagtagtctacaggtggaa
cagtga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112218743
Entry
112218743         CDS       T05605                                 

Definition
(RefSeq) mitogen-activated protein kinase 12-like
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04068  FoxO signaling pathway
otw04114  Oocyte meiosis
otw04218  Cellular senescence
otw04261  Adrenergic signaling in cardiomyocytes
otw04370  VEGF signaling pathway
otw04620  Toll-like receptor signaling pathway
otw04621  NOD-like receptor signaling pathway
otw04622  RIG-I-like receptor signaling pathway
otw04625  C-type lectin receptor signaling pathway
otw04912  GnRH signaling pathway
otw04914  Progesterone-mediated oocyte maturation
otw05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112218743
   04370 VEGF signaling pathway
    112218743
   04068 FoxO signaling pathway
    112218743
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    112218743
   04218 Cellular senescence
    112218743
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    112218743
   04621 NOD-like receptor signaling pathway
    112218743
   04622 RIG-I-like receptor signaling pathway
    112218743
   04625 C-type lectin receptor signaling pathway
    112218743
  09152 Endocrine system
   04912 GnRH signaling pathway
    112218743
   04914 Progesterone-mediated oocyte maturation
    112218743
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112218743
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112218743
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112218743
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     112218743
Protein kinases [BR:otw01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   112218743
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr RIO1 Kdo Kinase-like APH FTA2
Other DBs
NCBI-GeneID: 112218743
NCBI-ProteinID: XP_024235586
LinkDB
Position
19
AA seq 359 aa
MSSRTRPGYCRQDVNKTTWEVPEQYRELKQVGMGAYGTVCSAVDFRTGTKVAIKKLHRPF
QSELFAKRAYRELRLLKHMKHENVIGLVYVFTADLSLDRFHDFYLVMPFMGTDLGKLMKL
QNLSEDKVQFLVYQMLKGLKYIHSAGIIHRDLKPGNLAVNQECELKILDFGLARQADSEM
TGYVVTRWYRAPEVILSWMHYTQTVDIWSVGCIMVECCRENPVQSNDRLDQLTEIMKITG
TPTQDFITKLQSQDAKNLSKAFPKCKRKTFRLFSKVNPQAVTVIECMLLLDPESRVMAAE
ALTLPYFSEFREPEEETEAQPYDHSVDNSDLSLEQWKRHTFTEILSFQPQVVESRETAL
NT seq 1080 nt   +upstreamnt  +downstreamnt
atgtcgagccggaccagacctggctactgtcgccaggacgtgaacaaaaccacctgggag
gtaccggagcagtaccgggaactgaaacaggtggggatgggggcttacggtacagtctgc
tctgcagtggacttcaggacagggaccaaggtggccattaagaagctccacaggcccttc
cagtctgagctctttgctaagagggcctatcgggagctgaggctgctcaaacacatgaaa
catgaaaatgttattggccttgtttatgtattcactgcagacctctccttggacagattc
catgacttctatctggtgatgcccttcatgggaacagatctggggaagttgatgaagtta
cagaatctctcggaggacaaagtacagttcctggtgtatcagatgctgaagggactcaag
tatatccattctgctggcatcattcatagggacctcaaacctgggaatctggctgttaac
caggaatgtgagctcaagatcctggactttggattggcgcggcaggctgacagtgagatg
actggctacgtagtgactcgctggtacagagccccagaggtcatcctcagctggatgcac
tacacccagactgtggacatctggtcagtgggctgcatcatggtagagtgctgtcgggaa
aaccccgttcaaagcaatgaccgtctggatcagctgactgagatcatgaaaatcactggg
acgcccactcaggacttcatcaccaaactgcagtctcaggatgcaaagaacttgtcaaaa
gccttcccaaagtgcaaaagaaagaccttcagactcttttccaaagtcaacccacaggcg
gtgacagttatagagtgcatgctgctgctcgacccagagagtagggtgatggcggcagag
gccctcaccctgccatacttctcagagtttagagagccagaggaggagactgaggcccag
ccttacgaccactcggtagacaactctgacttgtccctggaacagtggaaacgtcacacg
ttcacagagatcttgtctttccagccccaagtggttgagtccagggaaaccgcactgtaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112221631
Entry
112221631         CDS       T05605                                 

Definition
(RefSeq) mitogen-activated protein kinase 14A-like isoform X1
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04068  FoxO signaling pathway
otw04114  Oocyte meiosis
otw04218  Cellular senescence
otw04261  Adrenergic signaling in cardiomyocytes
otw04370  VEGF signaling pathway
otw04620  Toll-like receptor signaling pathway
otw04621  NOD-like receptor signaling pathway
otw04622  RIG-I-like receptor signaling pathway
otw04625  C-type lectin receptor signaling pathway
otw04912  GnRH signaling pathway
otw04914  Progesterone-mediated oocyte maturation
otw05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112221631
   04370 VEGF signaling pathway
    112221631
   04068 FoxO signaling pathway
    112221631
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    112221631
   04218 Cellular senescence
    112221631
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    112221631
   04621 NOD-like receptor signaling pathway
    112221631
   04622 RIG-I-like receptor signaling pathway
    112221631
   04625 C-type lectin receptor signaling pathway
    112221631
  09152 Endocrine system
   04912 GnRH signaling pathway
    112221631
   04914 Progesterone-mediated oocyte maturation
    112221631
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112221631
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112221631
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112221631
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     112221631
Protein kinases [BR:otw01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   112221631
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo Kinase-like FTA2
Other DBs
NCBI-GeneID: 112221631
NCBI-ProteinID: XP_024239577
LinkDB
Position
22
AA seq 359 aa
MESPVKTGFHRLEIKKTTWDVPEQYIALKAVGSGAYGTVCSAIDQQTKEKVAIKKLYRPF
QSLIHAQRAYRELRLLRHIQHDNVISLLNVFTPDFSLEKFQTFYMVMPFVAQDLGRIMKS
RRLTDRIIVYLFYQLLRGLKYIHSAGIIHRDLKPGNLAVNENCELKILDFGLARHAESEM
TGYVVTRWYRSPEVIFNWMHYSQSVDLWSAGCILAEMITGQVLFPGSDSIDQLKKILNVT
GTPPSSLVQKMQSKDARSYVQSLPIQKKKNFKEVFPSLHVNAVNLLENVLLLDPETRMTA
KEGLSHPYLAEFHDPESEPDSPTYDDSFESLELDVGEWSSLIHMEIMAFDPSNPSATAL
NT seq 1080 nt   +upstreamnt  +downstreamnt
atggaatcgcctgtgaagacaggtttccatagactggagataaagaaaacaacatgggat
gttccagagcaatatatcgcgctgaaagcagttggctcgggcgcttacgggacagtatgt
tctgctattgaccagcagactaaggagaaggtggccataaagaagctctatcgtcccttt
cagtcgctaatccacgctcaacgggcctaccgtgaactaagactgttacgccatatccag
cacgacaatgtgatcagcctcctcaatgtcttcacacctgatttctccctggagaaattc
cagacgttttacatggtaatgccctttgtggctcaggacctcggtcgcatcatgaagagc
aggagactgaccgatcgcatcatcgtttacctcttctaccagctgctacgtggcctgaag
tatatccattctgcagggatcatccatcgggacctaaaacctggtaaccttgctgtgaat
gagaactgtgaattaaagatcctggactttggtctagcaagacatgcagagagtgagatg
acaggctatgtggtgacacgctggtacaggtcaccagaggtcatcttcaactggatgcac
tatagccaatcagtggacttgtggtctgctggctgcatcctggctgagatgatcacaggc
caggttcttttcccaggcagtgacagcattgaccagctgaagaagatcctcaacgttaca
ggaacaccaccatcctccctggtgcagaagatgcagagcaaagatgctcgctcatatgta
cagagtctccctatccaaaagaagaaaaacttcaaggaggtctttccctccttgcatgta
aacgcggtgaatctgctggagaacgtgctgctgctggacccagagaccaggatgacggct
aaagagggcctctcacacccctacctggctgagttccatgacccagaatctgaacccgac
tccccgacgtacgacgactcctttgaaagcctggagcttgacgtgggagagtggagtagt
ctgatccacatggagattatggctttcgaccccagtaaccccagtgcaactgcattgtag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112221641
Entry
112221641         CDS       T05605                                 

Definition
(RefSeq) mitogen-activated protein kinase 14A isoform X1
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04068  FoxO signaling pathway
otw04114  Oocyte meiosis
otw04218  Cellular senescence
otw04261  Adrenergic signaling in cardiomyocytes
otw04370  VEGF signaling pathway
otw04620  Toll-like receptor signaling pathway
otw04621  NOD-like receptor signaling pathway
otw04622  RIG-I-like receptor signaling pathway
otw04625  C-type lectin receptor signaling pathway
otw04912  GnRH signaling pathway
otw04914  Progesterone-mediated oocyte maturation
otw05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112221641
   04370 VEGF signaling pathway
    112221641
   04068 FoxO signaling pathway
    112221641
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    112221641
   04218 Cellular senescence
    112221641
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    112221641
   04621 NOD-like receptor signaling pathway
    112221641
   04622 RIG-I-like receptor signaling pathway
    112221641
   04625 C-type lectin receptor signaling pathway
    112221641
  09152 Endocrine system
   04912 GnRH signaling pathway
    112221641
   04914 Progesterone-mediated oocyte maturation
    112221641
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112221641
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112221641
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112221641
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     112221641
Protein kinases [BR:otw01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   112221641
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH Kinase-like
Other DBs
NCBI-GeneID: 112221641
NCBI-ProteinID: XP_024239599
LinkDB
Position
22
AA seq 361 aa
MSLKERPTFYRQEVNKTIWEVPERYQTLSPVGSGAYGSVCSSYDEKTGLKIAVKKLSRPF
QSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPATSLEEFNDVYLVTHLMGADLNNIVKC
QKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEM
TGYVATRWYRAPEIMLNWMHYNMTVDIWSVGCIMAELLTGRTLFPGTDHINQLQQIMRLT
GTPPASLISRMPSHEARNYINSLPQMPKRNFSDVFIGANPQAVDLLEKMLVLDTDKRITA
AEALAHPYFSQYHDPDDEPEADPYDQSFESRELEIEEWKRLTYEAVCDFEPPIFDGDNME
S
NT seq 1086 nt   +upstreamnt  +downstreamnt
atgtcgctgaaagaaagacccacgttttatcggcaggaggtgaacaagacgatttgggag
gtaccagaacgctaccagacgttgtctccagtcgggtctggggcctacggatcagtttgc
tcgtcttatgatgagaagaccggtctgaagatagcagtgaagaagctctcccggccattc
cagtccattatccacgccaagaggacctacagagagctacgtctgctcaagcacatgaaa
catgagaacgtgatcggccttctagatgtcttcacacctgctactagtctggaggagttc
aatgacgtgtacctggtgacccacctgatgggggcagacctcaacaacatagtcaagtgt
cagaaactcacagacgatcacgtgcagttcctcatataccagatcctccggggattaaag
tatatccactcagcagatatcattcacagagacctgaaacccagcaacttggctgtgaat
gaggactgtgagctgaagatcctggactttgggctggcgcggcacactgacgacgagatg
acgggttacgttgccacacgctggtaccgggcaccagagatcatgctgaactggatgcac
tacaacatgacagtggatatttggtctgtgggatgcatcatggctgaactcctcactggc
agaacgctgtttcccggtactgaccatataaaccagcttcagcagataatgcgtctgaca
ggaacgcccccagcctctctaataagcaggatgcccagccacgaggccaggaactacatc
aactccttgccacagatgcccaagaggaatttttctgacgtgttcatcggtgccaaccca
caagctgtggacctgctggagaagatgttggttctggacacagataagaggataacggcg
gccgaggctctggcccacccctacttctcccagtaccacgaccctgatgacgagcctgag
gctgacccctacgaccagagctttgagagccgtgagctggagatcgaggaatggaaacgg
ttgacctatgaggcggtgtgcgattttgagccacctatctttgatggagacaacatggaa
tcgtga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112221833
Entry
112221833         CDS       T05605                                 

Definition
(RefSeq) mitogen-activated protein kinase 14A-like
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04068  FoxO signaling pathway
otw04114  Oocyte meiosis
otw04218  Cellular senescence
otw04261  Adrenergic signaling in cardiomyocytes
otw04370  VEGF signaling pathway
otw04620  Toll-like receptor signaling pathway
otw04621  NOD-like receptor signaling pathway
otw04622  RIG-I-like receptor signaling pathway
otw04625  C-type lectin receptor signaling pathway
otw04912  GnRH signaling pathway
otw04914  Progesterone-mediated oocyte maturation
otw05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112221833
   04370 VEGF signaling pathway
    112221833
   04068 FoxO signaling pathway
    112221833
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    112221833
   04218 Cellular senescence
    112221833
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    112221833
   04621 NOD-like receptor signaling pathway
    112221833
   04622 RIG-I-like receptor signaling pathway
    112221833
   04625 C-type lectin receptor signaling pathway
    112221833
  09152 Endocrine system
   04912 GnRH signaling pathway
    112221833
   04914 Progesterone-mediated oocyte maturation
    112221833
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112221833
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112221833
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112221833
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     112221833
Protein kinases [BR:otw01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   112221833
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH Kinase-like
Other DBs
NCBI-GeneID: 112221833
NCBI-ProteinID: XP_024239975
LinkDB
Position
2
AA seq 361 aa
MSHKERPTFYRQELNKTIWEVPERYQSLSPVGSGAYGSVCSSYDVKSGQKMAVKKLSRPF
QSIIHAKRTYRELRLLKXMKHENVIGLLDVFTPATSLEEFNDVYLVTHLMGADLNNIVKC
QKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEM
TGYVATRWYRAPEIMLNWMHYNMTVDIWSVGCIMAELLTGRTLFPGTDHINQLQQIMRLT
GTPPACLISQMPSHEARNYINSLPQMLKRNFADVFVGANPQAVDLLEKMLVLDTDKRITA
SEALAHPYFSQYHDPDDEPESEPYDQSFESRELEIEEWKRLTYEEVCSFEPLPFDGDEME
S
NT seq 1086 nt   +upstreamnt  +downstreamnt
atgtctcacaaggagagacccactttctacagacaggagctgaacaaaacgatatgggag
gtcccggagcggtatcaatccctgtccccggtcggctctggagcctatggatcagtctgc
tcgtcgtatgatgtgaagtctgggcagaagatggcggtgaagaagctgtccaggccgttc
cagtcaattatccacgctaagaggacctacagagaactaaggctcctgaaacamatgaaa
cacgagaatgtgattggtctgttggatgtgttcacgcctgccaccagcctagaggaattc
aacgacgtttacctggtgacccacctgatgggggcagacctcaacaacatagtgaagtgt
cagaagctgacagacgaccatgtgcaattcctcatataccagatcctcaggggactcaag
tatatccattcagcagacatcatccacagagatctgaagcccagtaatctggcagtgaat
gaggactgtgagctcaagatcctggactttggtttggcgcgacacactgatgatgagatg
actggttatgtagcgaccaggtggtaccgcgccccagagatcatgctgaactggatgcac
tacaacatgacagtggacatctggtcagtcggctgcatcatggcagagctgctcactgga
cggacgttattccccggcaccgaccatataaaccagctgcagcagatcatgaggctgaca
ggaacgcccccggcctgtctcattagccagatgcccagccacgaggccagaaactacatc
aactcccttccccagatgctcaagaggaactttgctgatgtgtttgtaggcgctaaccca
caagcggtggatctgttagagaagatgctggttctggacactgataagcgaatcacagcg
tccgaggccctggcccacccctacttctcccagtaccacgaccctgacgatgagccagag
tccgagccatacgaccagagcttcgagagcagagagctggagatagaggagtggaaaagg
ttgacgtatgaggaggtttgcagtttcgagcccctgccattcgatggagacgagatggag
tcctga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112232083
Entry
112232083         CDS       T05605                                 

Definition
(RefSeq) mitogen-activated protein kinase 12-like
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04068  FoxO signaling pathway
otw04114  Oocyte meiosis
otw04218  Cellular senescence
otw04261  Adrenergic signaling in cardiomyocytes
otw04370  VEGF signaling pathway
otw04620  Toll-like receptor signaling pathway
otw04621  NOD-like receptor signaling pathway
otw04622  RIG-I-like receptor signaling pathway
otw04625  C-type lectin receptor signaling pathway
otw04912  GnRH signaling pathway
otw04914  Progesterone-mediated oocyte maturation
otw05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112232083
   04370 VEGF signaling pathway
    112232083
   04068 FoxO signaling pathway
    112232083
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    112232083
   04218 Cellular senescence
    112232083
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    112232083
   04621 NOD-like receptor signaling pathway
    112232083
   04622 RIG-I-like receptor signaling pathway
    112232083
   04625 C-type lectin receptor signaling pathway
    112232083
  09152 Endocrine system
   04912 GnRH signaling pathway
    112232083
   04914 Progesterone-mediated oocyte maturation
    112232083
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112232083
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112232083
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112232083
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     112232083
Protein kinases [BR:otw01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   112232083
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr RIO1 Kdo APH Kinase-like FTA2
Other DBs
NCBI-GeneID: 112232083
NCBI-ProteinID: XP_024254645
LinkDB
Position
Unknown
AA seq 361 aa
MSSRTRPGYCRQDVNKTTWEVPERYRDLKQVGTGAYGTVCSAVDFRTGTKVAIKKLHRPF
QSELFAKRAYRELRLLKHMKHENVIGLVDVFTADLSLDRFHDFYLVMPFMGTDLGKLMKL
QQLSEDKVQFLVYQMLKGLKYIHSAGIIHRDLKPGNLAVNQECELKILDFGLARQADSEM
TGYVVTRWYRAPEVILSWMHYTQTVDIWSVGCIMAEMLSGKPLFKGNDHLDQLTEIMKVT
GTPTQEFITKLQSQDAKNYVKSLPKVQKKDLQELFSKVNPQAVTVIECMLLLDPESRVMA
AEALTLPYFSEFREPEEETEAQPYDHSVDNSDLSLEQWKRHTFTEILSFQPQVVESRETA
L
NT seq 1086 nt   +upstreamnt  +downstreamnt
atgtcgagccggaccagacctggctactgtcgccaggacgtgaacaaaaccacctgggag
gtaccggagcggtacagggatctaaaacaggtggggacaggggcgtacggtacagtctgc
tctgcggtggacttcaggacaggcaccaaggtggccatcaagaagctccacaggcccttc
cagtctgagctctttgctaagagggcctatcgggagctgaggctgctcaaacacatgaaa
catgaaaatgtgattggccttgtggatgtattcactgctgacctctccttagacagattc
catgatttctatctggtgatgcctttcatgggaaccgatctggggaagttgatgaagtta
cagcagctctcagaggacaaagtacagttcctggtctatcagatgctgaaaggactcaag
tatatccattctgctggcataattcatagggacctcaaaccagggaatctggccgttaat
caggaatgtgagctcaagatcctggactttgggttggcacggcaggcggacagtgagatg
acaggctacgtggtgacccgctggtacagagcccctgaggttatcctcagctggatgcac
tacacccagactgtggacatctggtctgtgggctgcatcatggcagagatgctgtcaggg
aaaccactgttcaaaggcaatgaccacctggatcagctgactgagatcatgaaggtcaca
gggacacccactcaggagttcatcaccaaactgcagtctcaggatgctaaaaactatgtc
aaaagccttcccaaagtgcaaaagaaagaccttcaggaactcttttccaaagtcaaccca
caggcggtgacagttatagagtgcatgctgctgctcgacccagagagtagggtgatggcg
gcagaggccctcaccctgccatacttctcagagtttagagagccagaggaggagactgag
gcccagccttacgaccactcggtagacaactctgacttgtccctggaacagtggaaacgt
cacacgttcacagagatcttgtctttccagccccaagtggttgagtccagggaaaccgca
ctgtaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112233030
Entry
112233030         CDS       T05605                                 

Definition
(RefSeq) mitogen-activated protein kinase 13-like isoform X1
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04068  FoxO signaling pathway
otw04114  Oocyte meiosis
otw04218  Cellular senescence
otw04261  Adrenergic signaling in cardiomyocytes
otw04370  VEGF signaling pathway
otw04620  Toll-like receptor signaling pathway
otw04621  NOD-like receptor signaling pathway
otw04622  RIG-I-like receptor signaling pathway
otw04625  C-type lectin receptor signaling pathway
otw04912  GnRH signaling pathway
otw04914  Progesterone-mediated oocyte maturation
otw05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112233030
   04370 VEGF signaling pathway
    112233030
   04068 FoxO signaling pathway
    112233030
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    112233030
   04218 Cellular senescence
    112233030
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    112233030
   04621 NOD-like receptor signaling pathway
    112233030
   04622 RIG-I-like receptor signaling pathway
    112233030
   04625 C-type lectin receptor signaling pathway
    112233030
  09152 Endocrine system
   04912 GnRH signaling pathway
    112233030
   04914 Progesterone-mediated oocyte maturation
    112233030
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112233030
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112233030
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112233030
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     112233030
Protein kinases [BR:otw01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   112233030
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo
Other DBs
NCBI-GeneID: 112233030
NCBI-ProteinID: XP_024256150
LinkDB
Position
Unknown
AA seq 363 aa
MESQTQYTREEINSTIWEVPEKYTRLKQIGTGAYGSVCSVINVKTTEKVAIKKLHRPFQS
EIFAKRAYRELRLLKHMKHENVIGLLDVFTPAAGLDEFTDFYLVMPYMFTDLSKVKGLLT
EDRVQFLVYQMLCGLRYIHKAGIIHRDLKPGNLAVNQDCELKILDFGLARHAEAEMTGYV
VTRWYRAPEVILNWMHYTQTVDIWSVGCIMGEMINGKTLFKGKDYMDQLTQIMKVTGVPG
PDFIQKLDSQEAKSYVRSLPHFPRKDFSKLFPRASAQAIDLLEKMLVLDGETRLTAESAL
THPYFDGLRDPEDCPEPQPYDDSHDNATLPLEDWRRLSFKEVKSFVPFPRRDSKRRNTLT
ISP
NT seq 1092 nt   +upstreamnt  +downstreamnt
atggagtcgcagacacagtacacccgagaggagatcaacagcacgatatgggaagtgccg
gagaagtacacgcgattgaagcaaattgggacaggggcgtacggttccgtatgctcggta
ataaatgtgaaaaccactgagaaagtggccattaagaagcttcaccggcccttccagtct
gagatttttgcaaagagggcttatcgggagcttcgactgctcaagcacatgaaacatgaa
aatgtgatagggcttctggatgtgtttactcctgctgctgggcttgatgaattcacagat
ttctacctggtgatgccttacatgttcaccgacctctccaaagtcaaaggacttctcact
gaagacagagtgcagttccttgtctatcagatgctgtgtggactaaggtacattcacaaa
gctggcatcatccacagggacctgaagcctggtaacttggctgtcaatcaagactgtgaa
ttaaagatcctggactttggtcttgctcgccatgccgaggcggagatgacgggctatgtt
gtgacccgctggtaccgggcaccagaggtcattctaaactggatgcactacacccagact
gtggacatctggtctgtgggctgtatcatgggagagatgatcaatgggaagacgcttttc
aaagggaaagactacatggaccagctgactcagatcatgaaagtaactggagtacccggt
cctgacttcattcagaaactggacagtcaggaggcaaaaagctatgtgcggtccctccct
cactttcccagaaaagacttctctaagttgttccccagagcaagtgcacaggcgattgac
cttcttgagaagatgctggttttggatggtgagactcggcttactgctgagagtgctctg
acacacccgtattttgatggcttgagagatccagaggactgccctgagccacagccatat
gatgacagtcacgacaatgccacgctgcctctggaggactggaggcggttatccttcaaa
gaggtgaagagctttgtgccattcccacgacgggactccaagaggcgaaacacactgaca
atttctccgtga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112235071
Entry
112235071         CDS       T05605                                 

Definition
(RefSeq) mitogen-activated protein kinase 14A-like isoform X1
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04068  FoxO signaling pathway
otw04114  Oocyte meiosis
otw04218  Cellular senescence
otw04261  Adrenergic signaling in cardiomyocytes
otw04370  VEGF signaling pathway
otw04620  Toll-like receptor signaling pathway
otw04621  NOD-like receptor signaling pathway
otw04622  RIG-I-like receptor signaling pathway
otw04625  C-type lectin receptor signaling pathway
otw04912  GnRH signaling pathway
otw04914  Progesterone-mediated oocyte maturation
otw05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112235071
   04370 VEGF signaling pathway
    112235071
   04068 FoxO signaling pathway
    112235071
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    112235071
   04218 Cellular senescence
    112235071
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    112235071
   04621 NOD-like receptor signaling pathway
    112235071
   04622 RIG-I-like receptor signaling pathway
    112235071
   04625 C-type lectin receptor signaling pathway
    112235071
  09152 Endocrine system
   04912 GnRH signaling pathway
    112235071
   04914 Progesterone-mediated oocyte maturation
    112235071
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112235071
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112235071
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112235071
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     112235071
Protein kinases [BR:otw01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   112235071
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo
Other DBs
NCBI-GeneID: 112235071
NCBI-ProteinID: XP_024259233
LinkDB
Position
Unknown
AA seq 359 aa
MELPVKKGFLRLEIQKTTWEVPEQYTALKAVGSGAYGTVCSAIDQQTKEKVAIKKLYRPF
QSLIHAKRAYRELRLLRHIQHDNVICLLNVFTPDFSLEKFQTFYMVMPFVAEDLGNIMKR
RRLTDRVIVYLFYQLLCGLKYIHSAGIIHRDLKPGNLAVNDNCELKILDFGLARHAESEM
TGYVVTRWYRSPEVIFNWMHYSQSVDLWSAGCILAEMITGQVLFPGKDSIDQLKKILHVT
GTPPSSLLQKMQSKDARSYVQGLPIQKKKNFKEVFPSLDVNAVDLLDSILLLDPDTRMTA
KEGLSHPYLSEFHDPESEPDSPPYDDSFESMELDVGEWSSLIHMEIMTFDPRNPSATAM
NT seq 1080 nt   +upstreamnt  +downstreamnt
atggaattgcccgtgaagaaaggtttccttagactggaaatacagaaaacaacatgggag
gttccggagcaatataccgcactgaaagctgttggctcaggtgcttacgggacagtatgt
tctgctattgaccagcagaccaaggagaaggtggccattaagaagctctatcgtccattt
cagtccctgatccatgctaaacgggcctaccgggaactacgactgttgcgccacatccag
catgacaatgtgatctgcctccttaatgtcttcacacctgatttctccctggagaaattc
cagacattttacatggtgatgcccttcgttgctgaggatctcggtaacatcatgaagagg
aggagattgactgatcgcgtcatcgtttacctcttctaccagcttctatgtggcctcaag
tatatccattctgcagggatcatccatcgggacctaaaacctggcaacctcgccgtgaac
gataactgtgaattgaagatcctggactttggtctagcgagacatgcagagagtgagatg
acgggctatgtggtgacacgctggtacaggtcaccagaggtcatcttcaactggatgcac
tatagccagtcagtggacttgtggtcagcaggctgcatcttggctgagatgatcacaggc
caggttctgttcccaggcaaagacagcattgaccagttgaagaagatcctccacgtaaca
ggaacaccaccgtcctccctgctgcagaagatgcagagcaaagatgctcgttcatatgtg
cagggtctccctatccaaaagaagaaaaactttaaggaagtctttccctccttggatgta
aatgcggtggatctgctggacagcatactgctgctggacccagacaccaggatgacagct
aaagagggcctctcacacccctacctctctgagttccatgatccagaatctgaacccgac
tccccaccgtacgacgactcctttgaaagcatggagcttgacgtgggagagtggagtagt
ctgatccacatggagattatgacttttgaccccagaaaccccagtgccactgcaatgtag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112252549
Entry
112252549         CDS       T05605                                 

Definition
(RefSeq) mitogen-activated protein kinase 12-like
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04068  FoxO signaling pathway
otw04114  Oocyte meiosis
otw04218  Cellular senescence
otw04261  Adrenergic signaling in cardiomyocytes
otw04370  VEGF signaling pathway
otw04620  Toll-like receptor signaling pathway
otw04621  NOD-like receptor signaling pathway
otw04622  RIG-I-like receptor signaling pathway
otw04625  C-type lectin receptor signaling pathway
otw04912  GnRH signaling pathway
otw04914  Progesterone-mediated oocyte maturation
otw05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112252549
   04370 VEGF signaling pathway
    112252549
   04068 FoxO signaling pathway
    112252549
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    112252549
   04218 Cellular senescence
    112252549
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    112252549
   04621 NOD-like receptor signaling pathway
    112252549
   04622 RIG-I-like receptor signaling pathway
    112252549
   04625 C-type lectin receptor signaling pathway
    112252549
  09152 Endocrine system
   04912 GnRH signaling pathway
    112252549
   04914 Progesterone-mediated oocyte maturation
    112252549
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112252549
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112252549
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112252549
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     112252549
Protein kinases [BR:otw01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   112252549
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr RIO1 Kdo APH Kinase-like FTA2
Other DBs
NCBI-GeneID: 112252549
NCBI-ProteinID: XP_024279621
LinkDB
Position
6
AA seq 361 aa
MSSRTRPGYCRQDVNKTTWEVPERYRDLKQVGTGAYGTVCSAVDFRTGTKVAIKKLHRPF
QSELFAKRAYRELRLLKHMKHENVIGLVDVFTADLSLDRFHDFYLVMPFMGTDLGKLMKL
QQLSEDKVQFLVYQMLKGLKYIHSAGIIHRDLKPGNLAVNQECELKILDFGLARQADSEM
TGYVVTRWYRAPEVILSWMHYTQTVDIWSVGCIMAEMLSGKPLFKGNDHLDQLTEIMKVT
GTPTQEFITKLQSQDAKNYVKSLPKVQKKDLQALFSTVNPQAVTVIERMLLLDPESRVTA
AAALALPYFSEFREPEEETEAQPYDHSVDNSDLPLEQWKRHTFTEILSFQPIVVESRETA
L
NT seq 1086 nt   +upstreamnt  +downstreamnt
atgtcgagccggaccagacctggctactgtcgccaggacgtgaacaaaaccacctgggag
gtaccggagcggtacagggatctaaaacaggtggggacaggggcgtacggtacagtctgc
tctgcggtggacttcaggacaggcaccaaggtggccatcaagaagctccacaggcccttc
cagtctgagctctttgctaagagggcctatcgggagctgaggctgctcaaacacatgaaa
catgaaaatgtgattggccttgtggatgtattcactgctgacctctccttagacagattc
catgatttctatctggtgatgcctttcatgggaaccgatctggggaagttgatgaagtta
cagcagctctcagaggacaaagtacagttcctggtctatcagatgctgaaaggactcaag
tatatccattctgctggcataattcatagggacctcaaaccagggaatctggctgttaat
caggaatgtgagctcaagatcctggactttgggttggcacggcaggcggacagtgagatg
acaggctacgtggtgacccgctggtacagagcccctgaggttatcctcagctggatgcac
tacacccagactgtggacatctggtctgtgggctgcatcatggcagagatgctgtcaggg
aaaccactgttcaaaggcaatgaccacctggatcagctgactgagatcatgaaggtcaca
gggacacccactcaggagttcatcaccaaactgcagtctcaggatgctaaaaactatgtc
aaaagccttcccaaagtgcaaaaaaaagaccttcaggcactcttttccacagtcaaccca
caggcggtgacagttatagagcgcatgctgctgctggacccagagagcagggtgacggca
gcggcagccctcgccctgccatacttctcagagttcagggagccagaagaggagaccgag
gcccagccatacgaccactctgtagacaactctgacctgcctctggagcagtggaaacgt
cacacgttcacagagatcctgtctttccagcccatagtggtagagtccagggaaaccgca
ctgtaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112254157
Entry
112254157         CDS       T05605                                 

Definition
(RefSeq) mitogen-activated protein kinase 14A-like isoform X1
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04068  FoxO signaling pathway
otw04114  Oocyte meiosis
otw04218  Cellular senescence
otw04261  Adrenergic signaling in cardiomyocytes
otw04370  VEGF signaling pathway
otw04620  Toll-like receptor signaling pathway
otw04621  NOD-like receptor signaling pathway
otw04622  RIG-I-like receptor signaling pathway
otw04625  C-type lectin receptor signaling pathway
otw04912  GnRH signaling pathway
otw04914  Progesterone-mediated oocyte maturation
otw05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112254157
   04370 VEGF signaling pathway
    112254157
   04068 FoxO signaling pathway
    112254157
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    112254157
   04218 Cellular senescence
    112254157
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    112254157
   04621 NOD-like receptor signaling pathway
    112254157
   04622 RIG-I-like receptor signaling pathway
    112254157
   04625 C-type lectin receptor signaling pathway
    112254157
  09152 Endocrine system
   04912 GnRH signaling pathway
    112254157
   04914 Progesterone-mediated oocyte maturation
    112254157
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112254157
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112254157
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112254157
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     112254157
Protein kinases [BR:otw01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   112254157
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH Kinase-like
Other DBs
NCBI-GeneID: 112254157
NCBI-ProteinID: XP_024282206
LinkDB
Position
7
AA seq 361 aa
MFHKERPTFYRQELNKTIWEVPERYQTLSPVGSGAYGSVCSSYDVKSGLKIAVKKLSRPF
QSVIHAKRTYRELRLLKHMKHENVIGLLDVFTPATSLEEFNDVYLVTHLMGADLNNIVKC
QKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEM
TGYVATRWYRAPEIMLNWMHYNMTVDIWSVGCIMAELLTGRTLFPGTDHINQLQQIMRLT
GTPPASVISRMPSHEARNYINSLPQMPKRNFADVFIGANPLAVDLLEKMLVLDTDQRITA
SEALAHSYFSQYHDPGDEPESEPYDQSFESRELEIEEWKRLTYEEVCSFEPLPFDGDEME
S
NT seq 1086 nt   +upstreamnt  +downstreamnt
atgtttcacaaggagagacccactttctaccgacaggagctcaacaagacgatatgggag
gtcccggagcggtaccagaccctgtccccggtcggctcgggagcctacgggtccgtctgc
tcgtcgtatgacgtgaagtcggggctgaagatagcggtgaagaagctgtcgaggccgttc
cagtccgtcattcacgctaagaggacctacagagaactacgactcctcaaacacatgaaa
cacgagaacgtgatcggcctgttggatgtgtttacgcccgctaccagcctagaggagttc
aacgatgtgtacctggtgacccacctgatgggggcggacctcaacaatatcgtcaagtgt
cagaaactgacggacgaccacgttcagttcctcatataccagatcctccggggtctcaag
tatatccattcagcagacatcatccacagagatctgaagcccagtaacttggcagtgaat
gaggactgtgagctcaagatcctggactttggtttggcgagacacactgatgatgagatg
acgggttacgtagcaaccaggtggtaccgcgccccagagatcatgcttaactggatgcac
tacaacatgacagttgacatctggtcggtgggctgcataatggcggagctgctaaccgga
aggacgttattccccggcaccgaccatattaaccagctgcagcagatcatgaggctgaca
ggtacacccccggcctctgtcattagccggatgcccagccacgaggccagaaactacatt
aattcccttccccagatgcccaagaggaactttgctgatgtgttcattggcgctaaccca
ctagcggtggatctgttagagaagatgttggttctggacactgatcagcggatcacagcg
tcagaggccctggcccactcctacttctcccagtaccacgacccaggcgatgaaccagag
tctgagccatacgaccagagctttgagagccgtgagctggagatagaggagtggaaaagg
ttgacctatgaggaggtttgcagcttcgagcccctgccattcgacggagacgagatggag
tcctga

DBGET integrated database retrieval system