KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112214453
Entry
112214453         CDS       T05605                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B-like
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04012  ErbB signaling pathway
otw04068  FoxO signaling pathway
otw04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    112214453
   04068 FoxO signaling pathway
    112214453
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112214453
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 112214453
NCBI-ProteinID: XP_024228969
LinkDB
Position
15
AA seq 190 aa
MCNNMSNVSLSNGSPTLEMVDPRPTNHTKPPIRRNLFGSVDHDDFRRECLVQMKEMEKDS
IDKWNYDFQNDKPLSQGDYKWEPMKSSDLPDFYSRPPHKGVLSSGNVDHNGNHDYRVRPS
CLTNGSELSEETESERQTHCHHSHNRARKRPANPEPQSTGKKSHSSEEDEVVSKSVEQTP
SKNDSRTHEH
NT seq 573 nt   +upstreamnt  +downstreamnt
atgtgcaacaacatgtcaaatgttagtctttcgaatgggagtccgacgttggaaatggtg
gatccgcgtccgacgaatcacacgaagcccccaattcgcagaaatcttttcggatcggta
gatcacgacgactttaggagggagtgtttggttcaaatgaaagagatggagaaggattct
attgacaaatggaattatgatttccaaaacgacaagcccctttcccagggagattataaa
tgggaacccatgaaaagcagtgacctgcctgacttttacagcagaccgcctcacaaggga
gtcttgtcatctggaaatgtggaccataacgggaatcatgattaccgagtccgaccgagc
tgtcttacgaacgggtctgagctatccgaggagactgagagcgagaggcagacgcattgt
caccactctcacaaccgggcaaggaaaagacctgcaaatccagagccccaaagtactggt
aaaaagtcacattccagtgaagaggatgaagtggtgtcaaagtcagtagagcagacaccc
agcaaaaacgattccaggacacatgaacactaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112216753
Entry
112216753         CDS       T05605                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B-like
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04012  ErbB signaling pathway
otw04068  FoxO signaling pathway
otw04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    112216753
   04068 FoxO signaling pathway
    112216753
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112216753
SSDB
Motif
Pfam: CDI Multi-haem_cyto
Other DBs
NCBI-GeneID: 112216753
NCBI-ProteinID: XP_024232570
LinkDB
Position
17
AA seq 186 aa
MCNNMSNVSLSNGSPKLERVDPRPTDHTKPQICRNLFGSVDHDELGRECLVQMKEMEKVF
IDKWNFDFLNDEPLPQGDYNWEPMKSSDMPDFYSRPSHKRVWSSGNVDHNGNHGVRPSCP
ANGAELSEKSERQTDCHHSHNGARKRHANPEPQSTSKKLHSSEEDEVVSKSVEQTPSKND
SRTHEH
NT seq 561 nt   +upstreamnt  +downstreamnt
atgtgcaacaacatgtcaaatgttagtctttcaaatgggagtccgaagttggaaagggtg
gatccgcgcccgacggatcacacgaagccccagatttgcagaaatcttttcggatcggtg
gatcatgacgaattagggagggagtgtttggttcaaatgaaagagatggagaaggttttt
attgacaaatggaattttgattttctaaacgacgagccccttccccagggagattataat
tgggaaccgatgaaaagcagtgacatgccagacttttacagcagaccgtctcataagcga
gtctggtcctctggaaatgtggaccataacgggaatcatggagtccgaccgagctgtcct
gcgaacggggctgagctatccgagaagagcgagaggcagacggattgtcaccactctcac
aacggggcaaggaaaagacatgcaaatccagagccccaaagtacaagtaaaaagttgcat
tccagtgaagaggatgaagttgtgtcaaagtcagtagagcagacacccagcaaaaacgat
tccaggacacatgaacactaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112218171
Entry
112218171         CDS       T05605                                 

Gene name
cdkn1b
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04012  ErbB signaling pathway
otw04068  FoxO signaling pathway
otw04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    112218171 (cdkn1b)
   04068 FoxO signaling pathway
    112218171 (cdkn1b)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112218171 (cdkn1b)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 112218171
NCBI-ProteinID: XP_024234522
LinkDB
Position
19
AA seq 182 aa
MSNVRVSNGSPTFERTDARFSDHPKPSACRNLFGPVDHEELRRDLKGHLQEIEETSSAKW
NFDFSSQTPLLNGRFEWELVDSKDIPRFYSRTQRSAKGLCPSGNNNVDLNGNSCVTPPQP
SENTERSESKEQCTGQRKRPASHDLSSQNKRSHSSSDENTRCPALAHSVEHTPLKTSPRT
QT
NT seq 549 nt   +upstreamnt  +downstreamnt
atgtcaaatgttcgtgtttcaaatgggagccctacatttgaaaggaccgatgctcggttt
tcggatcaccccaaaccgtcagcctgcaggaaccttttcggcccggtggatcacgaagag
ttaaggagggatttaaagggacatttgcaagagattgaagagacgtcctcagcgaaatgg
aacttcgatttttcaagtcaaacacccctattaaacgggagattcgaatgggaattagtg
gatagtaaagacattccacgtttctacagcagaactcaacgatcggcaaagggcctttgc
ccctctgggaataataatgtggatcttaatgggaatagttgtgtgactccaccgcagcct
tctgaaaacacagaaaggtcggagagcaaagagcagtgcaccgggcagagaaaaagacca
gcctcccatgacctctcgtcccaaaataaaaggtcacacagcagttcggatgaaaatact
cgttgcccagccttggcgcattctgtagaacatacacccttgaaaaccagtcccaggact
caaacgtga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112240696
Entry
112240696         CDS       T05605                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B-like
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04012  ErbB signaling pathway
otw04068  FoxO signaling pathway
otw04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    112240696
   04068 FoxO signaling pathway
    112240696
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112240696
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 112240696
NCBI-ProteinID: XP_024264723
LinkDB
Position
Unknown
AA seq 186 aa
MSDVRLSNGSPTLERTDARLSDHPKPSACRIIFGSPDREELRRDLKGHLQEMEAAASAKW
NFDFSSHTPLSNGRFKWELMDCKDIPNFYTRTQRSVKDVCPSGNNTMDLNGNHSCVMVTP
RQPSDNTERSESQMESKEQCTGRRKRPASHEYPSSQNKRSHSSSNEVTPCPGLEYTPRKA
SPRTQT
NT seq 561 nt   +upstreamnt  +downstreamnt
atgtcagatgttcgactttcaaatgggagcccgacgttggaaaggacggatgctcggttg
tcggatcaccccaaaccgtcagcctgcagaatcattttcggctcgccggatcgcgaagag
ttaaggcgggatttaaagggacatttgcaagagatggaagcggcggcctcagcgaagtgg
aacttcgatttttcaagccacacacctctatcgaacgggagattcaaatgggaattaatg
gattgtaaagacattccaaatttctacaccagaacgcaacgatcagtgaaagacgtttgc
ccctctgggaataacactatggatctaaatgggaatcatagttgtgtgatggtgactccc
cggcagccctccgacaacacggagaggtcagagagccaaatggagagtaaagagcagtgc
accgggcggagaaaaagaccagccagccatgaatacccctcgtcccaaaataaaaggtca
cacagtagttcgaatgaagttactccttgcccaggcttagaatacacacccaggaaagcc
agtcccaggactcaaacgtga

DBGET integrated database retrieval system