KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112214243
Entry
112214243         CDS       T05605                                 

Definition
(RefSeq) myosin regulatory light polypeptide 9
  KO
K12755  myosin regulatory light chain 9
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04270  Vascular smooth muscle contraction
otw04510  Focal adhesion
otw04530  Tight junction
otw04810  Regulation of actin cytoskeleton
otw05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112214243
   04530 Tight junction
    112214243
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112214243
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    112214243
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112214243
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:otw04812]
    112214243
   04147 Exosome [BR:otw04147]
    112214243
Cytoskeleton proteins [BR:otw04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     112214243
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   112214243
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_11 EF-hand_9 UPF0154 SPARC_Ca_bdg DUF3741
Other DBs
NCBI-GeneID: 112214243
NCBI-ProteinID: XP_024228621
LinkDB
Position
2
AA seq 173 aa
MSSKRAKGKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLAS
LGKNPSDEYLEGMMAEAPGPINFTMFLTMFGERLNGTDPEDVIRNAFACFDEEGSGVIHE
DHLRELLTTMGDRFTDEEVDELFREAPIDKKGNFNYAEFTRILKHGAKDKDDM
NT seq 522 nt   +upstreamnt  +downstreamnt
atgtcgagcaaacgcgcaaaggggaagaccaccaagaagcgcccccagagggccacgtcc
aacgtgttcgccatgtttgaccagtctcagatccaggagttcaaggaggccttcaacatg
atcgaccagaaccgagatggcttcatcgacaaggaggatctgcacgatatgctggcctca
ctaggtaagaacccatctgatgagtacctggaggggatgatggctgaggcgccggggccc
atcaacttcaccatgttcctcactatgtttggagagcgcctcaacggcaccgaccccgag
gacgtcatccgcaacgccttcgcctgcttcgatgaggagggctctggggtgatccacgag
gaccacctgagggagctgctgacgaccatgggtgaccgcttcaccgacgaggaggtggac
gagctgtttcgcgaggcgcccatcgacaagaagggcaacttcaactacgccgagttcact
cgcatcctcaaacacggcgccaaggacaaggacgacatgtag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112215535
Entry
112215535         CDS       T05605                                 

Definition
(RefSeq) myosin regulatory light chain 2, ventricular/cardiac muscle isoform
  KO
K10351  myosin regulatory light chain 2
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04260  Cardiac muscle contraction
otw04261  Adrenergic signaling in cardiomyocytes
otw04371  Apelin signaling pathway
otw04510  Focal adhesion
otw04530  Tight junction
otw04810  Regulation of actin cytoskeleton
otw05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    112215535
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112215535
   04530 Tight junction
    112215535
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112215535
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    112215535
   04261 Adrenergic signaling in cardiomyocytes
    112215535
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112215535
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:otw04812]
    112215535
Cytoskeleton proteins [BR:otw04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     112215535
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EFhand_Ca_insen EF-hand_5
Other DBs
NCBI-GeneID: 112215535
NCBI-ProteinID: XP_024230398
LinkDB
Position
2
AA seq 168 aa
MAPKKAKKKSADSNSNVFSIFEQSQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRLN
VKQEEIDEMLKEASGPVNFTIFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLRKDFVT
EMLTTQADRFSPEEMEQMFAAFPPDVAGNLDYKNLVHIITHGEEKDQE
NT seq 507 nt   +upstreamnt  +downstreamnt
atggcacccaagaaggcaaagaagaagtcagcggattctaactccaatgtgttttcgatt
tttgagcagtctcagatccaggagttcaaggaggccttcaccatcatggaccagaacaga
gatggattcattgacaaaaatgacctgagggacacctttgctgcactggggcggctcaac
gtgaagcaggaggagatagatgagatgctgaaagaggcgtccggccccgtcaacttcacc
atcttcctcaccatgttcggggagaagctgaaaggcgctgatccagaggagactatcctc
aatgcttttaaagtatttgaccccgaaggaaaaggggtcctgaggaaggactttgtgaca
gagatgctgacgacacaagcggacagattttctcctgaagagatggagcagatgtttgca
gccttcccaccagacgtggcaggaaatctagactacaaaaaccttgtgcacatcatcaca
cacggagaagagaaggaccaggagtaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112215662
Entry
112215662         CDS       T05605                                 

Definition
(RefSeq) myosin regulatory light polypeptide 9-like
  KO
K12757  myosin regulatory light chain 12
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04530  Tight junction
otw04810  Regulation of actin cytoskeleton
otw05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112215662
   04530 Tight junction
    112215662
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112215662
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112215662
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:otw04812]
    112215662
   04147 Exosome [BR:otw04147]
    112215662
Cytoskeleton proteins [BR:otw04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     112215662
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   112215662
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_11 SPARC_Ca_bdg DUF3741 DUF2666
Other DBs
NCBI-GeneID: 112215662
NCBI-ProteinID: XP_024230648
LinkDB
Position
16
AA seq 172 aa
MSSKRAKGKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFVDKEDLHDMLAS
LGKNPTDDYLEAMMTEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEGTGVIQE
EYLRELLTTMGDRFTDEEVDELFREAPIDKKSNFNYVEFTRILKHGAKDKDD
NT seq 519 nt   +upstreamnt  +downstreamnt
atgtcgagcaaaagggccaagggaaagaccaccaagaagcgtccccagcgcgctaccagc
aatgtgttcgccatgttcgaccagtctcagatccaggagttcaaagaggccttcaacatg
attgaccagaaccgcgacgggtttgtcgacaaggaggacctgcatgacatgcttgcctca
ctagggaagaacccgactgatgattacctggaggctatgatgactgaagcgcctgggccc
atcaacttcaccatgttcctcaccatgttcggagagaagctcaacggcacagatcctgag
gacgtcatcagaaacgcttttgcctgctttgatgaagaaggcacaggtgtcatccaggag
gaatacctcagagagctgctgaccacaatgggtgaccgcttcacagacgaggaggtggac
gagctcttcagggaggcacctattgacaaaaagagcaacttcaactatgtggagttcaca
cgcatcctaaaacacggagccaaggacaaggatgattaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112227962
Entry
112227962         CDS       T05605                                 

Definition
(RefSeq) myosin regulatory light polypeptide 9
  KO
K12757  myosin regulatory light chain 12
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04530  Tight junction
otw04810  Regulation of actin cytoskeleton
otw05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112227962
   04530 Tight junction
    112227962
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112227962
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112227962
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:otw04812]
    112227962
   04147 Exosome [BR:otw04147]
    112227962
Cytoskeleton proteins [BR:otw04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     112227962
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   112227962
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_11 UPF0154 SPARC_Ca_bdg DUF3741
Other DBs
NCBI-GeneID: 112227962
NCBI-ProteinID: XP_024248775
LinkDB
Position
29
AA seq 172 aa
MSSKRAKGKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFVDKEDLHDMLAS
LGKNPSDEYLEAMMTEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEGTGVIQE
EYLRELLTTMGDRFTDEEVDELFREAPIDKKSNFNYVEFTRILKHGAKDKDD
NT seq 519 nt   +upstreamnt  +downstreamnt
atgtcgagcaaacgggcaaagggaaagaccaccaagaagcgcccccagcgtgctactagc
aatgtgttcgctatgtttgaccagtctcagatccaggagttcaaggaggccttcaacatg
attgaccagaaccgtgatgggtttgtcgacaaggaggatctgcatgacatgctagcctca
ctggggaagaacccgtctgatgagtacctggaggctatgatgactgaagctcctgggccc
atcaacttcaccatgttcctcaccatgtttggtgagaagctcaacggcacggaccctgag
gacgtaatcagaaatgcttttgcctgcttcgacgaagagggtacaggtgtcatccaggag
gaatacctcagagagctgctaaccaccatgggtgaccgcttcacagacgaggaagtggac
gagctcttcagggaggcacccattgacaaaaagagcaacttcaactatgtggagttcacg
cgcatcctaaaacacggagccaaggataaggacgattaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112228530
Entry
112228530         CDS       T05605                                 

Definition
(RefSeq) myosin regulatory light chain 2, ventricular/cardiac muscle isoform-like isoform X1
  KO
K12756  myosin regulatory light chain 10
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04810  Regulation of actin cytoskeleton
otw05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112228530
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112228530
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112228530
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:otw04812]
    112228530
Cytoskeleton proteins [BR:otw04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     112228530
SSDB
Motif
Pfam: EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5
Other DBs
NCBI-GeneID: 112228530
NCBI-ProteinID: XP_024249695
LinkDB
Position
30
AA seq 173 aa
MNGIERAPKKAKKKAAEASSNVFSMFEQAQIQEFKEAFTIMDQNRDGFIDKSDLRDTFCA
LGRLNVGNDELDEMLKMAPGPINFTIFLSMFGEKLKGTDPEETIINAFKIFDPEGQGVLK
GEDIKYYIMSQADKFTEAEVEDMFANFPLDVAGNLDYKNLCYVITHGEDKEAE
NT seq 522 nt   +upstreamnt  +downstreamnt
atgaatggaattgagagggcacccaagaaggcaaagaagaaggcagcagaggccagctcc
aatgtgttctccatgtttgagcaagcccagatccaggagttcaaggaggctttcaccatc
atggaccagaacagagacggtttcattgacaagagtgacctgagggacaccttctgtgct
ctgggccgtctcaatgtgggtaatgatgagctggatgagatgctgaagatggcccctgga
ccaatcaacttcaccatattcctctccatgtttggcgagaagttgaaaggtactgatcct
gaggagaccattattaacgccttcaagatcttcgaccccgagggacagggagtcctcaag
ggagaagatatcaaatattacataatgtcacaggcggacaagttcaccgaagctgaggtt
gaagacatgttcgcaaacttccccctggatgtcgccggcaatctggactataagaacctg
tgctacgttatcacccacggagaggacaaggaggcggagtaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112246201
Entry
112246201         CDS       T05605                                 

Definition
(RefSeq) myosin regulatory light polypeptide 9-like
  KO
K12755  myosin regulatory light chain 9
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04270  Vascular smooth muscle contraction
otw04510  Focal adhesion
otw04530  Tight junction
otw04810  Regulation of actin cytoskeleton
otw05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112246201
   04530 Tight junction
    112246201
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112246201
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    112246201
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112246201
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:otw04812]
    112246201
   04147 Exosome [BR:otw04147]
    112246201
Cytoskeleton proteins [BR:otw04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     112246201
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   112246201
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_11 UPF0154 SPARC_Ca_bdg DUF3741
Other DBs
NCBI-GeneID: 112246201
NCBI-ProteinID: XP_024270264
LinkDB
Position
Unknown
AA seq 173 aa
MSSKRAKGKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLAS
LGKNPSDEYLEGMMAEAPGPINFTMFLTMFGERLNGTDPEDVIRNAFACFDEEGSGVLHE
DHLRELLTTMGDRFTDEEVDELFREAPIDTKGNFNYAEFTRILKHGAKDKDDM
NT seq 522 nt   +upstreamnt  +downstreamnt
atgtcgagcaaacgtgcaaaggggaagaccaccaagaagcggccccagagggccacgtcc
aacgtgttcgccatgttcgaccagtctcagatccaggagttcaaggaggccttcaacatg
atcgaccagaaccgggacggcttcatcgacaaggaggatcttcatgacatgctggcctca
ctgggtaagaacccgtcagatgagtacctggaggggatgatggcggaggcgccggggccc
atcaacttcaccatgtttctcaccatgttcggagagcgcctcaacggcaccgaccccgag
gacgttatccgcaacgccttcgcctgcttcgacgaggagggttctggagtgctccacgag
gaccacctgcgagagttactgaccacaatgggcgaccgtttcactgatgaggaagtggac
gagctgttccgtgaggcgcctatcgacacgaagggcaacttcaactacgccgagttcacc
cgcatcctcaaacacggagctaaggacaaggacgacatgtag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112249714
Entry
112249714         CDS       T05605                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: myosin regulatory light chain 2, atrial isoform-like
  KO
K12754  myosin regulatory light chain 7
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04810  Regulation of actin cytoskeleton
otw05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112249714
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112249714
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112249714
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:otw04812]
    112249714
Cytoskeleton proteins [BR:otw04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     112249714
SSDB
Motif
Pfam: EF-hand_1 EF-hand_6 EF-hand_7 EF-hand_8 EF-hand_5 EF-hand_9 EF-hand_11
Other DBs
NCBI-GeneID: 112249714
NCBI-ProteinID: XP_024275260
LinkDB
Position
4
AA seq 172 aa
MASKKAANKRQRGAQKSCSNVFSMFEQCQIQEFKEACGCIDQDRDGVIKKQDLRETYGQL
GKLNVKDEELDXMLNEGKGPINFXVFLTLFGEKLNGTDPEDTILATFKLFDPNGTGFVNK
DEFKRLLMNQADKYTAEEVDQAFSVAPIDVAGNIDYKSLCYIITHGDEKEES
NT seq 519 nt   +upstreamnt  +downstreamnt
atggccagtaagaaggctgctaataagagacagagaggagcccagaagagctgctccaat
gtcttctccatgttcgaacagtgtcagatacaggagttcaaggaggcctgcggctgtatt
gaccaagacagagatggtgtgatcaaaaaacaggacctgagagaaacctatggacagcta
gggaagctgaacgttaaggatgaggaactggatnngatgttgaacgaggggaagggtccc
atcaactttnnagtgttcctcactctatttggagagaaactcaacggcacagaccccgag
gacaccatcctcgctaccttcaagctcttcgacccaaacggcacaggtttcgtcaacaag
gatgagtttaaacggttactaatgaaccaggcggataaatacacagcagaggaggtggac
caggcgttctctgtggcgccaattgacgtggccggcaacatcgattacaagtcactgtgt
tacatcatcacccacggagacgagaaggaggagtcctaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112254956
Entry
112254956         CDS       T05605                                 

Definition
(RefSeq) myosin regulatory light polypeptide 9-like
  KO
K12755  myosin regulatory light chain 9
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04270  Vascular smooth muscle contraction
otw04510  Focal adhesion
otw04530  Tight junction
otw04810  Regulation of actin cytoskeleton
otw05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112254956
   04530 Tight junction
    112254956
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112254956
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    112254956
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112254956
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:otw04812]
    112254956
   04147 Exosome [BR:otw04147]
    112254956
Cytoskeleton proteins [BR:otw04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     112254956
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   112254956
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_11 UPF0154 SPARC_Ca_bdg DUF3741
Other DBs
NCBI-GeneID: 112254956
NCBI-ProteinID: XP_024283729
LinkDB
Position
7
AA seq 173 aa
MSSKRAKGKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLAS
LGKNPSDEYLEGMMAEAPGPINFTMFLTMFGERLNGTDPEDVIRNAFACFDEEGSGVLHE
DHLRELLTTMGDRFTDEEVDELFREAPIDTKGNFNYAEFTRILKHGAKDKDDM
NT seq 522 nt   +upstreamnt  +downstreamnt
atgtcgagcaaacgtgcaaaggggaagaccaccaagaagcggccccagagggccacgtcc
aacgtgttcgccatgttcgaccagtctcagatccaggagttcaaggaggccttcaacatg
atcgaccagaaccgggacggcttcatcgacaaggaggatcttcatgacatgctggcctca
ctgggtaagaacccgtcagatgagtacctggaggggatgatggcggaggcgccggggccc
atcaacttcaccatgtttctcaccatgttcggagagcgcctcaacggcaccgaccccgag
gacgttatccgcaacgccttcgcctgcttcgacgaggagggttctggagtgctccacgag
gaccacctgcgagagttactgaccacaatgggcgaccgtttcactgatgaggaagtggac
gagctgttccgtgaggcgcctatcgacacgaagggcaacttcaactacgccgagttcacc
cgcatcctcaaacacggagctaaggacaaggacgacatgtag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112255301
Entry
112255301         CDS       T05605                                 

Definition
(RefSeq) myosin regulatory light chain 2, ventricular/cardiac muscle isoform-like
  KO
K10351  myosin regulatory light chain 2
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04260  Cardiac muscle contraction
otw04261  Adrenergic signaling in cardiomyocytes
otw04371  Apelin signaling pathway
otw04510  Focal adhesion
otw04530  Tight junction
otw04810  Regulation of actin cytoskeleton
otw05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    112255301
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112255301
   04530 Tight junction
    112255301
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112255301
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    112255301
   04261 Adrenergic signaling in cardiomyocytes
    112255301
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112255301
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:otw04812]
    112255301
Cytoskeleton proteins [BR:otw04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     112255301
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5
Other DBs
NCBI-GeneID: 112255301
NCBI-ProteinID: XP_024284083
LinkDB
Position
7
AA seq 179 aa
MDLLLFHLPPKVPKKAKKKSAEGANSNVFSIFEQSQIQEFKEAFTIMDQNRDGFIDKNDL
SDTFAALGRLNVKQKEIDEMLKEASGPVNFTVFFTMFGEKLKGADPEETILNAFKVFDPE
GKRVLRKDSVTEILTTQADRFSPEEMEQMFAAFPPDVAGNLDYKNLVHIIKHGEEKDQE
NT seq 540 nt   +upstreamnt  +downstreamnt
atggatctactccttttccacctcccgccgaaggtacccaagaaggcaaagaagaagtcc
gcagagggagccaactctaatgtattttctatatttgagcagtctcaaatccaggagttc
aaggaggcattcaccatcatggaccaaaaccgagatggattcattgacaaaaacgacttg
agcgacacctttgctgcactgggccgtctcaacgtgaagcaaaaggagatagatgagatg
ctgaaagaagcgtcgggcccagtcaacttcaccgtcttcttcaccatgtttggagagaag
ctaaaaggcgctgatccagaggaaactatcctcaacgcatttaaagtatttgatcctgaa
ggaaaacgggtcctgaggaaggactctgtgaccgagatactgacgacacaagcggacaga
ttttctcctgaagagatggagcaaatgtttgcagccttcccaccagacgtggcaggaaat
ctagactacaaaaaccttgtccacatcatcaaacatggagaagagaaggatcaggagtaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112257917
Entry
112257917         CDS       T05605                                 

Definition
(RefSeq) myosin regulatory light chain 2, ventricular/cardiac muscle isoform-like
  KO
K12756  myosin regulatory light chain 10
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04810  Regulation of actin cytoskeleton
otw05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112257917
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112257917
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112257917
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:otw04812]
    112257917
Cytoskeleton proteins [BR:otw04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     112257917
SSDB
Motif
Pfam: EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5
Other DBs
NCBI-GeneID: 112257917
NCBI-ProteinID: XP_024287622
LinkDB
Position
9
AA seq 168 aa
MAPKKAKKKAAEASSNVFSMFEQAQIQEFKEAFTIMDQNRDGFIDKNDLRDTFCALGRLN
VGNDELDEMLKMAPGPINFTIFLSMFGEKLKGTDPEETIINAFKIFDPEGQGVLKGEDIK
YYIMSQADKFTEAEVEDMFTNFPLDVAGNLDYKNLCYVITHGEDKETE
NT seq 507 nt   +upstreamnt  +downstreamnt
atggctcctaaaaaggcaaagaagaaggcagcagaggccagctccaatgtgttctccatg
tttgagcaagcccagatccaggagttcaaggaggctttcaccatcatggaccagaacaga
gacggtttcattgacaagaatgacctgagggacacattctgtgcactgggccgtcttaac
gtgggtaatgatgagctggacgagatgctaaagatggcccctggacccatcaacttcacc
atcttcctctccatgtttggcgagaagttgaaaggtactgaccccgaggagaccattatt
aatgccttcaagatcttcgaccccgagggacagggagtcctcaagggagaggatatcaaa
tattacatcatgtctcaggcggacaagttcaccgaagctgaggttgaagacatgttcaca
aacttccccctggacgtcgccgggaatctggactacaagaacctgtgctacgttatcacc
cacggagaagacaaggagacggagtaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112258967
Entry
112258967         CDS       T05605                                 

Definition
(RefSeq) myosin regulatory light chain 2, skeletal muscle isoform type 2-like
  KO
K12758  fast skeletal myosin light chain 2
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04810  Regulation of actin cytoskeleton
otw05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112258967
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112258967
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112258967
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:otw04812]
    112258967
   04147 Exosome [BR:otw04147]
    112258967
Cytoskeleton proteins [BR:otw04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     112258967
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   112258967
SSDB
Motif
Pfam: EF-hand_1 EF-hand_6 EF-hand_7 EF-hand_8 EF-hand_5 EFhand_Ca_insen
Other DBs
NCBI-GeneID: 112258967
NCBI-ProteinID: XP_024289415
LinkDB
Position
9
AA seq 170 aa
MAPKKAKRRGAAAEGGSSNVFSMFEQSQIQEYKEAFTIIDQNRDGIISKDDLRDVLASMG
QLNVKNEELEAMVKEASGPINFTVFLTMFGEKLKGADPEDVIVSAFKVLDPDATGFIKKD
FLQELLTTQCDRFSAEEMKNLWAAFPPDVAGNVDYKQICYVITHGEEKEE
NT seq 513 nt   +upstreamnt  +downstreamnt
atggcacccaagaaggccaagaggaggggagcagcagcagagggcggttcctccaacgtg
ttctccatgtttgagcagagccagatccaggagtacaaggaggctttcacaatcattgac
cagaacagagacggtattatcagcaaggatgacttgagggacgtgctggcatcaatgggc
cagttgaatgtgaagaatgaggagctggaagccatggtcaaggaggccagcggccccatc
aacttcaccgtcttcctcaccatgttcggagagaagctcaagggggctgatcccgaggat
gtcatcgttagtgctttcaaggtcctggaccccgatgctaccggtttcatcaagaaggac
ttccttcaggagctcctgaccactcagtgcgacaggttctctgcagaggagatgaagaac
ctgtgggctgccttccccccagatgtggccggcaacgtagactacaagcaaatctgctac
gtcatcacacacggagaggagaaggaggagtaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112259027
Entry
112259027         CDS       T05605                                 

Definition
(RefSeq) myosin regulatory light chain 2, skeletal muscle isoform type 2-like
  KO
K12758  fast skeletal myosin light chain 2
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04810  Regulation of actin cytoskeleton
otw05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112259027
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112259027
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112259027
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:otw04812]
    112259027
   04147 Exosome [BR:otw04147]
    112259027
Cytoskeleton proteins [BR:otw04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     112259027
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   112259027
SSDB
Motif
Pfam: EF-hand_1 EF-hand_6 EF-hand_7 EF-hand_8 EF-hand_5 EFhand_Ca_insen
Other DBs
NCBI-GeneID: 112259027
NCBI-ProteinID: XP_024289558
LinkDB
Position
9
AA seq 170 aa
MAPKKAKRRGAAAEGGSSNVFSMFEQSQIQEYKEAFTIIDQNRDGIISKDDLRDVLASMG
QLNVKNEELEAMVKEASGPINFTVFLTMFGEKLKGADPEDVIVSAFKVLDPDATGFIKKD
FLQELLTTQCDRFSAEEMKNLWAAFPPDVAGNVDYKQICYVITHGEEKEE
NT seq 513 nt   +upstreamnt  +downstreamnt
atggcacccaagaaggccaagaggaggggagcagcagcagagggcggttcctccaacgtg
ttctccatgtttgagcagagccagatccaggagtacaaggaggctttcacaatcattgac
cagaacagagacggtatcatcagcaaggatgacttgagggacgtgctggcctcaatgggc
cagttgaatgtgaagaatgaggagctggaagctatggtcaaggaggccagcggccccatc
aacttcaccgtcttcctcaccatgttcggagagaagctcaagggggctgatcccgaggat
gtcatcgttagtgctttcaaggtcctggaccccgatgctaccggtttcatcaagaaggac
ttccttcaggagctcctgaccactcagtgcgacaggttctctgcagaggagatgaagaac
ctgtgggctgccttccccccagatgtggccggcaacgtagactacaagcaaatctgctac
gtcatcacacacggagaggagaaggaggagtaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112263934
Entry
112263934         CDS       T05605                                 

Definition
(RefSeq) myosin regulatory light chain 2, skeletal muscle isoform-like
  KO
K12758  fast skeletal myosin light chain 2
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04810  Regulation of actin cytoskeleton
otw05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112263934
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112263934
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112263934
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:otw04812]
    112263934
   04147 Exosome [BR:otw04147]
    112263934
Cytoskeleton proteins [BR:otw04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     112263934
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   112263934
SSDB
Other DBs
NCBI-GeneID: 112263934
NCBI-ProteinID: XP_024296328
LinkDB
Position
12
AA seq 116 aa
MTEESFSKYSNEELEAMGKEASGPINFTVFLTMFGENLKGADPEDVIVSAFKVLEPEATG
FIKKEFLEELLITQCDRFTTEEMTNLWAAFPPDVAGNVDYKNICYVITHGEVKDET
NT seq 351 nt   +upstreamnt  +downstreamnt
atgacagaggaatcattctcaaaatatagtaatgaagagctggaagccatgggcaaggag
gccagcggccccattaacttcaccgtctttctcaccatgttcggcgagaatctgaagggt
gctgatcccgaggatgttatcgtgagcgctttcaaggtcctggaaccagaggctaccggc
ttcatcaagaaggaattccttgaggagctcctgatcactcagtgcgacagattcaccact
gaggagatgaccaacctatgggctgccttccccccagatgtggctggcaatgtagactac
aagaacatctgttatgtcatcacacacggagaggttaaggacgaaacgtga

DBGET integrated database retrieval system