KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112214278
Entry
112214278         CDS       T05605                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: filamin-C-like
  KO
K04437  filamin
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04510  Focal adhesion
otw05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112214278
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112214278
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112214278
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:otw04812]
    112214278
   04147 Exosome [BR:otw04147]
    112214278
Cytoskeleton proteins [BR:otw04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     112214278
  Intermediate filaments
   Intermediate filament-binding proteins
    112214278
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112214278
SSDB
Motif
Pfam: Filamin CH Big_3_5 Y_Y_Y YtkA CFSR
Other DBs
NCBI-GeneID: 112214278
NCBI-ProteinID: XP_024228691
LinkDB
Position
15
AA seq 2730 aa
MWYKKGTETDNMMSNNTYYEQQQPPQYYKSTDNGDDEEEMPATEKDLAEDAPWKKIQQNT
FTRWCNEHLKCLNKRINDLQKDLTDGLKLIGLLEVLSQKKMYRKYHARPNFRQMKLENVS
VALEFLEREHIKLVSIDSKAIVDGNLKLILGLIWTLILHYSISMPMWEDEDDEDAKKLTP
KQRLLGWIQNKVPQLPINNFHRDWRDGKALGALVDNCAPGLCPDWETWDPSQPVENAREA
MQQADDWLGVPQVIAPEEIVDPNVDEHSVMTYLSQFPKSKLKPGAPLRSKTLHPKKAKAY
GPGIAPRGNMVLKPAEFIVETVEAGLGEVLVYVEDPEGHTEEARVIPNNDKNRTYSVIYL
PKVEGLHKVTYLQAFAGQDIDRVPSWVSVPKPWENPNKGQARRKGLEPVGKXANKPDHFD
IYTAGNTHITLVIVDSQGRRDTVEIILENKGTVFSVATILPYLEVSHXLLVTFAGQQIPX
KPFHRHISEASNPNVCRASGRGLQPKGVRVKEVADFKVYTKGAGSGELKVTVKGPKGLEE
PVKVRDVGEGVYECDYYPIMTGKYTITITWGGQTIPRSPFEVVVSEDVGPQKVRAWGPGL
ETGMVGKSADFVVEAIGTEVGTLGKSDRRLLEVSSIRGPSQAKIECYDKATGHLNVRYWP
SDLGDYAFTVICDDETSKDNPLWPTSSSTAQXLVSPEKVKSYRPSLEPIGCLVNKPQFPF
DTSRAAQGXLKIYAPGSEGFPIEHPSQRTGDSTFLCVYHTSTKHHQTHHHYPWGEVNSPN
SPFRVTIGEGRHPDKVKVYGPGVEKSGLKANEPTYFTVDCCDAGQGDVSIGIKCAPGVVG
PAEADIDFDIIKNDNDTFTVKYMPPGPGRYTIMVLFADHEIPISPFRIKVDPSHDANKVR
AEGPGLNKTGVEVGKPTHFTIYTKGAGKAKPEVHFTGAAKGDAVRDFEIIDNHDYSYTVR
YTAVQQSNMSISICHGGDPIPKSPFNITVAPPLDLNKVKVQGLNNKVDVGKDQEFTVSTH
GVGGQGKIDVKITSPSRRPIPCKLESDTANEVHTVKYIPPEEGPYKVDISYDGNPVPGSP
FTVEGVMPPDPSKVRAYGPGLQGGMVGKPAPFAIDTKGAGTGGLGLTVEGPCEAKIECQD
NGDGSCSVSYLPTEPGEYAINILFAEQHIPGSPFKAMVQSVFDPSKVTASGPGLERGKVN
EAGSFVVDCAKAGDAELTIEIISDSGSKAEVHVQNNSDGTYSITYIPQFHGMYTITIKYG
GHAVPKFPARVQVDPAVDTSGVKVYGPGVEPRGVLREVTTHFIVDARAKSKTGGSHVKAR
IVNPTGANTDAYITDKGEGTYRVEYTAYEDGTCEVLYDDVPVPNSPFRVPGNGGLCPTAQ
SYGPWLEEGLVNKPNRFTVGTQGAGTXGSGSGSEGPSEAKMSCKDNKDGSCSVEYIPFTP
GDYDVNITFGGLPIPGSPFRVPVRELVDPSKVRCSGPGLGSGVRAHVLQTFTVDTSKAGL
APLGVVLYGPTGVAEPVNITDNGDGTHTATYTPAKDGPYTVCVKYADQEVPRSPYKIKTL
PAHDASKVRASGPGLNAQGVPASLPVEFTIDARDAGEGLLTVQILDPEGKPKKANIRDNR
DGTYTVSYVPDMAGRYTITIKYGGDEIPYSPYRIHALPIGDASKCLVTVSIGGHGLGSGL
GPTIQIGEETVITVDAKAAGKGKVTCKVSTPDGAELDVDVVENSDGTFDIYYTAPEPGKY
VITIRFGGEHIPNSPFHVVATEEPVTPGDIMEPMLRPFNLVIPFTVQKGEITGEVRMPSG
KTARPNITDNKDGTVTVKYAPTEKGLHEMDIKYDGNHIPGSPLQFYVDAINSGHVTAYGP
GLSHGMVNKPATFTIVTKDAGEGGLSLAVEGPSKAEINCKDNKDGTCTVSYLPTVPGDYN
IIVKFDNKHIAGSPYTAKITGDDTMRTSQLNVGTATDVSLKISETDLSSLTASIRAPSGN
EEPCLLKRLPNRHIGISFTPKEVGEHVVSVKKNGTHVTNSPFKIMVGQSEIGDASKVKVF
GQGLVEGHIFEVAEFIVDTRNAGYGGLGLSIEGPSKVDINCEDVEDGTCKVTYCPTEPGN
YIINIKFADQHVPGSPFTVKVCGEGRVKESITRKRHAPSIATVGSTCDLNLKIPGNWFQM
VSAQERHTRTFTRSSHTYTRTERTEISKTQAGETKREVRVEESTQVGGDPFRDVFGEFLG
SQSLTGFSGIPATTRQPQEGVCVTQEGDQGTQEMTAQVTSPGGKTEDAEIIDGEDSTYSV
RFIPQEMGPHTVNVKYRGQHVPGSPFQFTVGPLGEGGAHKVRAGGTGLDRGVAGVAAEFS
IWTREAGAGGLSIAVEGPSKAEISFEDRKDGSCGVAYVVQEPGDYEVSIKFNDEHIPDSP
FIVPIATLSDNSRRLTVTSLQEMGLKVGQEASFAVQLNGARGLIDAKVHTPSGAVEECYV
TELDSDKHAIRFIPRENGVHSIEVRFNGSHIPGSPFKIRVGEIGQVGDPGMVSAFGPGLE
GGTTGAASDFVVNTCNAGSGALSVTIDGPSKVKMDCQDCPEGYKVTYTPMAPGSYLITIK
YGGPSHIVGSPFKAKVTGARLSGGHSLHETSSVLVETVTKTSSSSSSMGVAYGPKFSSDA
SKVVSRGAGLSKAFVGQKNTFTVDCSKAGTNMLMVGVHGPKTPCEEVYVKHLGNRMYNVT
YTVKEQGNYILIVKWGDENVPGSPFHVTVP
NT seq 8193 nt   +upstreamnt  +downstreamnt
atgtggtataaaaagggcacggaaaccgacaacatgatgagcaataatacgtactacgag
cagcagcagccgccgcagtactacaagagtacggacaacggggacgacgaggaagagatg
ccggctacggagaaggacctcgctgaggatgcgccctggaagaaaatacaacagaacacc
ttcaccaggtggtgcaacgagcacctcaagtgcctcaacaagcggatcaacgacctacag
aaagacctgaccgacgggctcaagctcatcggtcttctggaggttttgagccagaagaaa
atgtacagaaagtaccacgccagacctaacttcagacaaatgaaactggaaaatgtgtcc
gttgcgctggaattcttggagagagaacacataaagctggtatcgatagacagtaaggca
atcgtggatgggaacctgaagcttatcctgggtttgatctggactctgatcctgcactac
tccatctcaatgcccatgtgggaggacgaggacgatgaggacgccaagaagctgaccccc
aagcagaggctgctgggatggatccagaacaaggtgccccagctgcccatcaacaacttt
caccgtgactggagggacggcaaggccctgggagccctggttgacaactgtgccccaggc
ctgtgtcctgactgggagacgtgggatcctagccagcctgtggagaatgccagggaggcc
atgcagcaggctgacgactggctcggagtgccccaggtgatagcccctgaggaaatagtg
gatcccaatgtggacgagcactcggtgatgacctacctgtcccagtttcccaagtccaag
ctgaagcctggtgccccgctgcgctccaagactctgcaccccaagaaggccaaggcctat
ggaccaggtattgcgcccagaggtaacatggtgctgaagccggctgagttcatcgtggag
acagtggaggcggggctaggggaggtgctggtctatgtggaggacccagagggacacaca
gaggaggccagagtgatccccaacaatgacaagaacaggacgtactctgtcatctatctg
cccaaagtggagggccttcacaaggtaacatacttacaggctttcgctgggcaggacata
gacagagtcccttcgtgggtgagtgttccaaagccatgggagaaccccaacaaggggcag
gccaggaggaaaggactggagcctgtaggcaagngggctaacaagcccgaccacttcgac
atctacacagcaggtaacacacacataacactggtcatcgtggactcccagggcagaaga
gacaccgtggagatcattctggaaaacaaggggacagtattttccgttgcaaccatattg
ccctacctggaggtgtctcatnngttactagtgacgtttgctgggcagcagataccanng
aagccctttcaccgtcacatctcagaggccagcaaccccaacgtgtgccgggcctcaggg
agaggtctccagcctaagggggtgagggtgaaagaggtggccgacttcaaggtctacacc
aagggcgccggcagcggagagctcaaggtcaccgtcaaggggccaaagggactagaggag
cctgtgaaggtgcgtgacgtgggagaaggggtgtatgagtgtgactactaccccatcatg
actggcaaatataccatcaccatcacctggggcggacagaccatcccacgcagcccgttc
gaggtggtggtgagtgaggacgtggggccccagaaggtgagggcgtgggggccgggcctg
gagacaggcatggtggggaagtcagctgactttgtggtggaggccatcggcacagaggtg
ggaactctgggtaagtctgacagacggctgttagaagtttcctccatccgagggccctcg
caggctaagatagagtgttatgataaggcgacgggtcatctgaacgtacgttactggccc
agtgacctgggcgactacgctttcaccgtcatctgtgacgacgagacatcaaaggacaac
cctttatggcccacatcctcctccacagcgcaatgattggtttcccctgagaaggtgaag
agctataggcccagtctggaaccgattggctgcttggtcaacaaaccacaattcccattt
gatacaagtagagccgcccagggcnagctgaagatatacgcaccaggatcagagggcttc
cccatagaacatccgagccagagaaccggagacagcaccttcctctgtgtctaccacact
tccaccaagcaccatcaaacacaccatcattatccctggggagaggtcaacagtcccaac
agtcccttcagggtgaccatcggagagggacgccacccagataaagtgaaggtgtacggt
ccaggtgtggagaagtcaggtctgaaggccaacgagcccacctacttcactgtggactgc
tgcgatgcaggacaaggggatgtcagtatcggcatcaagtgtgctcccggcgtggtgggt
ccggcagaggcagacatcgactttgacatcatcaagaacgacaacgacacgttcacagtg
aagtacatgccccccggccccggacgctacaccatcatggtgctgttcgctgaccatgaa
atacccatcagccctttcagaatcaaggtggacccctctcatgacgctaacaaggtgagg
gcggagggacccggactcaacaagacaggtgtggaggtaggtaagcccacccacttcacc
atctacaccaagggagcgggcaaggccaagcctgaagtgcacttcaccggagcagccaaa
ggggatgctgtccgagactttgagatcattgacaaccatgactactcctacaccgtgcgc
tacactgcagtgcagcagagtaacatgtctatctcaatctgccacggcggtgaccccatt
cccaagagccccttcaacatcactgtggcgccgccccttgacctcaacaaggtcaaagtt
caggggttgaacaacaaggtcgacgttgggaaggatcaggagttcacagtgagcacgcac
ggcgtcggtggccagggcaagatagatgtgaagatcacctcgccctctcgtcggccaata
ccctgcaagctggagtctgacacggccaatgaagtgcacactgtgaagtacattccccct
gaggagggcccctacaaagtggacatcagctatgatgggaaccctgtgcctgggagcccc
ttcaccgtggagggggtgatgccccctgacccctcaaaggtgcgtgcctatggcccaggc
ctccaggggggcatggtgggtaagccggcccccttcgccattgacaccaagggtgcgggc
accggcgggctgggcctgaccgtggaggggccatgcgaggccaagatcgagtgccaggac
aacggcgacgggtcctgctctgtctcctacctgcccacagagcccggcgaatacgccatc
aacatcctgtttgccgagcagcacatccccggctcccccttcaaggccatggtacagtct
gtgtttgaccccagtaaggtcacggccagtgggccaggcctggagagagggaaggtcaac
gaggcagggtcgttcgtagtggactgcgccaaggctggggacgccgagctgaccattgag
attatttccgattcggggtcgaaggcggaggtgcatgttcagaacaacagtgatgggacc
tattctatcacgtacatcccacagttccatggcatgtatactatcaccattaaatatggg
ggccacgccgtgcccaagttccccgcccgtgtgcaagtggacccagccgtggataccagc
ggggtgaaggtgtacggaccaggagtggaacccagaggggtcctgagggaggtgaccacc
catttcattgtggatgcccgtgccaagagcaagaccgggggcagccatgtcaaggcccgc
atcgtcaaccctacaggcgccaacacagacgcctacatcactgacaagggggaaggcacc
tatagagtggaatacactgcctatgaggatggcacctgtgaggtgctgtatgatgatgtg
ccggtgcctaacagtccgttccgtgtccccggtaacggagggttgtgccccaccgcgcag
agctacggtccctggctggaggagggcctggtcaacaaacccaaccgcttcactgtggga
acccagggtgcgggtacannggggtcggggtctggcagcgagggtccatcagaggctaag
atgtcgtgtaaggacaataaagatggcagctgcagtgtggagtacatccccttcaccccg
ggagactatgatgtcaacattaccttcggaggcttgcccatcccagggagtcctttccgt
gtgccagtgagagagctggtggacccaagtaaggtgaggtgttcaggcccagggctgggt
agtggagtcagagcccatgttcttcagaccttcactgtggacaccagcaaggctggcctc
gcccctctgggagtggtgctgtacggaccaactggagtggctgagccagtgaacatcaca
gataacggagacggaacacacacagcgacctacaccccggccaaggacggcccgtacacc
gtgtgtgtgaagtacgctgaccaggaggtccctcgcagtccgtataagatcaagacattg
cctgctcatgatgccagtaaggtgcgtgccagtgggccaggtttgaacgcccagggtgtg
cctgccagcctgcccgtggagttcaccatcgatgcccgcgatgctggcgaaggtttgctc
actgtgcagatactggacccagaaggcaagccgaaaaaggccaacatccgtgacaacaga
gatgggacgtacacagtgtcctacgtaccagacatggcagggcgctacaccatcaccatc
aagtatggaggagacgagattccctactcaccctatcgtatccatgccctgcccattgga
gacgccagcaagtgtctggtcacagtttccatcggaggacatggattgggttcaggcctc
ggacccaccatccagatcggcgaggagaccgtcatcaccgtggacgcaaaagctgctggg
aagggaaaggtgacctgtaaggtgtcgacgccagatggggcggagctagacgtggacgtg
gtggagaattccgacggaacttttgacatctactacacggctccggaacctgggaaatac
gtcatcaccatccgctttggaggagaacacattccaaacagccccttccacgtggtggcc
acagaggagcccgtcacccccggcgatatcatggagcctatgctccgccccttcaacctg
gtcattccgttcaccgttcagaagggagagatcacaggtgaggtgcgtatgccctcaggt
aagacagcccgtcctaacatcacagacaacaaggatgggacagtaacagtgaagtacgcc
cctacagagaaaggcctgcacgagatggatatcaaatatgacggaaaccacatcccagga
agtcccctccagttctatgtagatgccattaacagtggtcatgtgacagcctatggtcct
ggtctgagccacggcatggtcaacaaacctgccaccttcaccatcgtcacgaaggatgca
ggggaaggtggtctgtccctggcggtggagggtccctctaaggcagagatcaactgtaag
gataataaggatggaacctgcactgtgtcctaccttcccactgtaccaggagactacaac
atcatcgtcaagtttgacaacaaacacatcgccggcagcccctacactgccaagatcaca
ggagatgacactatgaggacatcccagctcaacgtcggcacggcaacagacgtgtcattg
aagatctcagagacagacctgagcagcctgacagcgagcatcagagcaccgtcgggcaac
gaggaaccctgcctcctcaagagactgcccaatcgacacatcggtatctcattcactcct
aaggaggtaggggagcatgttgtgagcgtgaagaagaacgggacgcacgtgaccaacagc
cccttcaagatcatggtgggccagtcagagatcggcgacgccagcaaggtcaaggtgttt
ggccagggactggtggagggacacatctttgaggtggctgagttcatagttgacaccagg
aacgcaggttatggtggtctgggcctgtctatcgagggtcccagtaaggtggatattaac
tgtgaggatgtggaggatggtacctgtaaggtgacctactgtcctactgaaccaggaaat
tacatcatcaacatcaagttcgccgaccagcacgtcccaggaagtcctttcacggtgaag
gtgtgtggtgagggcagggtgaaggagagcatcactaggaagagacatgctccatccatt
gctactgtgggaagcacctgtgacctcaacctcaaaataccaggtaattggttccagatg
gtgtcggcccaggagcggcatacgcgcacgttcacgcgcagcagtcacacgtacacacgc
acggagcgcacagagattagtaagacacaggcgggggagaccaagcgggaggtgcgcgtg
gaggagagtacccaggtcgggggagaccccttcagggacgtgtttggagagttcctgggt
agtcagagtctcacaggcttcagtgggataccagccactaccagacagcctcaagagggt
gtgtgtgtgacacaagagggtgaccaggggacccaggagatgacggcccaggtgaccagt
ccggggggtaagacggaggacgcagagatcatcgacggcgaggacagcacctacagcgtc
cgcttcatcccccaggagatggggccccacacggtcaacgtcaagtacaggggccagcat
gtccccgggagccccttccagttcaccgtggggcccctgggagagggaggggcacacaag
gtccgggctgggggcacggggctggatagaggagtggcaggagtggcagctgagtttagt
atctggaccagagaggctggtgcaggaggtctgtccatcgctgtagaggggcccagtaag
gcagagatcagctttgaagacaggaaggatggatcctgcggagtggcctatgtggtgcag
gaaccaggtgactatgaggtgtccattaagtttaatgatgagcacatcccagacagtccc
ttcatagtccccatcgccactctgtctgataactcacgccgccttacagtcaccagccta
caggagatggggttgaaggtgggccaggaggcgtcgttcgcggtgcagttgaacggggcg
agggggttgatagatgctaaggttcacaccccgtccggagctgtagaggagtgttatgtt
actgagctggacagcgacaagcacgccatccggtttatcccgagggagaacggagtccac
tccatcgaagtgcgtttcaacgggagccacattcccggtagtcccttcaagatccgtgtg
ggagagatcggacaggtcggagacccgggaatggtgtcagccttcggacctgggctggaa
ggaggaaccacaggcgcggcgtcagattttgtagtgaacacgtgtaatgcggggtcgggt
gctctgtcagtgaccatcgatgggccgtctaaggtcaagatggactgtcaggattgtccc
gagggttacaaggtcacctacacacccatggcccccggcagctatctcatcaccatcaaa
tacggaggaccatcccacatcgtaggcagccccttcaaggctaaagtcacaggtgctcgt
ctctctggtggtcacagtctacatgaaacctcgtccgttcttgtggagacagtaaccaag
acgtcgtcgtcttcgtcgtcgatgggcgtggcctatggccctaagttctcttcggatgcc
agtaaggtggtctcccggggcgccggcctatcaaaggcctttgtagggcagaagaacacc
ttcacagtagactgcagcaaagcaggaactaacatgttgatggtgggggtacacggccca
aagaccccgtgtgaagaggtctacgttaaacacctgggcaacaggatgtacaacgtcacc
tacaccgtcaaagaacagggcaactacatcctcatcgtcaaatggggggatgaaaatgtc
cccggcagccccttccatgtcaccgtcccctaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112222449
Entry
112222449         CDS       T05605                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: filamin-A-like
  KO
K04437  filamin
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04510  Focal adhesion
otw05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112222449
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112222449
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112222449
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:otw04812]
    112222449
   04147 Exosome [BR:otw04147]
    112222449
Cytoskeleton proteins [BR:otw04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     112222449
  Intermediate filaments
   Intermediate filament-binding proteins
    112222449
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112222449
SSDB
Motif
Pfam: Filamin CH Big_3_5 CFSR Y_Y_Y CarboxypepD_reg Invasin_D3
Other DBs
NCBI-GeneID: 112222449
NCBI-ProteinID: XP_024241024
LinkDB
Position
22
AA seq 1593 aa
MSGSHLRQHQSAQPAFNALSPDKEADMPATEKDLAEDAPWKKIQQNTFTRWCNEHLKCVN
KRIANLQTDLGDGLRLIGLLEVLSQKKMFRKYNQRPTFRQMQLENVSVALEFLDKENIKL
VSIDSKAIVDGNLKLILGMVWTLTSHYSISMPMWDEEGGGDGQQKTPKQRLLGWIQNKLP
EIPTXNFSRDWQSGRALGALVDSCAPGLCPDWDQWDQTKPVDNAREAMQQADDWLGIPQV
ITPEEIVDPNVDEHSVMTYLSQFPKSKLKPGAPLRPKLNPKKARAYGPGIEPVGNVVMKK
AMFTVETISAGMGEVLVYVEDPAGHKEEAKVTANNDKNRTYSVFYIPKVTGMHKVTVLFA
GLHINKSPYEVDVGMAQGDSSKATAQGPGLEPAGNIANKTTYFDVYTAGAGVGEVEVVIM
DPAGKKDVVVCQIEDKGNSSYRCTYKPTLEGAHTIYVTFAGGQISKSPFTVNIGEACNPS
LVRAKGRGLQPKGLRVKETADFRVFTKGAGTGELKVTIKGPKGLEEPCKRKDLGDGVFGF
EYYPTTPGTYSITITWGGQHIPRSPLEVKIGLEAGPQKVRAWGPGLESGIVGKSADFVVE
AVGENVGTLGFSVEGPSQAKIECDDKGDGSCDVRYWPMEAGEYAVHVLCNNEDIQHSPFM
AEITAALNKDYYPDKVKAYGPGLQSSGLAVGKPTEFTVDAKLGGNAALNILAQDGEGTPV
DVQVKDNGNGTYTCSYTPKKPLKHTVMASWGGVNIPDSPFRMTIGAGCHPNKVKVSGPGV
AKTGLKAFEPTFFTVDCAEAGQGDISIGIKCSPGVVGPAEADIDFDIIRNDNDTFTVKYT
PPGAGSYTIMVLFADQTIPMTPIRIKVDPSHDASKVKAEGPGLNRSGVELTKPTHFTVNT
KAAGKAKLDAVFSGPAKGEAVKDFEIINNHDNTHTVKYTPIQQGPLGVAVTYGGDSIPKS
PFSIPVAPSLDLSKIQVDGLGDKITVGKDQEVTVKSKGAGGQGKVGAKVTGPSGKPVTCK
VEPGLKPETSQVKFIPREAGPYQVELTYDSAPIPGSPFKPTAYPPTDATKVKCSGPGLER
AKVGETGEFVVDCTNAGPAELTIEIISDSGTEAEVHIQDNGDGTYTITYIPLYPGSYTLT
IRYGGQDVPNFPARLTVEPAVDASGIRVFGPGVEGKGVFREATTDFTVDARALNQTGGNH
IKTVIQNPSGSVTDAVITDRRDGTYNVEYTPYEEGPHSVKVAYDESPVPKSPFRVAVTEG
CDPGRVRAHGPGLDSGITNKANKFTVETRGAGTGGLGLAVEGPSEAKMSCTDNKDGSCSV
EYIPYEAGTYNLNITYGGQPIAGSPFQVPVSDTVDSSKVKCQGVGLGTNVRANIPQAFTV
DASKAGVAPLQVRVQGPKGXVPALYLILELLVPVSNSGFSVWCVGVVEPAELVDNGDQTH
TVNYIPTREGPYSINVLYADQEIPRSPYKVKVLPTHDASKVRASGPGLNTTGVPASLPVE
FTIDAKDAGEGLLAVQITDPEGKPKKASIRDNQDGTYLVSYVPDMTGRYTILIKYGGDEI
PYSPYRIRALPTGDASKCTVTVSIGGHGLGKNT
NT seq 4782 nt   +upstreamnt  +downstreamnt
atgagtggttcccacctccgccaacaccagtcggcccagcctgcattcaacgccctttcc
ccggacaaagaagcagacatgcctgctacagagaaggaccttgccgaggacgcgccgtgg
aagaagatccaacagaacacgttcacccgctggtgtaacgagcatctgaaatgcgtcaac
aaacgaatcgccaatctccagacggacctcggcgacgggctgcggctgatcggactcctg
gaggtgttgagccagaagaagatgttcaggaaatacaaccagcggcccactttccgacag
atgcagctcgagaacgtctcggtggcactcgagttcctagacaaggagaacatcaagctg
gtgtccatagactccaaggccatagtggatggtaacctgaagctgatccttggcatggtg
tggacgctgacctcacactactccatctccatgcccatgtgggacgaggagggagggggt
gacggccagcagaagaccccgaaacagagacttctgggatggatccagaacaagctacca
gagatccccaccnacaacttcagcagagactggcagagtggcagagcactgggggcactg
gtcgacagctgtgctccgggcctgtgccctgattgggaccagtgggaccagactaaacca
gtggacaacgcccgtgaggccatgcaacaggctgatgactggctgggtatccctcaggtg
ataaccccagaggagatcgttgaccctaatgtagatgaacattccgtgatgacatacctg
tcccagttccccaagtccaaactgaagcctggcgcacccctccgccccaaactgaacccc
aagaaggcccgcgcatatggaccaggtatagagccagtaggtaacgttgtgatgaagaag
gcgatgtttacagtggagaccatcagtgctgggatgggagaggtgctggtgtatgtagag
gaccctgccggacacaaagaggaggccaaggtgacagccaacaacgataagaatcgtacc
tactcagtcttctacattcccaaagtcactgggatgcacaaggtgacggtgctgtttgcg
gggctacacatcaataagtctccttatgaggtggatgtggggatggctcagggagacagc
agtaaagctacagcccagggacctggactagaacctgccgggaacatcgccaataagacc
acatactttgatgtctacaccgcaggtgctggtgtgggagaggtggaggtggtgatcatg
gacccagcgggtaagaaggacgtggtggtgtgtcagatagaggataagggcaacagttcg
taccgctgcacctacaaacccaccctggagggggcccacaccatctacgttaccttcgct
ggaggacaaatcagcaagagccccttcactgttaacataggagaagcttgtaaccccagc
ctggttcgggctaaggggcgtggtctgcagcccaaaggcctcagggtgaaggagacggct
gacttcagagtcttcactaaaggagctgggactggagaactcaaagtcaccatcaagggc
cccaagggtttggaggagccctgtaagaggaaggatctaggagacggagtgtttgggttt
gagtactaccccaccacccccggaacatacagtataaccatcacctggggaggacaacac
atcccccgcagcccgttggaggtgaagattggtttggaggcgggtccacagaaggtgcga
gcatgggggcccggcctggagagcggcattgtgggtaaatctgccgacttcgtggtcgaa
gctgttggagagaatgtgggaacactgggtttctcagtggagggtccgtcccaggcgaag
atcgagtgtgatgataagggcgacgggtcatgtgacgtgcggtactggccaatggaagca
ggagagtatgcggtgcatgtgctctgtaacaacgaggacatccagcactctcccttcatg
gctgaaatcactgctgctctaaacaaggactactaccctgataaggtgaaggcgtatggt
ccaggcctacagagcagtggtcttgctgtggggaaacccactgagttcaccgtcgacgcc
aagctgggagggaatgctgccctcaacatcctggcacaggatggtgagggaaccccagta
gatgttcaggtgaaggataacggtaatggaacgtacacctgcagttacacccccaagaaa
cccctcaaacacaccgtcatggcgtcctggggcggggtcaacataccggacagtcccttc
aggatgactatcggagcaggctgccaccctaacaaggtgaaggtgtcaggtcctggtgtg
gctaaaacagggctgaaggcatttgaaccaacattcttcactgtggactgtgctgaggca
ggtcaaggtgacatcagtatcggtataaagtgctctccaggcgtggtgggaccggcggag
gcagacatcgacttcgacatcatcaggaacgacaacgacacgtttaccgttaaatacacc
ccgccaggcgctggtagttacactatcatggtgctgtttgctgaccagaccatccccatg
actcccatcaggatcaaagttgacccgtcacacgacgccagcaaggtcaaggccgaggga
cctggactcaaccgcagtggtgtggagttgaccaagccgacccacttcacagtaaacacc
aaggctgcaggtaaagccaagctggacgctgtgttctccggcccggctaaaggagaggct
gttaaggactttgagatcattaacaaccatgacaacactcacacggtcaagtacaccccc
atccagcaggggcctctgggagtggccgtcacctacggcggagattctattcccaagagc
cccttctccatccctgtggctccaagcctcgacctcagcaagatacaagttgatggactg
ggagacaagataacagtgggtaaggaccaggaagtgaccgtgaagtccaagggagcagga
ggtcaggggaaggtgggagctaaggttacagggccctctgggaaacctgtcacctgcaag
gtggaaccggggcttaaaccagagaccagtcaggtgaagtttatccctcgagaggcgggg
ccataccaggtggagctgacctatgacagcgctcccatcccaggatcccctttcaaaccc
accgcctacccccccactgatgccaccaaggtgaagtgttctggcccagggttggagcgt
gccaaggtgggagagactggggagtttgtggtggactgtaccaatgcaggtccagctgag
ctgaccatagagatcatcagtgacagcgggacagaggcagaggtccacatccaggataat
ggagacggaacctacaccatcacctacatccccctgtaccccggctcctacaccctcacc
atccgctacggggggcaggatgtacccaacttccccgcccgcctcacagtggagccggcc
gtcgacgccagtggaatccgcgtgttcggaccgggagtggagggcaaaggcgtgttccgc
gaggcgaccacagatttcacggtagacgccagagctctgaaccagacgggagggaaccac
atcaagacagtgatccagaacccatctggctccgttaccgacgcggtcatcaccgaccgc
cgtgatggcacctacaacgtagagtacactccctacgaagagggtccccacagtgtaaag
gtggcgtacgatgagtctccagttcccaaaagtccgttccgcgtggcagtgacagagggt
tgtgacccggggcgtgtacgtgcacatggacccggcttggacagtggcatcaccaacaaa
gccaacaagttcactgtggaaacccgtggtgcgggtacaggtggtctgggtctggctgta
gagggcccatccgaggctaagatgtcctgcaccgacaacaaagatggcagctgcagcgta
gagtacattccctacgaggctggaacgtataatctcaacatcacctacggagggcagccc
atcgctggcagtccattccaggttcctgtcagtgacacggtggacagttctaaggtgaag
tgccagggggtggggcttggaaccaacgtgcgtgccaacattccacaggccttcacagtg
gacgcctctaaagcaggagtcgcccctctccaagtcagagtacagggacccaaaggtngt
gtgccagccctttatttgattctagaacttttggttcctgtgtccaactctggtttctct
gtgtggtgtgtaggtgtagtggagccagcagagttggtggataatggagaccagactcac
accgtgaactacatcccgaccagagagggaccttactctatcaatgtactgtatgctgac
caagagatcccacgcagtccctacaaggtgaaagtgttgcctacccatgatgccagcaag
gtgcgcgccagtggccccggtctcaacaccaccggagtgcccgcctctctgcctgtcgag
ttcaccatcgacgccaaggatgcaggagaggggctgctcgccgtgcagatcactgacccc
gaggggaagcctaagaaggccagtatccgtgacaaccaggatgggacttacctggtgtct
tatgtacctgacatgactggtcgttacaccatcctgataaagtatggaggggacgagata
ccttattccccctaccgcatcagggctctacctactggggacgccagcaaatgtactgtc
acagtgtcaatcggcggccacggcctgggtaagaacacttag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112232341
Entry
112232341         CDS       T05605                                 

Definition
(RefSeq) filamin-C-like
  KO
K04437  filamin
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04510  Focal adhesion
otw05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112232341
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112232341
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112232341
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:otw04812]
    112232341
   04147 Exosome [BR:otw04147]
    112232341
Cytoskeleton proteins [BR:otw04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     112232341
  Intermediate filaments
   Intermediate filament-binding proteins
    112232341
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112232341
SSDB
Motif
Pfam: Filamin CH Big_3_5 Y_Y_Y
Other DBs
NCBI-GeneID: 112232341
NCBI-ProteinID: XP_024255092
LinkDB
Position
Unknown
AA seq 2702 aa
MSSNNAHYYDHSHPPQYYQGTDTSEGDKEDEMPATEKDLAEDAPWKKIQQNTFTRWCNEH
LKCINKSITDLQKDVGDGLKLIGLLEVLSQKKMYRKHHNRPNFRQMKLENVSVALEFLDG
EHIKLVSIDSKAIVDGNLKLILGLIWTLILHYSISMPMWEDEDDEEAKELTPKQRLLGWI
RNKVPELPINNFHRDWRDGKALGALVDNCAPGLCPDWQAWDPNQPVENAREAMQQADDWL
GVPQVINPEEIVDPEVDEQSMMTYLSQFPKSKLRPGAPLKPKGVQLYPKKAKFYGPGIEA
NGNMVLKPAVFTVETLEAGQAEVLVYVNDPEGHTEEAKVVFNNDKNRTHTVIYIPKVEGA
HKVKVLFAGQDVDKSPYTVNVDKAIGDPNKVQARGPGLEATGNMANKPTYFYIYTAGAGN
GDVSVVIVDPEGKKDTVKLILENKGDSVFRCTYRPMLEGPHTIHILFAGQEILKSPFKVQ
ITEAINADTCRATGRGLQAKGVRVKEVADFKVFTKGAGNGELKVSVTGPCGDEEPVKVKD
IGGVYECEYLPNQTGKYTVNITWGGQPIPHSPFDVEVSEVAGPQKVRAWGPGLLTGRVGK
SADFVVEAVGTEVGTLGFSIEGPSQAKIECDDKGDGSCDVRYWPTRPDYYAVHVICDDED
IKGSPFMAHILSATNDCFPDKVKAFGPGLEPIGVIVNKPAEFTIDARGAGKGHLKIYAKD
TESVTIDIKITDKGDGTFLCVYVPIKPIKHTIIITWGDVKVPNSHFRVIVGEGCHPDKVK
VYGPGVEKTGLKANEPNFFTVDCAEAGQGDISIGIKCAPGVVGPAEADINFDIIKNDNDT
FTVKYTPPGAGKYTIMVLFAEQEIPISPFRVKVNRSHDAGNVRAEGPGLNKTGVEAGTPT
HFTIFTKGAGKAKPKVQFTAAELKGEAVRDFEIIDNHDYSYTVKYTAVHQGQMTISVTHG
GDPIPKSPFNITVAPPVDLGKVKVTGLDTKVEVGKDQEFYINTQGAGGQGEVAVKMTSPS
GRPIPYKLDSDTANGAHSVKYIPPEEGPYKVDVSYDCNPVPGSPFAVEGVMPADPSKVRA
YGPGLKGGIVGKPAPFAIDTNGAGPGGLGLTVEGSCKAKIECQDNGHSTCLPTEAGEYAI
NILFGKQHIPGSPFKAAVKPCLDPSQVTASGPGLDKAKAGEPAYFTVDCTSAGEAKLTIE
IVSESGAESEVHIQKTAEGSFSVTYIPPFHGTHTITIKYGGHVVPNFPALIQVEPAVDTG
GVQVYGPGVQPRGVIKEVTTHFIVDARKMPKTSGDHLNACIINPSGTNTDTYITNKGDGT
FRVEYTAYEDGMHVIEVLYDEVAIPKSPFRVSVVEGCDPTRVRAYGPGLEGGLINTPNCF
TVETRGAGTGGLGLTIEGASEAKITCKDNKDGSCSVEYVTFTPGEYDVNINFGGHPIPGS
PFRVPVWDPSKVKCSGQGLGDRVRAHLPQTFTVDTIQAGQANLEVSLIGPSGSEPVAVKN
NSDGTHTVNYTPVHDGPYTVSVKYGDQEVPRSPFKVRSQPGHDASKVCASGPGLDKSGVP
ASLPVEFTIDARDAGEGLLTVQILDQECKPKKATIYDNRDGTYTVSYVPDSTGPYTIMIK
YGGDEIPYSPYHILALPTGDASKCLLTVFIGGHALASGLTKMQVNEEAIISVDTKAAGKG
KVTCSVMTPEGVELDMDVQENRDGTVDIYYTAPEPGKYVITIRFGGGHIPKSPFHVTATK
EPIVLSDGMDQFRPLNLVIPFTVQQGPITGEVRMPYGKTAHPYIINDNDGTITVKFNPTE
KGLHEMDIKYEGNHIPGSPLQFYVDAMNSGLVTAHGPGLCQGSINKPVTFIVVTKNAGEG
GLSLAVEGPSKAKITCKDNKDGTCTVSYLPTSPGDYKIIVKSDNKHIAGSPFTAKITGDD
SIRTSQLNVGTAADLSLKITESDLSLLTANIRAPSGNEEPCLLKRLPSRYIGISFTPKEV
GEHEVSVKKNGKHVTNSPFKIQVGQSDIGEASRVKAFGKGLVEAHTFKMAEFFVDTRDAG
YGGLGLSIEGPSKVDINCEVVEDGTCRVSYCPTELGNHIINIKFSDKHIPGSPFTVKVTG
EGRMKESITRKRTAPAIASVGSACGLNLKIPGNWFQMVSAQERMTRTFTRSSHTYTRKER
TEISKMRGGETKREVRVEESTQAGGTGGASPFKDVFGEFLGRESLASFAGIPATVTPGET
TTKGSMMAQVTSPGGKTEQAEIIDGGDSTYSVRFVPQEMGAHTVNVKYSGQHVPGSPFQF
TVGPLGEGGSHKVRAGGTGLERGVAGAPTEFSIWTREAGAGGLSIAVEGPSKAEISFEDR
KDGSCRVVYIVQDPGDYEVSIKFNNEHIPDSPFVVPIATLSDEACRLTVTSLQEKDLKVN
QEASFAVQCNGARGVVDAKVHTPSGSAEECYITDLDSDKNAIRFIPRENGVHSIDVKFNG
SHIPGSPFNVRVGEAGQAGDPGMVTVYGPGLDGGSTGVASEFVVNTCNAGSGALSVTIDG
PSKVKMDCSDCLDGYKVIYRPMAPGNYLITIKYGGPNHIVGSPFKAKVTGTRLSGGHSLH
ETSSVLVQTITKTSKVAGAYSTSFSSKLTSDASKVVCRGGGLTKALVGQKNVFNVDCSKA
GTNMLLVGVHGPRTPCEKVYVKHMGNRLYNVTYTVKDKDNYTIFVKWGDDSVPGSPFKVA
VP
NT seq 8109 nt   +upstreamnt  +downstreamnt
atgtcaagcaataatgcacattactatgaccacagccatccaccacagtactaccagggc
actgacacctctgaaggggacaaggaagacgagatgccggctacagagaaggaccttgcc
gaggatgcaccatggaagaaaatacaacagaatacttttaccaggtggtgcaatgagcac
ctcaagtgcatcaacaagagcatcactgacttacagaaggatgttggcgacggtttaaag
ctgatcgggctcctagaagttctgagtcagaagaagatgtacagaaagcatcacaataga
cccaacttcagacagatgaaactggaaaatgtgtcggtggcccttgaattcttggacggg
gaacacatcaagttggtgtctattgactccaaggccatcgtggatgggaacctgaagttg
atcctgggtctgatctggactctgatcttgcactactccatctccatgcccatgtgggag
gacgaggatgatgaggaggccaaggaactgaccccgaagcagaggctgcttggctggatc
cggaacaaggtgcctgagctgcccatcaacaacttccaccgtgactggagggacggcaag
gccctaggagccctggtagacaactgtgcccctggtctgtgccctgactggcaggcctgg
gaccctaatcagcctgtggagaatgccagagaggcyatgcagcaggctgacgactggctg
ggcgttccccaggtgatcaaccctgaggagattgtagatccggaagtggatgaacagtcc
atgatgacttacctgtcccagttccccaagtctaaactgaggcctggcgctcccctcaaa
cctaaaggggttcagctgtaccccaaaaaagccaagttttacggaccaggtattgaggca
aatggtaacatggttctgaagccagcagtgttcacagtggaaactctagaggcaggtcag
gctgaggtgctggtgtatgtcaatgatcctgagggacacactgaggaggctaaggtggtc
ttcaacaacgacaagaacaggacccacaccgttatttacatccccaaggttgagggcgcc
cacaaggtgaaagtgctatttgctgggcaggatgttgataagagcccctacacagtgaac
gtggacaaggccataggtgatcccaacaaggtccaggccagaggaccagggctggaagct
accggcaacatggccaacaaacccacctacttttacatctacactgcaggtgctggtaac
ggtgatgtgagcgttgtcatcgtggaccctgaggggaagaaagacacggtgaaactgatc
ttggaaaacaagggggacagtgttttccgttgcacctaccggcccatgttggaaggcccc
cacaccatccatatcctgtttgccggtcaggagatccttaagagccccttcaaggttcaa
atcacagaggccatcaatgctgacacgtgtcgtgccacaggaagaggccttcaggcaaaa
ggggtgcgggtcaaggaggtggcagacttcaaggtcttcaccaagggagctggcaacgga
gagctcaaggtctcagtgactggaccatgtggagatgaggagccagtgaaagtaaaagat
attggtggtgtctatgaatgtgaatatcttcctaaccagactggtaaatacaccgtcaac
atcacctggggaggacagcctatcccacacagccccttcgatgtggaggtgagtgaggtg
gcaggccctcagaaggtgagagcctggggtcctggtctgttgaccggccgggtgggcaag
tcggctgacttcgtggtggaggccgtcggcacggaagtgggaactctgggcttctctatc
gagggtccatcccaggctaagatagagtgtgatgataaaggtgacggctcctgcgatgtc
cgctattggcccactaggccagattactatgctgtccatgtcatatgtgatgacgaagac
atcaagggcagccccttcatggcccacatcctctctgcaaccaatgactgcttccctgat
aaggtgaaagctttcggtccaggcctggagcccataggggtcatcgtaaacaaaccagca
gagttcacgatcgatgcccgcggggctggcaaaggccatctgaagatctacgccaaggat
acagagagcgtcaccatcgacattaagataactgataagggagacgggaccttcttgtgt
gtgtacgttcccatcaagcccatcaaacacaccatcatcatcacctggggagatgtcaaa
gtgcccaacagccacttcagggtgattgttggagagggctgccacccagacaaggtcaag
gtgtatggtccaggagtggagaagacaggactcaaggcaaacgagcccaacttcttcact
gtggactgcgcagaggctggacaaggagacatcagtattgggatcaagtgtgctccagga
gtggtgggtccagctgaggctgacatcaactttgacattatcaagaacgacaatgacacc
ttcactgtcaagtacaccccccccggtgcagggaaatacaccatcatggtgttgttcgct
gaacaggaaatccccattagtccatttagggtgaaggtgaatcgttcccatgatgctggc
aatgtgagggctgagggtccaggactcaacaagacaggcgtggaggcgggcactccgacc
cacttcaccatcttcacaaagggagcaggcaaggccaagccaaaggtccagttcacagca
gcagaactgaagggagaggctgtcagggactttgagatcatagacaaccatgactactcc
tacaccgttaagtacaccgctgttcatcagggtcagatgaccatctccgtcacccatgga
ggggaccccattccaaagagccccttcaatattactgtggctcctcctgtagatctggga
aaggtcaaggttacaggactggacaccaaggtggaagttggcaaggatcaagagttctac
atcaacacccagggagccggaggacagggcgaggtggctgtcaagatgacctcaccctct
ggccgaccaatcccttacaagctggattcggacacagccaatggagcccactcggtgaag
tacatccccccagaggaggggccttacaaggtggacgtcagctatgactgcaaccccgtc
cctggatcccccttcgctgtggagggagtgatgcctgctgacccatcaaaggtgcgtgca
tacggcccaggcctgaagggaggcattgtgggtaaaccagccccctttgccattgacacc
aatggagcgggccccggcgggctgggcctgactgtggaggggtcgtgcaaggctaagatc
gagtgccaggacaatggacacagtacctgcctgcctaccgaggctggagagtatgccatc
aatatcctgtttggaaagcagcacatccctgggtctcctttcaaggcagctgttaagcca
tgcctggaccccagccaggtaaccgccagtggtccaggcctagataaagccaaggcaggg
gaaccagcctactttacagtggactgcaccagtgccggagaggctaagctcaccatcgag
attgtctctgagtccggggctgagtccgaggtccacatccagaagacagccgagggatcc
ttctctgtcacctacatcccaccttttcacggcacacacaccatcaccattaagtacggg
ggtcatgtggttcccaacttccctgcgctcatccaagtggagccggctgttgataccggc
ggagtgcaggtctatggaccaggagtgcagcccagaggtgtcatcaaggaggttaccact
cacttcattgtggatgcccgcaaaatgcccaagacctctggtgaccacttgaatgcatgc
atcatcaacccttcaggcaccaacacagacacctacatcacaaacaagggagacggaacc
ttcagagtggaatacaccgcctatgaggacggtatgcatgtgattgaggtactgtatgac
gaggtggccatccctaagagccccttcagggtgtcagtagtggagggatgtgaccccacc
cgggtcagggcctacgggccagggctcgagggaggactcatcaacacacccaactgcttc
accgtcgagaccaggggtgctggtactggaggcctgggcctgaccatagagggagcgtca
gaggcaaaaattacctgtaaagataacaaagatggcagctgcagcgtagagtacgttacc
ttcacacctggagagtacgacgtcaatatcaacttcggaggacaccccattccaggcagt
ccgttccgcgtgccagtgtgggatcccagtaaggtgaaatgttcaggccaaggtttgggt
gacagagtcagagcccacctacctcagacctttactgtggacactatacaggcaggacag
gcaaatctggaggtcagtctcataggaccatcaggttcagagcctgttgctgtaaaaaat
aacagtgatggtacacacacagtcaactacactccagttcatgatggcccttacactgtg
tcagttaaatatggagaccaggaggttcctcgcagtccattcaaggtgagatctcagcct
ggtcatgatgccagtaaggtttgtgcaagcggtccaggtctggacaagtcaggtgtgccc
gccagcctgccagtggagttcaccattgatgcccgcgacgcaggagagggactgctcact
gtacaaatactggaccaagaatgcaagccaaagaaggctaccatctatgataacagagat
gggacctacacagtgtcttacgtaccagactccaccggcccttacacaatcatgatcaag
tatggaggcgatgagatcccctactctccctaccatatcttagccctgcccactggagat
gccagcaagtgtctgcttactgtgtttatcggaggacatgccctggcatcaggtctgact
aagatgcaggtgaacgaggaggccatcatctctgtggacacaaaggccgctgggaagggc
aaggtgacctgctcggtcatgaccccagagggggtggagctagacatggatgtgcaggaa
aaccgtgatggaaccgtcgacatctactacaccgctccagaaccaggaaaatatgtcatc
accatccgcttcggaggagggcacatacccaagagccccttccatgttacggcaacaaag
gagcccattgtccttagtgacggcatggatcagttccgccctctcaacctggtcatcccg
ttcactgtacagcagggaccaatcacaggtgaggtgcgtatgccctacggtaagactgcc
catccctacataataaatgacaatgatgggaccatcacagttaaattcaaccctactgaa
aagggtctgcacgagatggacatcaagtatgaaggaaatcacatcccaggaagccccctc
cagttttatgtggatgctatgaacagtggtctggtgacagcacacggccctggtctctgt
caagggtccatcaacaaacctgtcactttcattgtggtcaccaagaatgctggagaaggt
ggtctgtccctagcggtggagggtccttctaaggcaaagatcacctgtaaagacaataag
gatggaacctgtactgtatcctacctgcccacctcaccaggagactacaagatcattgtc
aagtctgacaacaaacacattgccggcagccccttcactgctaaaatcactggtgatgac
tctatcaggacatcccagctcaacgtggggacagcagcagacttgtcactgaagatcaca
gagtctgacctgagtctgctgacggctaatatcagagctccatcaggcaacgaagagccg
tgtttgctcaagagactgcccagcagatacataggtatctccttcactcctaaggaggtg
ggagagcacgaggtgagcgtgaagaagaacggtaagcacgtgaccaacagccctttcaag
atccaggttggccagtcagatattggcgaggccagtagggtcaaggcctttggtaaagga
ctggtggaggcacacaccttcaaaatggctgagttctttgtggacactagggatgcaggt
tatggtggtctggggttgtcgatcgagggtccgagtaaagtggatattaactgtgaggtt
gtggaggatgggacgtgcagagtcagttactgccccacagagctaggcaaccacatcatc
aacatcaagttttctgacaagcacatcccaggaagtcctttcacagtgaaggtgacagga
gaaggaaggatgaaggagagcatcaccaggaagagaactgcccccgccatcgcttctgtc
ggcagcgcctgtggactcaacctcaaaatccctggaaactggttccagatggtgtcagcc
caggagaggatgacgcgcacattcacacgcagtagccacacgtacacacgcaaggagcgc
acggagatcagcaagatgcggggcggcgagacgaagagggaggtgagggtcgaagagagc
acccaggcgggaggaacaggaggagccagtccattcaaagatgtttttggagagttcctg
ggcagagagagtctggctagcttcgctgggatacccgctacagtcacaccaggtgaaacc
actaccaagggtagtatgatggcccaggttaccagccctgggggtaaaacagaacaggca
gagatcatagatggaggggacagcacctacagtgtccgcttcgtgccccaggagatgggg
gcccacacggtcaatgtgaagtacagcgggcagcacgtcccaggtagtcccttccagttt
acagtgggaccactgggagaaggagggtcccacaaggttcgggccggaggcactgggctg
gagagaggagtggcaggagcaccaactgaatttagtatctggacgcgggaggccggtgca
ggcggtctgtccatcgctgtagaggggcccagtaaggctgagatctcctttgaagacagg
aaggatggatcctgtagggtggtctacattgtacaggatccaggtgactatgaagtgtca
atcaagttcaacaacgagcacatccccgacagcccctttgttgttcccatagcaacgctg
tctgatgaggcatgccgactcactgtcaccagcctgcaggagaaggacctaaaggtgaac
caggaagcgtcgttcgctgtacagtgtaacggggcaaggggcgtggttgatgctaaggtc
cataccccctccggctcagcagaggagtgctacatcacagacctggacagtgacaagaac
gccatccgcttcattccccgtgagaatggcgtgcactccatcgacgtcaagttcaatggc
agccacatccctggaagtccgttcaatgtgagggtgggggaggccggacaggctggagac
ccaggcatggtgacagtttatgggcctggactggatggagggtccacaggtgtagcctca
gagtttgtagtgaacacctgtaacgcggggtcgggtgccctgtccgtgaccatcgacggt
ccctctaaggtgaagatggactgttccgattgccttgatggctacaaggtcatctacaga
cccatggcccctggcaactatctcatcaccatcaaatatggaggacccaaccatatagtg
ggcagcccattcaaagccaaagtcacaggtacccgtctgtctggtggtcacagccttcac
gagacgtcctcggtcctggtacagacgattactaagacgtccaaggtagcaggagcgtac
agtacctcgttttcctcaaaactgacctctgacgccagcaaggtggtgtgtcgaggcggc
gggctcaccaaggctctggtcggacagaagaatgtattcaatgtggactgcagcaaagca
ggtactaacatgttactggtgggagtgcacggtcccaggacgccctgtgaaaaggtgtac
gttaaacacatgggcaaccgcctgtacaacgtcacctacactgtcaaagacaaggacaac
tacaccattttcgtcaagtggggggatgacagtgttcctggcagcccctttaaagtagct
gtgccctga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112232475
Entry
112232475         CDS       T05605                                 

Definition
(RefSeq) filamin-C-like
  KO
K04437  filamin
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04510  Focal adhesion
otw05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112232475
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112232475
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112232475
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:otw04812]
    112232475
   04147 Exosome [BR:otw04147]
    112232475
Cytoskeleton proteins [BR:otw04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     112232475
  Intermediate filaments
   Intermediate filament-binding proteins
    112232475
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112232475
SSDB
Motif
Pfam: Filamin CH Big_3_5 Y_Y_Y
Other DBs
NCBI-GeneID: 112232475
NCBI-ProteinID: XP_024255255
LinkDB
Position
Unknown
AA seq 2702 aa
MSSNNAHYYDHSHPPQYYQGTDTSEGDKEDEMPATEKDLAEDAPWKKIQQNTFTRWCNEH
LKCINKSITDLQKDVGDGLKLIGLLEVLSQKKMYRKHHNRPNFRQMKLENVSVALEFLDG
EHIKLVSIDSKAIVDGNLKLILGLIWTLILHYSISMPMWEDEDDEEAKELTPKQRLLGWI
RNKVPELPINNFHRDWRDGKALGALVDNCAPGLCPDWQAWDPNQPVENAREAMQQADDWL
GVPQVINPEEIVDPEVDEQSMMTYLSQFPKSKLRPGAPLKPKGVQLYPKKAKFYGPGIEA
NGNMVLKPAVFTVETLEAGQAEVLVYVNDPEGHTEEAKVVFNNDKNRTHTVIYIPKVEGA
HKVKVLFAGQDVDKSPYTVNVDKAIGDPNKVQARGPGLEATGNMANKPTYFYIYTAGAGN
GDVSVVIVDPEGKKDTVKLILENKGDSVFRCTYRPMLEGPHTIHILFAGQEILKSPFKVQ
ITEAINADTCRATGRGLQAKGVRVKEVADFKVFTKGAGNGELKVSVTGPCGDEEPVKVKD
IGGVYECEYLPNQTGKYTVNITWGGQPIPHSPFDVEVSEVAGPQKVRAWGPGLLTGRVGK
SADFVVEAVGTEVGTLGFSIEGPSQAKIECDDKGDGSCDVRYWPTRPDYYAVHVICDDED
IKGSPFMAHILSATNDCFPDKVKAFGPGLEPIGVIVNKPAEFTIDARGAGKGHLKIYAKD
TESVTIDIKITDKGDGTFLCVYVPIKPIKHTIIITWGDVKVPNSHFRVIVGEGCHPDKVK
VYGPGVEKTGLKANEPNFFTVDCAEAGQGDISIGIKCAPGVVGPAEADINFDIIKNDNDT
FTVKYTPPGAGKYTIMVLFAEQEIPISPFRVKVNRSHDAGNVRAEGPGLNKTGVEAGTPT
HFTIFTKGAGKAKPKVQFTAAELKGEAVRDFEIIDNHDYSYTVKYTAVHQGQMTISVTHG
GDPIPKSPFNITVAPPVDLGKVKVTGLDTKVEVGKDQEFYINTQGAGGQGEVAVKMTSPS
GRPIPYKLDSDTANGAHSVKYIPPEEGPYKVDVSYDCNPVPGSPFAVEGVMPADPSKVRA
YGPGLKGGIVGKPAPFAIDTNGAGPGGLGLTVEGSCKAKIECQDNGHSTCLPTEAGEYAI
NILFGKQHIPGSPFKAAVKPCLDPSQVTASGPGLDKAKAGEPAYFTVDCTSAGEAKLTIE
IVSESGAESEVHIQKTAEGSFSVTYIPPFHGTHTITIKYGGHVVPNFPALIQVEPAVDTG
GVQVYGPGVQPRGVIKEVTTHFIVDARKMPKTSGDHLNACIINPSGTNTDTYITNKGDGT
FRVEYTAYEDGMHVIEVLYDEVAIPKSPFRVSVVEGCDPTRVRAYGPGLEGGLINTPNCF
TVETRGAGTGGLGLTIEGASEAKITCKDNKDGSCSVEYVTFTPGEYDVNINFGGHPIPGS
PFRVPVWDPSKVKCSGQGLGDRVRAHLPQTFTVDTIQAGQANLEVSLIGPSGSEPVAVKN
NSDGTHTVNYTPVHDGPYTVSVKYGDQEVPRSPFKVRSQPGHDASKVCASGPGLDKSGVP
ASLPVEFTIDARDAGEGLLTVQILDQECKPKKATIYDNRDGTYTVSYVPDSTGPYTIMIK
YGGDEIPYSPYHILALPTGDASKCLLTVFIGGHALASGLTKMQVNEEAIISVDTKAAGKG
KVTCSVMTPEGVELDMDVQENRDGTVDIYYTAPEPGKYVITIRFGGGHIPKSPFHVTATK
EPIVLSDGMDQFRPLNLVIPFTVQQGPITGEVRMPYGKTAHPYIINDNDGTITVKFNPTE
KGLHEMDIKYEGNHIPGSPLQFYVDAMNSGLVTAHGPGLCQGSINKPVTFIVVTKNAGEG
GLSLAVEGPSKAKITCKDNKDGTCTVSYLPTSPGDYKIIVKSDNKHIAGSPFTAKITGDD
SIRTSQLNVGTAADLSLKITESDLSLLTANIRAPSGNEEPCLLKRLPSRYIGISFTPKEV
GEHEVSVKKNGKHVTNSPFKIQVGQSDIGEASRVKAFGKGLVEAHTFKMAEFFVDTRDAG
YGGLGLSIEGPSKVDINCEVVEDGTCRVSYCPTELGNHIINIKFSDKHIPGSPFTVKVTG
EGRMKESITRKRTAPAIASVGSACGLNLKIPGNWFQMVSAQERMTRTFTRSSHTYTRKER
TEISKMRGGETKREVRVEESTQAGGTGGASPFKDVFGEFLGRESLASFAGIPATVTPGET
TTKGSMMAQVTSPGGKTEQAEIIDGGDSTYSVRFVPQEMGAHTVNVKYSGQHVPGSPFQF
TVGPLGEGGSHKVRAGGTGLERGVAGAPTEFSIWTREAGAGGLSIAVEGPSKAEISFEDR
KDGSCRVVYIVQDPGDYEVSIKFNNEHIPDSPFVVPIATLSDEACRLTVTSLQEKDLKVN
QEASFAVQCNGARGVVDAKVHTPSGSAEECYITDLDSDKNAIRFIPRENGVHSIDVKFNG
SHIPGSPFNVRVGEAGQAGDPGMVTVYGPGLDGGSTGVASEFVVNTCNAGSGALSVTIDG
PSKVKMDCSDCLDGYKVIYRPMAPGNYLITIKYGGPNHIVGSPFKAKVTGTRLSGGHSLH
ETSSVLVQTITKTSKVAGAYSTSFSSKLTSDASKVVCRGGGLTKALVGQKNVFNVDCSKA
GTNMLLVGVHGPRTPCEKVYVKHMGNRLYNVTYTVKDKDNYTIFVKWGDDSVPGSPFKVA
VP
NT seq 8109 nt   +upstreamnt  +downstreamnt
atgtcaagcaataatgcacattactatgaccacagccatccaccacagtactaccagggc
actgacacctctgaaggggacaaggaagacgagatgccggctacagagaaggaccttgcc
gaggatgcaccatggaagaaaatacaacagaatacttttaccaggtggtgcaatgagcac
ctcaagtgcatcaacaagagcatcactgacttacagaaggatgttggcgacggtttaaag
ctgatcgggctcctagaagttctgagtcagaagaagatgtacagaaagcatcacaataga
cccaacttcagacagatgaaactggaaaatgtgtcggtggcccttgaattcttggacggg
gaacacatcaagttggtgtctattgactccaaggccatcgtggatgggaacctgaagttg
atcctgggtctgatctggactctgatcttgcactactccatctccatgcccatgtgggag
gacgaggatgatgaggaggccaaggaactgaccccgaagcagaggctgcttggctggatc
cggaacaaggtgcctgagctgcccatcaacaacttccaccgtgactggagggacggcaag
gccctaggagccctggtagacaactgtgcccctggtctgtgccctgactggcaggcctgg
gaccctaatcagcctgtggagaatgccagagaggcratgcagcaggctgacgactggctg
ggcgttccccaggtgatcaaccctgaggagattgtagatccggaagtggatgaacagtcc
atgatgacttacctgtcccagttccccaagtctaaactgaggcctggcgctcccctcaaa
cctaaaggggttcagctgtaccccaaaaaagccaagttttacggaccaggtattgaggca
aatggtaacatggttctgaagccagcagtgttcacagtggaaactctagaggcaggtcag
gctgaggtgctggtgtatgtcaatgatcctgagggacacactgaggaggctaaggtggtc
ttcaacaacgacaagaacaggacccacaccgttatttacatccccaaggttgagggcgcc
cacaaggtgaaagtgctatttgctgggcaggatgttgataagagcccctacacagtgaac
gtggacaaggccataggtgatcccaacaaggtccaggccagaggaccagggctggaagct
accggcaacatggccaacaaacccacctacttttacatctacactgcaggtgctggtaac
ggtgatgtgagcgttgtcatcgtggaccctgaggggaagaaagacacggtgaaactgatc
ttggaaaacaagggggacagtgttttccgttgcacctaccggcccatgttggaaggcccc
cacaccatccatatcctgtttgccggtcaggagatccttaagagccccttcaaggttcaa
atcacagaggccatcaatgctgacacgtgtcgtgccacaggaagaggccttcaggcaaaa
ggggtgcgggtcaaggaggtggcagacttcaaggtcttcaccaagggagctggcaacgga
gagctcaaggtctcagtgactggaccatgtggagatgaggagccagtgaaagtaaaagat
attggtggtgtctatgaatgtgaatatcttcctaaccagactggtaaatacaccgtcaac
atcacctggggaggacagcctatcccacacagccccttcgatgtggaggtgagtgaggtg
gcaggccctcagaaggtgagagcctggggtcctggtctgttgaccggccgggtgggcaag
tcggctgacttcgtggtggaggccgtcggcacggaagtgggaactctgggcttctctatc
gagggtccatcccaggctaagatagagtgtgatgataaaggtgacggctcctgcgatgtc
cgctattggcccactaggccagattactatgctgtccatgtcatatgtgatgacgaagac
atcaagggcagccccttcatggcccacatcctctctgcaaccaatgactgcttccctgat
aaggtgaaagctttcggtccaggcctggagcccataggggtcatcgtaaacaaaccagca
gagttcacgatcgatgcccgcggggctggcaaaggccatctgaagatctacgccaaggat
acagagagcgtcaccatcgacattaagataactgataagggagacgggaccttcttgtgt
gtgtacgttcccatcaagcccatcaaacacaccatcatcatcacctggggagatgtcaaa
gtgcccaacagccacttcagggtgattgttggagagggctgccacccagacaaggtcaag
gtgtatggtccaggagtggagaagacaggactcaaggcaaacgagcccaacttcttcact
gtggactgcgcagaggctggacaaggagacatcagtattgggatcaagtgtgctccagga
gtggtgggtccagctgaggctgacatcaactttgacattatcaagaacgacaatgacacc
ttcactgtcaagtacaccccccccggtgcagggaaatacaccatcatggtgttgttcgct
gaacaggaaatccccattagtccatttagggtgaaggtgaatcgttcccatgatgctggc
aatgtgagggctgagggtccaggactcaacaagacaggcgtggaggcgggcactccgacc
cacttcaccatcttcacaaagggagcaggcaaggccaagccaaaggtccagttcacagca
gcagaactgaagggagaggctgtcagggactttgagatcatagacaaccatgactactcc
tacaccgttaagtacaccgctgttcatcagggtcagatgaccatctccgtcacccatgga
ggggaccccattccaaagagccccttcaatattactgtggctcctcctgtagatctggga
aaggtcaaggttacaggactggacaccaaggtggaagttggcaaggatcaagagttctac
atcaacacccagggagccggaggacagggcgaggtggctgtcaagatgacctcaccctct
ggccgaccaatcccttacaagctggattcggacacagccaatggagcccactcggtgaag
tacatccccccagaggaggggccttacaaggtggacgtcagctatgactgcaaccccgtc
cctggatcccccttcgctgtggagggagtgatgcctgctgacccatcaaaggtgcgtgca
tacggcccaggcctgaagggaggcattgtgggtaaaccagccccctttgccattgacacc
aatggagcgggccccggcgggctgggcctgactgtggaggggtcgtgcaaggctaagatc
gagtgccaggacaatggacacagtacctgcctgcctaccgaggctggagagtatgccatc
aatatcctgtttggaaagcagcacatccctgggtctcctttcaaggcagctgttaagcca
tgcctggaccccagccaggtaaccgccagtggtccaggcctagataaagccaaggcaggg
gaaccagcctactttacagtggactgcaccagtgccggagaggctaagctcaccatcgag
attgtctctgagtccggggctgagtccgaggtccacatccagaagacagccgagggatcc
ttctctgtcacctacatcccaccttttcacggcacacacaccatcaccattaagtacggg
ggtcatgtggttcccaacttccctgcgctcatccaagtggagccggctgttgataccggc
ggagtgcaggtctatggaccaggagtgcagcccagaggtgtcatcaaggaggttaccact
cacttcattgtggatgcccgcaaaatgcccaagacctctggtgaccacttgaatgcatgc
atcatcaacccttcaggcaccaacacagacacctacatcacaaacaagggagacggaacc
ttcagagtggaatacaccgcctatgaggacggtatgcatgtgattgaggtactgtatgac
gaggtggccatccctaagagccccttcagggtgtcagtagtggagggatgtgaccccacc
cgggtcagggcctacgggccagggctcgagggaggactcatcaacacacccaactgcttc
accgtcgagaccaggggtgctggtactggaggcctgggcctgaccatagagggagcgtca
gaggcaaaaattacctgtaaagataacaaagatggcagctgcagcgtagagtacgttacc
ttcacacctggagagtacgacgtcaatatcaacttcggaggacaccccattccaggcagt
ccgttccgcgtgccagtgtgggatcccagtaaggtgaaatgttcaggccaaggtttgggt
gacagagtcagagcccacctacctcagacctttactgtggacactatacaggcaggacag
gcaaatctggaggtcagtctcataggaccatcaggttcagagcctgttgctgtaaaaaat
aacagtgatggtacacacacagtcaactacactccagttcatgatggcccttacactgtg
tcagttaaatatggagaccaggaggttcctcgcagtccattcaaggtgagatctcagcct
ggtcatgatgccagtaaggtttgtgcaagcggtccaggtctggacaagtcaggtgtgccc
gccagcctgccagtggagttcaccattgatgcccgcgacgcaggagagggactgctcact
gtacaaatactggaccaagaatgcaagccaaagaaggctaccatctatgataacagagat
gggacctacacagtgtcttacgtaccagactccaccggcccttacacaatcatgatcaag
tatggaggcgatgagatcccctactctccctaccatatcttagccctgcccactggagat
gccagcaagtgtctgcttactgtgtttatcggaggacatgccctggcatcaggtctgact
aagatgcaggtgaacgaggaggccatcatctctgtggacacaaaggccgctgggaagggc
aaggtgacctgctcggtcatgaccccagagggggtggagctagacatggatgtgcaggaa
aaccgtgatggaaccgtcgacatctactacaccgctccagaaccaggaaaatatgtcatc
accatccgcttcggaggagggcacatacccaagagccccttccatgttacggcaacaaag
gagcccattgtccttagtgacggcatggatcagttccgccctctcaacctggtcatcccg
ttcactgtacagcagggaccaatcacaggtgaggtgcgtatgccctacggtaagactgcc
catccctacataataaatgacaatgatgggaccatcacagttaaattcaaccctactgaa
aagggtctgcacgagatggacatcaagtatgaaggaaatcacatcccaggaagccccctc
cagttttatgtggatgctatgaacagtggtctggtgacagcacacggccctggtctctgt
caagggtccatcaacaaacctgtcactttcattgtggtcaccaagaatgctggagaaggt
ggtctgtccctagcggtggagggtccttctaaggcaaagatcacctgtaaagacaataag
gatggaacctgtactgtatcctacctgcccacctcaccaggagactacaagatcattgtc
aagtctgacaacaaacacattgccggcagccccttcactgctaaaatcactggtgatgac
tctatcaggacatcccagctcaacgtggggacagcagcagacttgtcactgaagatcaca
gagtctgacctgagtctgctgacggctaatatcagagctccatcaggcaacgaagagccg
tgtttgctcaagagactgcccagcagatacataggtatctccttcactcctaaggaggtg
ggagagcacgaggtgagcgtgaagaagaacggtaagcacgtgaccaacagccctttcaag
atccaggttggccagtcagatattggcgaggccagtagggtcaaggcctttggtaaagga
ctggtggaggcacacaccttcaaaatggctgagttctttgtggacactagggatgcaggt
tatggtggtctggggttgtcgatcgagggtccgagtaaagtggatattaactgtgaggtt
gtggaggatgggacgtgcagagtcagttactgccccacagagctaggcaaccacatcatc
aacatcaagttttctgacaagcacatcccaggaagtcctttcacagtgaaggtgacagga
gaaggaaggatgaaggagagcatcaccaggaagagaactgcccccgccatcgcttctgtc
ggcagcgcctgtggactcaacctcaaaatccctggaaactggttccagatggtgtcagcc
caggagaggatgacgcgcacattcacacgcagtagccacacgtacacacgcaaggagcgc
acggagatcagcaagatgcggggcggcgagacgaagagggaggtgagggtcgaagagagc
acccaggcgggaggaacaggaggagccagtccattcaaagatgtttttggagagttcctg
ggcagagagagtctggctagcttcgctgggatacccgctacagtcacaccaggtgaaacc
actaccaagggtagtatgatggcccaggttaccagccctgggggtaaaacagaacaggca
gagatcatagatggaggggacagcacctacagtgtccgcttcgtgccccaggagatgggg
gcccacacggtcaatgtgaagtacagcgggcagcacgtcccaggtagtcccttccagttt
acagtgggaccactgggagaaggagggtcccacaaggttcgggccggaggcactgggctg
gagagaggagtggcaggagcaccaactgaatttagtatctggacgcgggaggccggtgca
ggcggtctgtccatcgctgtagaggggcccagtaaggctgagatctcctttgaagacagg
aaggatggatcctgtagggtggtctacattgtacaggatccaggtgactatgaagtgtca
atcaagttcaacaacgagcacatccccgacagcccctttgttgttcccatagcaacgctg
tctgatgaggcatgccgactcactgtcaccagcctgcaggagaaggacctaaaggtgaac
caggaagcgtcgttcgctgtacagtgtaacggggcaaggggcgtggttgatgctaaggtc
cataccccctccggctcagcagaggagtgctacatcacagacctggacagtgacaagaac
gccatccgcttcattccccgtgagaatggcgtgcactccatcgacgtcaagttcaatggc
agccacatccctggaagtccgttcaatgtgagggtgggggaggccggacaggctggagac
ccaggcatggtgacagtttatgggcctggactggatggagggtccacaggtgtagcctca
gagtttgtagtgaacacctgtaacgcggggtcgggtgccctgtccgtgaccatcgacggt
ccctctaaggtgaagatggactgttccgattgccttgatggctacaaggtcatctacaga
cccatggcccctggcaactatctcatcaccatcaaatatggaggacccaaccatatagtg
ggcagcccattcaaagccaaagtcacaggtacccgtctgtctggtggtcacagccttcac
gagacgtcctcggtcctggtacagacgattactaagacgtccaaggtagcaggagcgtac
agtacctcgttttcctcaaaactgacctctgacgccagcaaggtggtgtgtcgaggcggc
gggctcaccaaggctctggtcggacagaagaatgtattcaatgtggactgcagcaaagca
ggtactaacatgttactggtgggagtgcacggtcccaggacgccctgtgaaaaggtgtac
gttaaacacatgggcaaccgcctgtacaacgtcacctacactgtcaaagacaaggacaac
tacaccattttcgtcaagtggggggatgacagtgttcctggcagcccctttaaagtagct
gtgccctga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112236628
Entry
112236628         CDS       T05605                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: filamin-A-like
  KO
K04437  filamin
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04510  Focal adhesion
otw05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112236628
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112236628
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112236628
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:otw04812]
    112236628
   04147 Exosome [BR:otw04147]
    112236628
Cytoskeleton proteins [BR:otw04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     112236628
  Intermediate filaments
   Intermediate filament-binding proteins
    112236628
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112236628
SSDB
Motif
Pfam: Filamin CH CFSR CarboxypepD_reg Invasin_D3 Big_3_5 CH_2
Other DBs
NCBI-GeneID: 112236628
NCBI-ProteinID: XP_024260985
LinkDB
Position
Unknown
AA seq 1158 aa
MSGSHPRQHQSVQPALNAPDMPATEKDLAEGATWKKIQQNTFTRWCNEHLKCVNKQITNL
QMDLSDGLRLIGLLEVLSQKKMFRKYNQKPTFRQMQLENVSVALEFLDKENIKLVSIDSK
AIVDGNLKLILGMVWTLILHYSISMPMWEEEEGGDGQHKTPKQRLLGXIQNKLPEISIHN
FSRDWQSGXALGALVNSCAPGLCADWNQWDQTKPVDNAREAMKQADDWLGIPQVITPEEI
VDPNVDEHSVMTYLSQFPKSKLKPGTPLCPGLNPKNACAYGPGIEPVGNVVMKKAVFTVQ
TISAGMGEVLVYVEDPAGHKEEAKVTANNDTNQTYSVFYIPKVTGMHKVMVLFSGLHINT
SPYEVDVGMAQGDSSKATAQGPGLEPAGNIANKTTYFDVYTAGAKASSMSPGCYRLSLSG
LSSACHEGSPCVRSGVGAVEVVVMDPAGKKDVVVVSRLEDIGCNSITAAPTNPPGGGPHH
LRYSLETKQQEPRSPSKHTCNPSLVRAKGRGLQPKGLRVKETADFRVFTKGAGTGELKVT
IKGPSVFTYHPPTPTLYHTTLGERVLACNLGDVCLPLEVKIGSEAGPQNVRAWGPGLETG
IMGKSADFVVEAVGDNVNVYGPGLQSSGLAVGKQTEFTVDAKLGGKAPLKILAQDGGGTP
VDVQVKDNGNGTYTCSYTPKKPLNTPSWRPGRVNIPDSPFRMPIGAGCHPNKVKVSGPGV
AKTGLKAFDQHSSLWTVLRQVKVRSLHYTSPFTVDCAEAGQEYTPPGAGSYTIRVLFADQ
TIPMTPISIKVDPSHDASKVKAEGPGLNHSGVELTKPTHFTVNTKAAGKAKLDAVFSGPA
KGETVKDFEIINNPDNTHTVKYTPVQQGVLGVALTYGGDSIPKSPFSIPVAPSHDLSKIQ
VAGLGDKMTVGKDQEVTVKSEGAGVQGKVLANVTGPSGKPVTSKVEAGLKPETSQVKFIP
WEAGPYQVELTFDGAPIPGSPFNPTAYPPTDATKVKCSGPGLEHAKVGETGEFVVDCTNA
GPAELTIEIISDSGTEAEVHIQDNGDGTYTITYIPRYPGSYTLTIRYGGQDVPNFPASLT
VEPAVNTSGVCVFGPGVEGKGVFREATTDFTVDARPLTQMGGKHIKTVIQNPSGAVTEAV
ITDHCDGTYSVEYTPYQE
NT seq 3475 nt   +upstreamnt  +downstreamnt
atgagtggctcccacccccgccagcaccagtcggtccaaccggcgctcaacgccccggac
atgcctgctacagagaaggacctcgcagagggcgcaacatggaagaagatccaacagaac
accttcacccgctggtgtaacgagcatctgaaatgcgtcaacaagcagatcaccaatctc
cagatggacctgagtgacgggctgcggctgatcggactcctggaggtgttgagccagaag
aaaatgttcaggaaatacaaccagaaacccaccttccgacagatgcagcttgagaacgtt
tcggtggcgctcgagttcctagacaaggagaacatcaagctggtgtccatcgactccaag
gccatagtggatggtaacctgaagctgatccttggcatggtgtggactttgatcctccac
tactccatctccatgcccatgtgggaggaggaggaggggggtgacggccagcacaagacc
ccgaaacagaggcttctgggantgatccagaacaagctccccgagatctccatccacaac
ttcagcagagactggcagagtggcnaggcactgggggcactggtcaacagctgtgctccg
ggcctgtgtgcagactggaaccagtgggaccaaactaaaccagtggacaatgcccgggag
gccatgaaacaggctgatgactggctgggcatccctcaggtgataaccccagaggaaatc
gttgaccccaatgtagatgaacattccgtgatgacatacctgtcccagttccccaagtcc
aaattgaagcctggcacacccctgtgcccaggactcaaccccaagaatgcctgcgcatac
ggaccaggtatagagccagtaggtaacgttgtgatgaagaaggcggtgtttacagtgcag
accatcagtgctgggatgggagaggtgctggtgtatgtagaggaccctgccggacacaaa
gaggaggccaaagtgacagccaacaatgatacgaaccaaacctactctgtcttctacata
cccaaggtcactgggatgcacaaggtgatggtgctgttttcggggctacacatcaatacg
tctccttatgaggtggatgtggggatggctcagggagacagcagtaaagctacagcccag
ggacctggactagaacctgccgggaacatcgccaataagaccacatactttgacgtctac
accgcaggtgctaaggcctcttccatgtctccagggtgctacaggctctccctgtcaggt
ctaagctcggcgtgtcatgaaggctctccctgtgtcaggtctggtgtgggagcggtggag
gtggtggtcatggaccccgcgggtaagaaggacgtggtggttgtgtccagattagaggat
atagggtgcaacagcattaccgctgcacctaccaacccccctggagggggcccacaccat
ctacgttactcgctggagacaaagcagcaagagccccgttcaccgtccaaacatacttgt
aaccccagcctggttcgggccaaggggcgtggtctccagcctaaaggcctcagggtgaaa
gagacagctgacttcagagtcttcactaaaggagctgggacaggagaactcaaagtcacc
atcaagggccccagtgtgtttacctaccacccacccacccccaccctttaccacaccacc
ctgggggaacgtgtgttagcctgtaacctgggtgatgtgtgcctcccgttggaggtgaag
attggttcggaggcagggccacagaatgtgcgtgcctgggggcctggcctggagaccggc
attatgggtaaatctgccgacttcgtggtcgaggccgtcggagacaatgtgaacgtgtat
ggtccaggtctacagagtagtggtctagctgtggggaaacagactgagttcaccgttgac
gccaaactaggaggcaaagcccctctcaagatcctggcacaggatggtggaggaacccca
gtagatgtccaggtgaaggataacggtaatggaacgtacacctgcagttacacccccaag
aaacccctcaacacaccctcatggcgtcctgggcgggtcaacataccggacagtcccttc
aggatgcctatcggggcaggctgccaccctaacaaggtgaaggtgtcaggtcctggtgtg
gctaaaacagggctgaaggcttttgaccaacattcttcactgtggactgtgctgaggcag
gtcaaggtaagatctttacactacaccagccccttcactgtggactgtgctgaggcaggt
caagaatacaccccgccaggcgctggtagttacactatcagggtgctgtttgctgaccag
accatccccatgactcccatcagtatcaaagttgacccgtcacatgatgccagcaaggtc
aaggccgagggaccaggactcaaccatagtggtgtggagttgaccaagccgacccacttc
acagtaaacaccaaggctgcaggtaaagccaagctggacgctgtgttctccggcccagct
aaaggagagacggtcaaggactttgagatcatcaacaaccccgataacacccatacggtc
aagtacacccctgtccagcagggtgttctgggagtggccctcacctacggaggagattct
attcccaagagtcccttctccatccccgtggcaccaagccatgacctcagcaagatacaa
gtggctggactgggtgataagatgacggtgggtaaggaccaggaagtaactgtgaagtct
gaaggagcaggagttcaggggaaagtcttggccaatgttacagggccttctgggaaacct
gtcaccagcaaggtggaggcaggtcttaaaccagagaccagtcaagtgaagtttatccct
tgggaggcggggccataccaggtggagctgacctttgacggagctccgatcccaggatcc
cccttcaaccccaccgcctatccccccaccgacgccaccaaggtgaagtgttccggccca
ggtttggagcatgccaaagtgggagagactggggagtttgtggtggactgtaccaacgcg
ggtccagctgagctgaccatagagatcatcagtgacagtgggacagaggcagaggtccac
atccaggataatggagacggaacctacaccatcacctacatcccccggtaccccggctca
tacaccctcaccatccgctacggggggcaggatgtacccaacttccctgcctccctgact
gtggagcccgctgtcaacaccagcggagtctgcgtgttcggaccgggagtagagggcaaa
ggtgtgttccgcgaggcaaccacagacttcacggtagacgcgcggcccctgacccagatg
ggagggaagcacatcaagacagtcatccagaacccatctggagccgttactgaagctgtc
atcaccgaccactgtgacggaacgtacagcgtagagtacacaccctaccaagagg

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112237703
Entry
112237703         CDS       T05605                                 

Definition
(RefSeq) filamin-A-like
  KO
K04437  filamin
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04510  Focal adhesion
otw05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112237703
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112237703
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112237703
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:otw04812]
    112237703
   04147 Exosome [BR:otw04147]
    112237703
Cytoskeleton proteins [BR:otw04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     112237703
  Intermediate filaments
   Intermediate filament-binding proteins
    112237703
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112237703
SSDB
Motif
Pfam: Filamin Y_Y_Y Big_3_5 CFSR
Other DBs
NCBI-GeneID: 112237703
NCBI-ProteinID: XP_024262072
LinkDB
Position
Unknown
AA seq 1174 aa
MGEGLGTNVRANIPQAFTVDASKAGVAPLQVRVQGPKGVVEPAELVDNGDQTHTVNYIPT
REGPYSINVLYADQEIPRSPYKVKVLPTHDASKVRASGPGLNTTGVPASLPVEFTIDAKD
AGEGLLAVQITDPEGKPKKASIRDNQDGTYLVSYVPDMTGRYTILIKYGGDEIPYSPYRI
RALPTGDASKCTVTGAGVGPTIQIGEQTVITVDAKAAGKGKVTCSVCTPEGVELDVDVVE
NEDGTFDIFYTAPQPGDYCICVRFGGELIPNSPFLVTALEGAPSDQLLQQQQLPQYYSQQ
PWATDRPMGMNGLDVAGLRPFDLVIPFTIQKGEITGDVRMPSGKTAKPDITDNKDGTVTV
KYAPTEAGLHEMDIKYDGIHIPGSPLQFYVDYVNSGNVSAYGPGLIHGTVNKPAMFTVNT
KDAGEGGLSLAIEGPSKADISCVDNQDGTCSVSYLPVLPGDYSILVKYNDKHIPGSPFSA
HITGDDSMRMSHLKVGSAADIPLDIGELDLSQLTASLTTPSGREEPCHLKMLRNGHVGIS
FVPKEIGEHLVNIKKNGRHIPSSPIAVMISQSEIGDASRVRVTGQGLSEAKTFEPAEFII
DTREAGYGGLSLSIEGPSKVDINTEDQEDGTCKVTYCPTEPGNYIINIKFADQHVPGSAF
TVKVTGEGRMKESITRKKRAASVANVGSQCDLSLKIPEISIADMVAQVTSPSGQVQEADI
MEGENNTYCIRFVPTETGVHTVCVKYAGVHVPGSPFQFTVGPLGEGGAHKVRAGGPGLER
AEAGVPAEFSIWTREAGAGGLSIAVEGPSKAEITFEDRKDGSSGVSYMVQESGDYEVSIR
FNEEHIPDSPFVVPVASPSDDARRLTVASLQESGLKVNHPASFAVSLNGAKGQIDAKVHS
PSGALEGCCVTELDQDKYAVRFIPRENGLYLIDVKFNGSHIPGSPFKIRVGETGQAGDPG
MVTAYGAGLEGGTTGTACEFVVNTSKAGPGALAVTIDGPSKVKMDCVECPEGYKVTYTPM
APGNYLISIRYGGPYHIVGSPFKAKITGSKLVSSHSNHETSSVMVDPVTRQVSSSHQGAP
SQSDASCVTAKGLGLSKGFIGQKNNFSVDCSKAGRNMLLVGVDGPRVPCEEVLVKHLGNR
VYNISYQLKEKGEYILVVKWGEQHIPGSPYHITV
NT seq 3525 nt   +upstreamnt  +downstreamnt
atgggggaggggcttggaaccaacgtgcgtgccaacattccacaggccttcacagtggac
gcctctaaagcaggagtcgcccctctccaagtcagagtacagggacccaaaggtgtagtg
gagccagcagagttagtggataatggagaccagactcacaccgtgaactacatcccgacc
agagagggaccttactctatcaatgtactgtatgctgaccaagagatcccacgcagtccc
tacaaggtgaaagtgttgcctacccatgatgccagcaaggtgcgcgccagtggccccggt
ctcaacaccaccggagtgcccgcctctctgcctgtcgagttcaccatcgacgccaaggat
gcaggagaggggctgctcgccgtgcagatcactgaccccgaggggaagcctaagaaggcc
agtatccgtgacaaccaggatgggacttacctggtgtcttatgtacctgacatgactggt
cgttacaccatcctgataaagtatggaggggacgagataccttattccccctaccgcatc
agggctctacctactggggacgccagcaaatgtactgtcacaggagccggtgtgggtcca
accatccagatcggagagcagactgtcattactgtggatgcaaaggctgctgggaaagga
aaggttacgtgcagtgtatgtaccccagaaggggtggagttagatgtagacgtggtggag
aatgaggatggaacctttgatatcttctacactgccccccagcctggagattactgtatc
tgtgttcgctttggaggggaactcatccccaacagccccttcctggtcacggcattggaa
ggagccccttcagatcagctcctccaacagcaacaactaccacagtactacagtcaacag
ccctgggcaacagaccggccaatgggaatgaatggtttggacgtggcgggactccggccg
tttgacctggttatccccttcaccatccaaaaaggagagatcacaggtgacgtgcgcatg
ccgtcaggtaagacagccaagccagacatcacagacaataaggacgggacggtaacggtt
aaatacgctccgactgaggccggcctgcacgagatggacatcaaatacgacgggatacac
atccctggtagtccactccagttctatgtggactatgtgaacagtgggaacgtcagtgcy
tacgggccgggcctgatccacgggaccgtcaacaaacctgccatgttcaccgtcaacacc
aaggacgcaggagagggtggtctgtctctggccatcgagggtccttctaaagctgacatc
agctgtgtggataaccaggatggaacatgctctgtgtcctacctgcctgtcctacctggg
gactacagcatcctggtcaaatacaatgacaaacacatccctggcagccccttctcagcc
cacatcacaggtgatgactctatgaggatgtcccatctgaaggtgggctctgctgctgac
atcccattggacattggcgagctggacctgagtcagctgacagcctctctgaccacgccc
tccggccgagaggaaccctgccacctcaagatgctccgcaacggacacgtcggcatctcg
tttgttcccaaggagatcggggagcacctggtgaacattaagaagaacggacgccatatt
cccagcagccccatcgccgtgatgatcagccaatcggagattggtgacgccagtcgggtg
cgagtgactggccagggcctcagtgaggccaaaacctttgaacctgctgagttcatcatc
gacacacgcgaagcaggctatgggggtctgagtctgtccatcgaaggccccagtaaggtg
gacattaacactgaggaccaggaggatgggacctgtaaggtcacctactgccctactgaa
ccaggaaactacatcatcaacatcaagttcgccgaccaacacgtaccagggagtgcgttc
acggtgaaggtgacaggagaagggaggatgaaggagagtatcaccaggaagaagagggca
gcgtctgttgctaacgtgggcagccagtgtgacctcagcctgaagatcccagagatcagc
atagcagacatggtggcccaggtgaccagtccgtctggtcaggtccaggaggctgacatc
atggagggagagaacaacacctactgcatccgctttgttcccacggagaccggcgtacac
acagtgtgtgtgaagtatgcgggcgtgcacgtacccggcagccccttccagttcacagtg
gggcccctgggagaaggaggagcccacaaggtccgcgctggggggcccgggctggagagg
gcagaggctggagtaccagcggagttcagtatctggacgcgggaggcaggtgcagggggt
ctcagcattgcggtggaggggcccagtaaagcagagatcacctttgaggaccgcaaggac
ggatccagtggagtatcctacatggtccaggagtcaggagactatgaggtgtctatccgt
ttcaatgaggagcacatccctgacagtcccttcgtggttcccgtggcgtcgccctctgat
gacgccagacgactcactgttgccagtcttcaggagtccgggttgaaggtcaatcaccca
gcatcctttgctgtgagcctgaacggagcgaagggacagattgacgctaaagtccacagc
ccctctggagccctggagggctgctgtgttactgagctagaccaagataagtatgctgtc
cgattcattcccagagagaacggtctgtatctgatcgatgtgaagttcaacggcagccac
atccctggcagtcccttcaagatcagggtgggggagacgggacaggctggagacccaggc
atggtgaccgcatacggagctggattagagggaggaaccactggtacagcctgtgagttc
gtggttaacaccagtaaggcgggccctggggccctggcggtgaccatcgacggcccctcc
aaggtgaagatggactgtgttgagtgtccggagggttacaaggtgacctacacccccatg
gctccaggaaactacttaatctccatcagatacggaggaccttaccacatcgtaggatcc
cccttcaaggccaagatcactggctccaagctggtcagtagccatagtaaccacgagacg
tccagtgtcatggtcgaccccgtgactcgccaggttagctcttcccaccagggagctccc
agccaatcggacgccagctgtgtgacagccaagggtctcggcctatcaaagggctttatc
ggccagaagaacaacttcagcgtcgactgcagcaaagcaggtcgtaacatgctgttggtg
ggtgtggacgggcccagggttccctgtgaggaggtactggtgaagcaccttgggaaccgt
gtctataacatcagctaccagctcaaggagaagggagagtacatcctggtagtgaagtgg
ggagaacaacacatccctggcagcccctaccacatcactgtctag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112241106
Entry
112241106         CDS       T05605                                 

Definition
(RefSeq) filamin-A-like
  KO
K04437  filamin
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04510  Focal adhesion
otw05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112241106
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112241106
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112241106
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:otw04812]
    112241106
   04147 Exosome [BR:otw04147]
    112241106
Cytoskeleton proteins [BR:otw04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     112241106
  Intermediate filaments
   Intermediate filament-binding proteins
    112241106
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112241106
SSDB
Motif
Pfam: Filamin Y_Y_Y DUF5060
Other DBs
NCBI-GeneID: 112241106
NCBI-ProteinID: XP_024265048
LinkDB
Position
Unknown
AA seq 470 aa
MDIKYDGIHIPGSPLQFYVDYVNSGNVSAYGPGLIHGTVNKPAMFTVNTKDAGEGGLSLA
MDGPSKADISCVDNQDGTCSVSYLPVLPGQYSILVKYNDKHIPGSPFSAHITGDDSMRMS
HLKVGSAADIPLDIGELDLSQLTASLTTPSGQEEPCHLKMLRNGHVGISFVPTEIGQHLV
NIKKNRHHIPSSPITVMISQSGIGDASRVRVTGQGLSEAKTFEPAEFIIDTRKAGYGCLS
LSIEGPSKVDINTEDQEDGTCKVTYCPTEPGNYIINIKFTDQHVPGSTFTVKVTGEGRMK
ESITRKKGAVSVANVGSQCDLSLKVPEISIADMMAQVTSPSGQVQEADIMEGENNTYCIR
FVPTETGVHTVCVKYAGVHVPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEAGVPAEFSI
WTREAGAGGLSIMVEGPSKAEITFEDRKDGSSGVSYMVQESGVLRMVTTI
NT seq 1413 nt   +upstreamnt  +downstreamnt
atggacatcaaatacgacgggatacacatccctggtagtccactccagttctatgtggac
tatgtgaacagtgggaacgtcagtgcgtacgggccgggcctgatccacgggaccgtcaac
aaacctgccatgttcaccgtcaacaccaaggatgcaggagagggtggtctgtcgctggcc
atggacggtccatctaaagccgacatcagctgtgtggataatcaggatggaacatgctct
gtgtcctacctgcctgtcctacctggacagtacagcatcctggtcaaatacaatgacaaa
cacatccctggcagccccttctcagcccacatcacaggtgatgactctatgaggatgtcc
catctgaaggtgggctctgctgctgacatcccattggacattggagagctggacctgagt
cagctgactgcttctctgaccacgccctcaggccaggaggaaccctgccatctcaagatg
ctccgcaatggacacgtcggcatctcatttgttcccacggagattggacagcacctggtg
aacatcaagaaaaacagacaccatattcccagcagccccatcactgtgatgatcagccaa
tcagggatcggcgacgccagccgggtgcgtgtgactggccagggcctcagcgaggccaaa
acctttgaacccgctgagttcatcatcgacacacgcaaagcaggctatgggtgtctgagt
ctgtccattgagggccccagtaaggtggacattaacactgaggaccaggaggatggcacc
tgtaaggtcacctactgccctactgaaccaggaaactacatcatcaacatcaagttcact
gaccagcacgtaccagggagtacgttcacggtgaaggtgacaggagaagggaggatgaag
gagagtatcaccaggaagaagggggcagtgtctgttgctaacgtgggcagccagtgtgac
ctcagcctcaaggtcccagagatcagcatagcagacatgatggcccaggtgaccagtcca
tctggtcaggtccaggaggctgacatcatggagggagagaacaacacctactgcatccgc
tttgttcccacggagaccggcgtacacacagtgtgtgtgaagtatgcaggcgtgcacgta
cccggcagccccttccagttcacagtggggcccctgggagaaggaggagcccacaaggtc
cgcgctggggggcccgggctggagagggcagaagctggagtaccagctgagttcagtatc
tggacgcgggaggcaggtgcagggggtctcagcatcatggtggaggggcccagtaaagca
gagattaccttcgaggaccgcaaggacggatcgagtggagtatcctacatggtccaggag
tcaggtgtgttgagaatggtaacgactatctaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112255105
Entry
112255105         CDS       T05605                                 

Gene name
flnb
Definition
(RefSeq) filamin-B
  KO
K04437  filamin
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04510  Focal adhesion
otw05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112255105 (flnb)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112255105 (flnb)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112255105 (flnb)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:otw04812]
    112255105 (flnb)
   04147 Exosome [BR:otw04147]
    112255105 (flnb)
Cytoskeleton proteins [BR:otw04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     112255105 (flnb)
  Intermediate filaments
   Intermediate filament-binding proteins
    112255105 (flnb)
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112255105 (flnb)
SSDB
Motif
Pfam: Filamin CH Y_Y_Y Big_3_5 YtkA CFSR Invasin_D3 DUF4930
Other DBs
NCBI-GeneID: 112255105
NCBI-ProteinID: XP_024283934
LinkDB
Position
7
AA seq 2621 aa
MPVTEKDLADDAPWKKIQQNTFTRWCNEHLKCVNKRIGDLQLDLSDGLRLIALLEVLSQK
KMYRKYHARPTFRQMKLENVSVALEFLDRENIRLVSIDSKAIVDGNMKLILGMVWTLILH
YSISMPVWEDEVDDEAEKKTPKQRLLGWIQNKVPDLPINNFSRDWQSGKALGALVDSCAP
GLCPDWETWDNKPSDNAQEAMQLADDWLGIPQVIAPEEIIDPSVDEQSVMTYLSQFPKAK
LKPGAPLKPKLNPKKARAYGPGLEPVGNRVLRPAVFTVDAFSAGQGQVTVYVEDPEGTRE
EVKAVPNEGKKTFSVTYIPQVMGHHKVTVLFAGQQIPKSPFEVSVDKAQGDPTKVTAKGP
GLEAIGNIANKPTYFDIYTAGAGVGDVSAFIKDPQGRPLEAMVEDKGDSVFRCTYKPTQQ
GPHTITVTFGGIAIPKSPSTVNIGPASMPGSCRATGRGLQPRGVRVKQVADFRVDTRNAG
SGDLKVSVKGPKGMEEPVKQKESGDGVFNYDYYPHAPGKYTVTITWGGQHIPKSPFEVGV
GPEAGPQKIRAWGPGLEGGMVGKSADFVAESIGTDVGVLGFAIEGPSQAKIECEDQNDGS
CDVKYWPSEAGEYAVHVMCDDDDIEDSPFMAYIVPDNQDINPSLVKAYGPGLEKSGCVIN
KPAEFTVNTKDAGTGPLKISAQSAEGGPLDVKVKKTGDGVYACSYTPVAAVKHTVAITWA
GVSVPNSPFRVTVGKGSHPHKVKVFGPGIERTGLKANEPTHFTVDCTEAGEGDVSVGIKC
DANIISDKEEDVDFDIIPNANDTITVKYIPPGAGRLTIKVLFTDQEIPISPFRVKVEPSH
DATKVKAEGPGVARSGVECGKPTHFTVHTKGAGKAPVDVQFTGTGKGDAVLDFDIIDNYD
YSHTVKYTPIQQGEMVIIITFGGDVIPKSPFAVGVAAPLDVTKVQVNNLDGRVEVGQDQE
FVVDTKGAGGQGKLEVKISSPSGKLVPCVLEAQPGKRPENSTVKYIPKEEGLYAVEVNYD
GHPIPGSPFPVEATLPPDPSKVKAFGPGLKGGLVGNPAEFTIDTKGAGTGGLGLTVEGPT
EAKIECSDNGDGTCSVSYLPTEPGEYLVNILFEETHIPGSPFHSDVNCPFDPTKVVASGS
GLKRAKVGEVSVVNVDCSRAGPGQLTLDAASDSGNNKAKTEVIDNKDGTYTVTYVPLTAG
MYTLLLKYGGKATPGFPAKVMVDPAVDTSRIQVFGPGVEGQALFREATTEFTVDARSLTK
KGGDHIKAQVRNPSGAMTDCIVTDKADGTYGIEYTPFENGVHAVEVLYDESPVPKSPFQV
GVEEGCDPTRVLAKGPGLQEAITEAPNNFSIITRGAGIGGLGITVEGPSESKMSCKDNKD
GSCNVEYIPFVPGLYDVNITYGGQHIPGSPFKVPVKDMVDPSKVKISGPGVSSGVRANIP
QSFTVDCSKAGVAPLSVAVTAPKGVAEPVEVTNNGDGTHTVAYTPSVEGPYSVVVKYADE
EITRSPFKLRVLPTHDASKVVASGPGLTTGVPASFPVEFTIDAKDAGEGQLSVQITDQDG
KPKRVGIQDNCDGTYLVSYVPDKVGRYTIVIKYGGDEIPASPYRVRATSSGDASKCTVTG
PGIAPIIAVGEEVGFVVNAKAAGKGKVTCIVVTPDGTEVEADVIQNEDGTFDIFYTAPTP
GNYVIYVRFGGENVPKSPFKVMATDEDPMMQQQSANQQSAAPGAAGFQPWVQSRETPLSF
LPSLQPWVTDGSYNPANRMNGTGFRPFDMVIPFAFRKGEITGEVHMPSGKTAQPEIMDNK
DGTVTVKFAPTEAGLHEMHIKYNGTHIPESPLQFYVNNANSANVTASGPGLVYGVANKTA
MFTIYTEDAAEGGLDLAIEGPSKADITCVDNKDGTCTVTYLPVLPGDYHILVRYNDKHIA
GSPFNARITEEKRCSQLKLGSAADFSLDIAETDLSLLTASIKAPSGRDEPCLLKRQPNNH
IGISFIPREVGEHVVSIKKNGCHVPNSPITIMVVQSEIGDASKVKVYGQGLVEGHTFDMS
DFVVDTREAGYGGLALSVEGPSKVDIQTQDVEDGTCVVSYCPSEPGSYIVSVRFADQHVP
GSPFAVKVTGEGRIRESITRRQKAASIATVGSVCDLNLKIPEIDIHDVSAQVTSPSGATE
KADMEAVGPSTYCVRFVPHEMGIHTVDVKYRDQHIPGSPFQFTVGPLGEGGAGKVRAGGP
GLEKAECGVPAEFSIWTREAGAGGLSVAVEGPSRAEISFEDRKDGSCEVSYVAQEPGDYE
VSVKFNEEHIPDSPYLVPVMAPTDDARRLTVASLQESGLKVNHPASFAVHLNGAKGTIDA
KAHSPSGALEECAVSQLEQDKYAIRFIPRENGLHSVDVKFNGSHIPGSPFQVRVGEPGQS
GDAGLVTAHGAGLERGTTGQQSEFIINNTKAGPGALAVTIEGPSKVKMDCQECSEGYKVQ
YTPMAPGNYLVSIKYGGPNHITGSPFKAKVTGQRLVNVSNASETSSLMVESVTKSSSTNS
HSALPRSASDASKVATRGPGLSKAYMGQRASFSVDCSKAGKNMLLVGVHGPHIPCEEVSV
KHMGNMQYNVSYILKEKGDYILVVKWGEDHVPGSPFHVTVP
NT seq 7866 nt   +upstreamnt  +downstreamnt
atgccggttacagagaaagacttggcagacgacgcgccatggaagaaaatccaacaaaac
acttttacgcgctggtgcaacgagcacttaaagtgtgtaaacaagaggataggcgactta
cagttggacctgagcgacgggctgcgacttatcgccctgctggaggtactgagccagaag
aagatgtaccgaaagtatcatgctagacctactttccgccagatgaaactcgagaacgtg
tccgtggcgctggagttcttggaccgggagaatatccgactcgtttccatagactcgaag
gccatagtggatggtaacatgaaactgatcctgggcatggtgtggaccctgatcctccac
tactccatctccatgccggtgtgggaagacgaggtggatgacgaggcggagaagaagact
ccaaagcagaggcttctgggatggatccagaataaagtgccagacttgcccatcaacaac
ttcagcagagactggcagagtggcaaggccctgggagccctggtcgacagctgtgctcca
ggtctgtgtcctgactgggagacgtgggacaacaagccctcggacaacgcccaagaggcc
atgcagctagctgacgactggctgggcatccctcaggtgattgcaccagaggagatcatc
gaccccagtgtggatgaacagtccgtgatgacctacctgtcccaattcccaaaagccaaa
ctgaagcctggtgctcccctcaaacccaaactcaaccccaagaaggcccgtgcatatgga
ccaggtctggagccagtaggtaacagggtgttgcgtcctgctgtcttcacggtggatgcg
ttcagtgcaggtcagggacaggtcactgtttacgtggaggatccagaaggaaccagagaa
gaggtgaaggcggttcctaacgaagggaagaaaaccttcagtgtcacctacataccccag
gttatgggtcatcacaaggtgacggtgctgtttgcaggccagcagatccctaagtctccg
tttgaggtgagcgtggacaaggctcagggagaccccaccaaggttacagccaaagggcct
ggactggaagctataggaaacatagccaacaaacctacgtacttcgacatatacactgca
ggggcaggagtgggagatgtgtcggctttcatcaaggatccccagggcagaccgttggag
gccatggtggaggataagggagacagtgtgttcaggtgtacctacaagcccacccagcaa
ggtcctcacacaatcaccgtcaccttcggaggcatcgccatacccaagagtccttctact
gtcaacattggaccagcgtcaatgccagggtcgtgtcgtgccacagggcgtggcctccag
cccagaggtgtcagagtgaaacaggtggctgacttcagagtggacaccaggaacgcaggg
agtggggatctcaaggtctcagtcaaaggccccaaaggtatggaggagccagtgaaacag
aaggagtctggtgatggggtgtttaactatgactattaccctcacgcccctgggaagtac
actgtcaccatcacctggggaggacagcacatccctaagagtccgtttgaggtgggggtt
ggtccggaggcgggccctcagaagatcagggcctgggggccaggtctggagggaggcatg
gtgggtaaatcggctgactttgtggcggaatccatcggcactgatgtgggagttctgggc
tttgccatcgagggcccgtcccaggctaaaatagagtgtgaggaccagaacgatggttca
tgtgatgtgaagtactggccatcggaggcaggggagtacgctgtccacgtgatgtgtgac
gacgacgatatagaggatagtcccttcatggcctacatcgtccctgacaaccaggacatt
aaccccagcttggtgaaggcctacggtccaggcctggagaagagtggctgtgtcatcaac
aaaccggcagaattcaccgtcaacactaaggatgctgggacaggccccctgaagatctct
gcccagagtgccgagggcggtcccctcgacgttaaggtgaagaagactggagacggtgtc
tacgcctgttcctacacgcccgttgccgcggtcaaacacacagtcgccatcacctgggca
ggagtcagtgtacccaacagtcccttcagggtgactgttgggaagggcagccatcctcac
aaggtgaaggttttcggtccaggaatagagaggactggactgaaggccaatgaacccaca
cacttcactgtggactgcacagaggctggggaaggggacgtgagtgtgggtatcaagtgt
gatgccaatataatcagtgataaagaggaggacgtggacttcgatatcatcccaaatgcc
aacgacaccatcactgtgaagtacatccctcctggagctggacggctcaccatcaaggtc
ctcttcactgaccaggagattcccatcagcccgttcagggtcaaagtggaaccttcccat
gatgccaccaaggtcaaggccgagggtcctggagtggctcgttcaggagtcgagtgtggc
aaaccgacccatttcacggtgcacactaaaggagcaggcaaggctcccgtggacgtccag
ttcactggtactggaaagggagacgccgtcctagactttgacatcatcgacaactacgac
tactcccatactgtcaagtatactccaatacaacagggagagatggtaatcatcataaca
tttggaggagatgtcatccccaagagtccctttgctgtgggagtggctgctcctctggat
gtcaccaaggtccaggtcaacaacctggatggcagagtggaggtggggcaggaccaggag
tttgtggtggacaccaagggagcgggaggccagggtaaactggaggtgaagatcagcagc
cctagcggtaagcttgtcccctgtgtgttggaggctcagcctgggaagagacccgagaac
agcacagtgaagtacatccccaaggaggagggtctctatgctgtggaagtgaactacgat
ggacacccaatcccaggcagccccttccctgtggaggccacactgcctcctgaccccagc
aaggtgaaggcgtttggtccaggtctgaagggcggtttggtgggtaatcccgctgagttc
accatcgacactaagggtgcggggaccggtggcctgggcctgactgtggaggggcccacc
gaagccaagatcgagtgctctgataacggggacgggacctgtagcgtgtcttaccttccc
acggagccaggagagtacctggttaacatcctgtttgaggagacccatatcccaggatcc
cccttccactctgatgtcaactgcccctttgaccccaccaaggtggtggcatcgggctcg
gggctgaagagggccaaggtgggagaggtcagtgtggtgaatgtggattgttccagggct
ggaccgggtcaactcaccctggacgctgcctctgactctggcaacaataaggcgaagacc
gaggtgatcgacaacaaagatggcacctacacagtgacctacgtgcccctgaccgctggg
atgtacaccctgctactgaagtacggaggcaaggctacgcccggattccctgccaaggtg
atggtcgaccctgcagtggacacatccagaatccaggtgtttggccccggagtggaggga
caagcgttgttccgggaagctactacggagttcacagtagatgccaggtctctgactaag
aagggaggtgaccacatcaaagcccaggtcagaaatccctctggtgccatgactgactgt
atcgtcactgacaaggcggacgggacctatggcattgagtacacaccctttgaaaatgga
gtccatgctgtggaggtgctgtacgatgagtctccggtcccaaagagtcccttccaggtg
ggggtagaggagggctgtgatcctaccagggttctggctaagggccccgggctccaggag
gccatcacagaggcccccaacaacttctccatcatcaccagaggggcaggtatcggaggc
ctgggcatcacagtcgagggcccatcggagtctaagatgtcctgtaaagacaataaggac
ggcagctgtaacgtagagtacatcccattcgtcccaggcctgtacgacgttaacatcacg
tatggaggacaacacatcccaggcagtccattcaaggtaccagtgaaggacatggttgac
cccagcaaggtgaagatctcaggacccggcgtgagctcaggtgtccgcgccaatattcca
caatcctttactgtggactgcagcaaggccggggtggctccgctgtctgtagcagtcacc
gcaccgaaaggtgtggctgagccggtggaggtgacaaacaacggagatggaacacacact
gtagcctacaccccttcagtggagggaccctactctgtagtggtcaagtacgctgacgag
gagatcacacgcagtcccttcaagctgcgagtgctgcctacccatgatgccagtaaggtg
gtggctagtggtccaggtctaaccaccggagtgccagccagctttccagtggagttcacc
atcgatgccaaggacgcaggagagggacaactatccgtccagatcacagaccaagatgga
aagccgaagagggttggtatccaggacaactgtgacgggacctatctggtgtcgtacgta
cctgacaaggtggggcggtacaccatcgtgatcaagtacggaggagatgagatccctgcc
tcgccctaccgggtcagagccacgtcctcaggagacgccagcaaatgcactgtcacaggt
cctggtatcgcccccatcatcgcagtcggggaagaggtgggctttgtggtgaacgctaag
gcagctgggaaggggaaggtgacatgtatcgtggtgacgccggatgggaccgaggtggag
gctgatgtcatccagaacgaggatggaacattcgatatcttctacaccgccccgaccccc
gggaactatgtcatatacgtacgatttggaggggagaacgtccccaagagccccttcaaa
gtcatggcgactgatgaggatccaatgatgcagcaacagtcagccaatcagcagtcagct
gctcctggagccgccggattccagccctgggtacagagtagagaaacacctctatccttc
cttccttccctccagccctgggtcacagacgggtcctataacccagccaaccgtatgaac
ggaacaggtttcaggcccttcgacatggtcattcctttcgccttccgcaagggggagatc
acaggtgaggtccacatgccgtcggggaagactgctcagcctgagatcatggacaacaag
gacgggacagtcacagtgaagtttgcccccactgaggccggtctacacgagatgcacatc
aagtacaacggaacgcacattccagagtctcctctacagttctatgtgaacaacgccaac
agtgccaatgtgactgcctccggtcccggtctggtctacggcgtcgccaacaagactgcc
atgttcaccatctacacagaggatgctgccgagggaggtttggacttggccatcgagggt
ccttccaaggcagatatcacctgtgtggataataaagatggtacctgcacagtgacctac
ctacctgttctccctggagactaccatatcctggtcagatacaacgacaagcacatcgct
ggcagccccttcaacgctaggatcaccgaggagaaacgttgttcccagttgaagttgggt
tctgcagctgacttctccctggacattgcagaaactgacctgtctctacttaccgccagc
atcaaagccccctctggccgcgacgaaccctgtctgctcaagagacagcccaataaccac
atcggtatttccttcatcccgagggaggttggggagcacgtggtgagcatcaagaagaat
ggctgccatgttcccaacagccccatcacaatcatggttgtgcaatctgagatcggcgac
gcctccaaggtcaaggtgtacggacaggggctggtcgagggacacaccttcgacatgtct
gactttgtggtggacacacgagaagcaggttacgggggtctggccctatctgtagagggg
cccagtaaggtggacatccagacccaggatgtggaggatgggacatgtgtcgtctcctac
tgcccgtcagaaccaggctcctacatcgtctccgtacgcttcgctgaccaacacgtgcca
ggcagtccgttcgcggtgaaggtgacaggtgagggccgtatccgagagagcatcaccagg
agacagaaggctgcttccatcgccactgtcggtagtgtctgtgacctcaacctcaagata
ccagagatcgacatccatgacgtgtcagcccaggtaaccagtccctctggcgccacagag
aaggcagacatggaggcggtggggcccagcacctactgcgtacgcttcgttccccatgag
atgggaattcacacggtggatgtgaaatacagggaccagcacattccagggagccccttc
cagttcactgtggggcccctgggagagggaggggctgggaaggtcagggccggtggacca
ggcctggagaaggccgagtgtggagtaccagctgagttcagtatctggacacgggaggct
ggtgccggtggtctgtccgtcgctgtagaggggcccagcagagctgagatctcctttgaa
gacaggaaggatggatcctgtgaggtgtcctacgtagctcaggagcctggtgactacgag
gtgtcagtgaagttcaacgaggagcacatcccagacagtccgtaccttgtgcctgtcatg
gcgcctacggacgatgcccgccgtctcactgttgctagtcttcaggagtctggactcaag
gtaaaccacccagcatcctttgcggtacatctgaacggtgccaagggaaccatcgacgcc
aaggcccactcaccctctggcgctctggaggaatgtgctgtgtctcagctagagcaagat
aagtatgctatcaggttcattccacgtgagaacgggctccactccgtcgacgtcaagttc
aatggcagccacatccccgggagccccttccaggtgcgggtgggagagcctggtcagagt
ggagacgcagggctggtcactgcacacggagctggactggagagagggaccacaggccag
cagtcagagttcatcatcaacaacaccaaggcgggccccggggccctggcggtgacgatt
gagggcccctccaaggtcaagatggactgccaggagtgttcagagggatacaaggtccag
tacactcccatggcccctgggaactacctggtttccatcaaatacggaggacccaaccac
atcactggcagccccttcaaggccaaagtcacaggtcagcgcctggtgaatgtgagtaat
gccagtgagacgtcctccctgatggtggagtcagtaaccaaatcatccagtaccaactcc
cacagcgccctgcctcgttctgcctccgacgccagtaaggtggccacccgtggcccaggc
ctcagcaaggcctacatgggtcagagagccagcttctctgtcgactgcagcaaggctggt
aagaacatgttgctggttggcgtccacggcccccacatcccctgtgaggaggtatcagtg
aaacacatggggaacatgcagtacaacgtctcctatatcctcaaggagaagggcgactac
atcctggttgtgaagtggggcgaggatcacgtccccggctcccccttccatgtcactgtc
ccctag

DBGET integrated database retrieval system