KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112214476
Entry
112214476         CDS       T05605                                 

Definition
(RefSeq) thrombospondin-4-B-like
  KO
K04659  thrombospondin 2/3/4/5
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04145  Phagosome
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112214476
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    112214476
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112214476
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112214476
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112214476
   00536 Glycosaminoglycan binding proteins [BR:otw00536]
    112214476
   04990 Domain-containing proteins not elsewhere classified [BR:otw04990]
    112214476
Membrane trafficking [BR:otw04131]
 Endocytosis
  Phagocytosis
   Opsonins
    112214476
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   112214476
  Exosomal proteins of colorectal cancer cells
   112214476
  Exosomal proteins of bladder cancer cells
   112214476
Glycosaminoglycan binding proteins [BR:otw00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   112214476
Domain-containing proteins not elsewhere classified [BR:otw04990]
 Thrombospondin domain-containing proteins
  Thrombospondins
   112214476
SSDB
Motif
Pfam: TSP_C TSP_3 COMP EGF_CA EGF_3 EGF cEGF EGF_MSP1_1 Prominin
Other DBs
NCBI-GeneID: 112214476
NCBI-ProteinID: XP_024229012
LinkDB
Position
15
AA seq 937 aa
MGLWTMLIVASQLILNLCSDGAQGSVYDLLNSPDCLPDLLQGGLVEQGVNEAFILTTFKL
QPKTGTTVFGLYNPRDNSKYFEFTVLGKLNRAVLRYLRSDRRMSSVTFNNIQLADGQRHR
LLFHLKGMQQGPGAVELHLDCRLVETVRDLPSVFQGLPAGYGVVELKSMQGKAEDELEEL
KLVVGDTFENVASLQNCHQQGDSVQTLGVNTKQLSNQMLELTQVINELKDVLIQQVKETS
FLRNTISECQACGLGGSEVIEPKCAPGVCFRDDMCIETEEGVECGPCPDGYTGDGFSCDD
VNECQFNPCFAGVKCVNTAPGFRCDACPLGYTGLAVEGVGVVYAQTNKQVCDDIDECKGP
NNGGCTADSLCHNSAGSYVCGGCKTGYIGGQVKGCKPERSCGNSRTNPCDVNAQCIQERD
GSITCQCGIGWAGNGYLCGKDTDIDGYPDEKLKCKDMVCKKDNCMRVPNSGQEDADEDGQ
GDACDDDADGDGILNEQDNCRLKPNVDQRNSDKDNHGDACDNCRTVENPDQRDTDGDRKG
DACDDDMDGDGLKNFLDNCQMVVNRDQLDRDGDGVGDACDSCPDIPNPNQSDIDDDLVGD
SCDTNQDSDGDGHQDTKDNCPNVINSSQLDTDKDGLGDECDDDDDNDSIPDFLPPGPDNC
RLVPNPDQLDENNDGVGDVCESDFDQDKVIDRIDNCPENAEVTLTDFRAYQTVVLDPEGD
AQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFSGVDFEGTFHVNTVTDDDYAGFIFGYQ
DSSSFYVVMWKQTEQTYWQATPFRAVAEPGIQLKAVKSKSGPGEHLRNSLWHTGDTNDQV
RLLWKDPRNVGWKDKVSYRWYLQHRPQVGYIRARFYEGTELVADSGVTIDTTMRGGRLGV
FCFSQENIIWSNLKYRCNDTIPEDFQFSTQHGVNDSL
NT seq 2814 nt   +upstreamnt  +downstreamnt
atggggctgtggacgatgctgatcgtggcttcgcagctgatcttaaacctgtgctcagac
ggagcccagggatcagtctatgatctcctaaactccccggactgtctgccagacctgctg
cagggcggcctggtagagcagggggtgaatgaggcgttcatcctcaccacctttaaactg
cagcccaagactggcaccacagtgtttggtctgtacaacccccgggacaacagcaagtac
tttgagttcaccgtgctggggaaactcaacagagctgtgctgcgttacctgaggagtgat
cggaggatgagctctgtgaccttcaacaacatccaactggcggacggtcagcgccaccgc
ctcctcttccacctgaaggggatgcagcagggcccaggggcggtggagctgcacctggac
tgcagactggtggagacggtcagggatctcccctccgtgtttcagggcctgcctgcaggc
tacggcgtggtggagctgaagagtatgcagggcaaagcagaggatgagctggaggaattg
aaactggtggtgggagacacgtttgagaacgtagcctctctacaaaactgccaccaacaa
ggagactcggtgcagactctgggggtcaacacaaagcaactctccaatcaaatgcttgag
ctcacccaggtgataaatgagctgaaagatgtccttattcagcaggtcaaagagacatct
tttctcagaaacaccatctctgagtgccaggcttgtggactgggtggaagcgaggtcatt
gagccaaagtgtgcccctggtgtttgtttccgtgacgacatgtgtattgagacagaggag
ggtgttgagtgtggaccctgtcctgatggatacacaggggatggcttcagctgtgatgat
gtgaatgagtgtcagtttaacccttgcttcgccggggtaaagtgtgtgaacacagctcca
gggtttcgctgtgacgcatgtcctctgggctacactggtctggctgtggagggggtggga
gtggtctacgcacagacaaacaaacaggtctgtgacgacattgatgagtgcaaaggaccc
aacaatggagggtgcactgctgactctctctgtcacaactctgcgggttcatatgtctgt
gggggctgtaaaacaggctacatagggggccaggtgaagggctgtaagccagagaggagc
tgtggtaacagtcggaccaacccctgtgatgtcaacgcccagtgtatccaagaaagagac
ggctccatcacctgtcagtgtgggattggctgggctggtaatggctacctatgtgggaag
gacacagacattgatggataccctgatgagaaactcaagtgcaaggatatggtctgtaaa
aaggataactgcatgcgtgttcccaactctggccaagaagatgctgacgaggacggacaa
ggggacgcttgtgacgatgacgctgatggagacggtattctgaatgaacaggataactgc
aggttgaagcctaacgtggaccagaggaatagtgacaaggacaaccacggtgatgcctgt
gacaactgtcgtacggtggagaaccccgatcagagggacactgacggtgacaggaaagga
gacgcctgtgatgatgacatggatggagacggcttgaagaacttcctggataactgccag
atggtggtgaaccgggaccagttggaccgggatggagacggagtgggagacgcctgtgac
agctgccccgatattcctaatcctaaccagtccgacatcgatgatgacctggttggggat
tcttgtgacacaaaccaagacagtgatggtgacggtcaccaggacaccaaggacaactgt
cccaacgtgatcaacagctcccagctggacacagacaaagacggcctgggggatgagtgt
gacgatgacgatgacaacgacagcatccctgacttcctgccaccaggacccgacaactgt
agactggtgcccaaccccgaccagctggatgagaacaatgacggtgttggggatgtgtgt
gagtcagactttgaccaggacaaggtgattgacagaatagacaactgtccagagaacgct
gaggtcactctgacagacttcagagcctatcagacggtggtgctggaccccgagggtgac
gcccagattgaccccaactgggttgtcctcaatcagggaatggagattgtgcagaccatg
aacagtgaccctggactggctgtgggttacactgcgttcagtggggtggactttgagggg
acgttccatgtaaacacagttacggacgatgactacgcaggcttcatctttggttaccag
gactcctcctccttctacgtggtcatgtggaaacagactgagcagacctactggcaggcc
acacctttcagagcagtggccgagcctggcatccagctcaaggctgtgaagtctaagtcg
ggtccaggtgaacacctgaggaactccctttggcacacaggggacaccaacgaccaggtg
cgtctgttgtggaaggaccccaggaatgtgggctggaaggacaaggtttcctaccgctgg
tacctgcagcaccggccccaggttggatacatcagggcccgtttctatgaaggtacagaa
ctggtggctgactctggtgtgaccattgacaccaccatgagaggagggcgactgggcgtt
ttctgtttctctcaggaaaacataatctggtccaacctaaagtatcgctgcaatgacacc
atccctgaggacttccagttcagcacgcagcacggcgtcaacgacagtctctaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112214511
Entry
112214511         CDS       T05605                                 

Definition
(RefSeq) collagen alpha-6(IV) chain-like isoform X1
  KO
K06237  collagen type IV alpha
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112214511
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112214511
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112214511
   00536 Glycosaminoglycan binding proteins [BR:otw00536]
    112214511
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   112214511
Glycosaminoglycan binding proteins [BR:otw00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   112214511
SSDB
Motif
Pfam: Collagen C4
Other DBs
NCBI-GeneID: 112214511
NCBI-ProteinID: XP_024229069
LinkDB
Position
15
AA seq 1693 aa
MKFWICVLAVSWAVEATLGGTTGEPCNGLDCSGGCNCNPEKGSRGRPGALGPVGPSGPEG
FPGDQGPSGPKGEKGHVGLGGPSGLKGEKGPMGVPGFPGTDGVPGHPGADGGRGLPGADG
CNGTQGEPGPRTLNSGIPGAPGLSGPTGPKGQKGEPVYVGLSGGVPGPDGVPGPRGPDGG
PGDFGPRGPDGFLGAPGPPGPPGPVGSPSLGFQGEPGDKGDVGPQGDPGRPLVNGVVEFV
GFPKGDKGPKGEGGYKGVRGPTGRPGPPGPFGFPGEVGESGILGYPGGRGPPGFNGPPGS
PGRQGFTGSPGFPGQPGYRGPKGDQGEQGPPGPPIYTDAQGMTVQGAPGDNGVDGLPGQP
GDAGAPGFPGQPGRPGDSFGDGRGSSPGFPGTPGPKGERGNPGRQSYGPEGQPGGQGLPG
TPGPPGPPGRSVANIQTDLFDNLPGMPGRPGAQGPPGASGYKGPKGELGDCNCLGEGTSG
GVGPPGAPGSDGRPGGFGRKGESGDPGIPGFGGQPGTPGRAGERGFFGRKGEKGASFYPS
FSRGIKGELGALGPQGPPGDMGRPGRDGLPGFPGQPGPPADVDGYGTVGERGFPGFSGAK
GRAGEPGENGIGYQGTVGTRGLPGDPGFTGLPGQPGLPGPPGDSCGQEGVNDAEGGLTVP
CRLPGEDGEPGYPGIPGRTGPKGEPGFPGGPGRPGFDGGKGERGDPGFGGQPGPQGFPGP
RGDAGVPGIPGEGRPGAPGKNGFLGRPGEKGQPGEVLGASTGLPGSPGFPGGPGDKGERG
ASGPPGGPGFDGRSGVSGAKGERGTEGYPGTPGLPGLPGEGRPGGFPGPAGPAGSRGLTG
PPGCQGYPGVKGARGDAGFPGPAGMKGQPGEPGGDGSPGLRGLPGPPSPGGRDGIPGGPG
RKGESGYPGLVGFPGMPGNPGRPGGPGGKGAPGFSGRDGQPGDFGAPGPKGDRGNAGPPG
APSLPVRVEYIEKGQMGDNGANGLPGFPGPRGDKGFPGLPGRQGLPGLPGYADRAKGEQG
LPGIPGRPAGPGYPGPKGSPGIIGFPGMPGPRGDDGEPGFPGNPGVLGQPGAKGERGDSS
GYPGGPGAKGEAGTPGYSGNPGAKGAPGDNGFAGGPGFNGQKGAPGDQGIPGQMGTPGFT
GAKGLNGYPGGRGLDGTPGRSGFPGTPGEKGLPGSPGLDGLNGLAGPKGLPGTPGYSEGG
RPGTPGAAGLKGERGSSIPGGPGYNGEKGARGESGGPGVTGFPGLPGLRGETIISNIPGP
LGDPGLPGIDGEEGYRGPPGPPGPPGPGTAQGDRGDSGLSGIPGTPGNRGDPGGPGGPGR
DGNPGFKGERGDSGYSGASGQMGFPGDPGYYGGKGPKGRRGDTGRKGPQGITFPRPDIPT
PYGDMGDPGTNGTPGSVGEAGNPGMPGRGGPKGRPGAVGKLGRNGGSGLDGPLGDSGPPG
FPGPTGSQGLPGKPGLQGPPGSVARSRSIGYTLVKHSQNNQVPMCPQGMAQLWEGYSLLY
VEGQEKAHNQDLGMAGSCLPRFSTVPFLYCTPNEICYYASRNDKSYWLSTTAPIPMMPVG
EEAISQYISRCSVCEAYSQPVAVHSQDLTIPTCPAGWRSLWIGYSFLMHTAAGAEGGGQS
LSSPGSCLEDFRATPFIECNGAKGTCHYFANKYSFWLTTVEPNREFDPPPMDTLKGGNQR
SRVSRCQVCSKIL
NT seq 5082 nt   +upstreamnt  +downstreamnt
atgaaattctggatttgtgtactcgctgtcagctgggcagtagaagcgacactcgggggg
acgacaggagaaccgtgtaatgggttggactgtagtgggggatgcaactgtaatccagag
aaaggcagcagggggcgtccaggggccttggggccagtaggacccagtggaccagagggc
ttcccaggtgaccaagggccttcagggcccaaaggagaaaagggtcatgttggactcggg
ggcccctctgggctgaaaggagaaaaggggcctatgggcgtaccagggttcccaggaacc
gacggagtcccaggtcacccaggtgcggacggtggcaggggtctacccggagcagacggg
tgcaacggtacccagggagaaccaggtcccagaactctaaacagtggaatacctggagct
ccaggactctctggtcccactggtcctaaaggacagaagggagagcctgtatacgttgga
ctcagtgggggagttcctggaccggatggtgtacctggtcctagaggtccagacggaggt
cccggtgactttggccctcgaggtcctgatggattcctgggtgctccaggcccccccggt
ccccctggccctgtagggagccccagtctagggtttcagggggagccaggagacaagggc
gatgtgggcccgcagggagacccaggcaggcccttggtcaatggagtggtggagtttgtg
ggctttcctaaaggagacaaaggacctaagggggaagggggttacaaaggagtgcgtgga
ccaactggtagacccggcccacctggtcctttcggctttcctggcgaggtgggagagagt
ggaattttggggtatccagggggacggggtcctcctggttttaacgggcctcccggatct
ccaggaagacagggattcacaggaagtccagggttccccggccaaccaggctacagagga
cctaagggtgaccagggagaacaggggcctcccggacccccgatctacactgacgcacaa
gggatgactgttcaaggagcaccaggtgacaacggcgtcgacggcctccctggccaacca
ggggacgcaggagctccagggtttccaggacaaccaggacgaccaggcgactccttcggc
gatggtcgcggaagcagcccagggttccctggtacaccgggtcctaagggagagaggggt
aacccaggcagacagagctatggtcctgagggccaaccaggaggacaaggcttaccagga
acccctggaccacccggaccaccaggcagatctgtagccaacatccaaaccgacttgttc
gacaatctaccaggaatgccaggacgaccaggagcccagggaccacctggagccagtgga
tataagggacccaaaggggagctgggtgactgtaactgcctgggagaaggcacctcgggt
ggggtggggccaccgggtgctcctgggtctgatggaagacctggggggttcggacgtaaa
ggcgagagtggagaccctggcatacccggtttcggaggacaaccaggaacacctggtcgt
gcgggtgagaggggtttctttgggcgtaaaggagagaagggggcctccttctacccgtcg
ttcagccgggggatcaagggtgaactgggggccctgggtcctcagggcccccctggagac
atgggccgacccgggagagatggactgcctgggttccctggacagcctgggcctcctgct
gatgtcgatggctacggaaccgttggagagagaggtttcccagggttctcgggggccaaa
ggtcgcgcgggtgaaccaggagagaatgggattggctaccagggtaccgtcggtacccgc
gggttgccaggcgacccgggcttcaccgggttaccagggcaacctggtttacctggcccg
ccaggtgacagctgtgggcaggagggggttaatgacgcagagggagggttgacggtccct
tgtcgtctacctggcgaggacggagaacccggctacccaggaatacctggaagaacaggt
cccaagggcgagccaggtttcccagggggtcccggtcggcccggctttgatggagggaag
ggagagaggggagaccctggctttggaggtcagcctggaccacaaggtttccctggcccc
agaggagatgcgggcgtcccaggtatcccaggcgagggccgtccaggggccccagggaaa
aacgggttcctggggaggccgggggaaaaggggcagccgggggaggttctgggggcctca
acaggtctccctggatcacctgggtttcccggaggaccaggagacaagggagagcgagga
gcatcgggaccacctggaggaccaggttttgacgggcggtccggtgtttccggcgctaag
ggtgagcgtggtaccgaaggctaccccggaactccaggtcttcctggacttcccggagag
ggcagaccgggtggatttcccggtcctgccggaccagccggaagcagaggattaaccgga
cctccaggctgtcaaggctaccccggtgtgaagggagccagaggtgatgcaggctttcca
ggcccagctgggatgaagggacaaccaggagaaccaggaggcgatggctctccaggactc
aggggtcttccaggaccaccgagccccgggggaagagacggcatccctgggggaccagga
agaaagggcgagagcggttaccccggactggtgggtttccccggaatgccaggtaaccct
ggaagacctggaggtcccggagggaaaggagctcccggattctcaggaagagacggtcag
cccggagatttcggagcgccgggacctaaaggtgacagaggtaacgctggtccacccggc
gcaccctctctgcccgtcagagttgagtacattgagaagggacagatgggcgacaatggt
gccaacggtctacccggtttccctggacctagaggtgacaagggtttcccagggctgcct
ggtcgacagggtttgcccgggctgcctggttatgctgacagggctaaaggagaacaagga
cttcctggtatccccggacgcccagccgggccaggctacccagggcctaaaggatctccc
ggtatcatcggcttccctggcatgcctggacctaggggtgacgatggcgaacctggtttc
cctggaaaccccggagtccttggtcagccaggtgccaaaggtgagagaggtgactcgtcc
ggctaccccggaggtcccggagctaaaggtgaggccggaacccctggttactcaggcaac
ccaggtgctaaaggagcccccggggacaacggtttcgcaggcggccctgggttcaacgga
cagaagggagcaccgggagatcaaggaatacccggacaaatgggtacccctggtttcacc
ggcgctaagggtctgaacggatacccaggaggaagaggtctagacgggacacctggacgc
tccggcttccctggaacacctggagagaaaggtctgccgggatctcctggtcttgatggg
ctcaacggactggccggacccaagggtctaccaggaaccccaggttatagtgaggggggt
cgtcccggcactcctggagcagccggtctgaagggagagaggggctcctccatcccaggt
ggacctgggtacaacggagagaagggagctagaggagagtcagggggtcctggtgtgacg
ggcttcccaggactgcctggtcttcgcggggagacgatcatttctaatatccctggacca
ctgggagaccctggcctgccaggaatcgatggagaagaaggttaccgtggtcctccaggc
cccccaggcccaccggggcccggtacagcccaaggggacagaggcgactctgggctctct
ggcatccctggtacccctggtaaccgtggagaccctgggggtccaggtggcccaggacgg
gacgggaaccctggattcaaaggagagagaggtgactctgggtacagtggagcatcagga
caaatgggcttccctggagatccaggatactacggtgggaaaggacccaaaggaaggaga
ggtgatactggtcgtaagggaccccaaggtataactttccccaggccggacattccgaca
ccctatggagacatgggagaccccgggaccaacggaactccagggtccgtgggagaagca
ggcaatcccggcatgccaggcagggggggtcctaaaggcaggcccggcgcggtagggaag
ctggggaggaacggagggtcaggcttggacggacctctgggagactctggtcctcctggt
ttccctggacctaccgggtcacaaggtctgcccggtaagcctggactgcagggtccccca
ggtagtgtggcgcgcagcaggagtattggctacactctggtgaagcacagtcagaacaac
caggtgcccatgtgtcctcagggcatggctcagctctgggaaggatacagtctgctgtat
gttgaggggcaggagaaggcccataaccaggaccttggtatggcaggctcctgccttccc
cgtttcagcactgtcccgttcctgtactgcacgcccaacgagatctgctactacgccagc
cgcaacgacaagtcctattggctgtccaccacggcacccatccccatgatgccggtggga
gaggaggctatcagccagtacatcagcaggtgctccgtgtgcgaggcctactcccagcct
gtagctgtccactcacaggacctcaccatccccacctgccctgccggctggaggtccctc
tggatcgggtactcctttctcatgcacactgctgccggggctgagggcggcggtcagtcc
ctgtcctctccagggtcctgtctggaagacttccgcgccacgcccttcattgagtgtaat
ggggccaagggcacctgccactactttgccaacaagtacagcttctggctgaccacggtt
gagcctaaccgggagttcgacccccctccgatggacacactgaagggaggcaaccaacgc
agccgagtcagtcgctgtcaagtctgcagcaagatcttgtag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112215049
Entry
112215049         CDS       T05605                                 

Definition
(RefSeq) laminin subunit beta-1-like
  KO
K05636  laminin, beta 1
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112215049
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112215049
SSDB
Motif
Pfam: Laminin_EGF Laminin_N UPF0242 Med14
Other DBs
NCBI-GeneID: 112215049
NCBI-ProteinID: XP_024229830
LinkDB
Position
15
AA seq 1647 aa
MLILHIASLLTLGWRSFAQLPEFGDVCTEGSCYPATGDLLIGRAHKLTASSTCGIEKPER
FCIVGHLEEEKKCFVCDSREKYDERMNHTTSHSIENLVTTFAPNRLKTWWQSENGENMCV
WVGVCAHVFGFTSKIRNIQASWDISPVPTRKKAILVLRFRVSVTIMVTEWTSHVGATISV
CWTGLFEIETPTVPATMCVCVYVSPYVCVDMLKITNLRVQFTKLHTLGDNLLDSRDEVTE
KYYYALFDMVVRGNCFCYGHASKCAPVDGIHVGTEGMVHGHCMCNHNTEGLNCEHCKDFY
NDLPWRPAEGRNTNACKMCECNHHSRSCHFDMAVYLSTGNVSGGVCDECQHNTMGRQCEQ
CRPFYYQHPERHLRDPNICERTSPSLCDLRQGPREFYLLILGNCPGGSPCDIGHRNLASG
KRLVTGRNCDRLSGCSRYQASFGMDWFPGPRPLNRESYLDRGRQQLTDSMGTTSMLIRYE
PQLPDQWEQVEIRVIRPYSMRVGQPASPCENTLQGGDQQLVSLLPGSRHVLLPRPVCLEK
GRNYTVRLSLPLYSSLSDVQSPYTLIDSLVLIPRVRKLLLFEGSQGEGAWDTFQRYRCLE
SSQSVIKSPMTDICNNYIFSVSALLHQGAMACQCDSQGSLSAVCDPSGGQCQCRPNVAGR
NCDRCAPATFLFSPLGCRRCECSPPGSVNAFCHEATGQCECVPGASGRQCAHCLPGYWGF
PQCQPCQCNGNSDYCHPQTGECQGCRAFTTGHMCERCLDGYHGDPVLGLGGHCRPCMCPD
GPGSGRQYADSCYQTADNYQLVCACSPGYRGARCDECAPGHYGNPQVPSGRCLPCQCNDN
IDQLDPGSCDARTGICLKCLHHTEGYGCQHCKLGYYGNAASQSCRRCMCYSVGTMSEACL
SPGECHCDLQTGQCPCRPNVIGQNCDRCALDTFNIGSGKGCQTCDCDPTHSFGTSCNELS
GQCSCRSGFGGRKCNECRDKFWGDPEVKCQACDCDLRGIASEQCHRSSGQCVCVEGVSGP
RCNQCARGYHGTFPACERCHQCFAEWDRVVGELSNQTQRLKDHVTELQTSGVTAPYKDTV
SSLEISANAISAIVENNPAIQKMEDVQQMMQQATELVADLNERLNVSEESLSRLVVNAND
TEASLDTLRKQAQELERKVTDIRDHIKTVKNSNIEGAMDTITKAHLESKRAEIRANQTTS
YPDNTLEQSATLRREAEARLSQNQAEFDLRQQKHTERLERLATELNTLDLSELSKQTCGA
ARGEEGCAASPCGGVGCVSEDGTLRCGGEGCDGLVTQTQSTLKTAKDFDQEILSTLQEVD
KLSRMVWEVKVRAGEAKLNAQEVLLKSNQSRDRVEQSNEQLRSLIKEIRGLLTNDRAKVE
VIEAVSNEVLALEMPTSPEQLEALTMEIRDRVGTLTSVEDILSQSANDIHTAERLLEQAR
TASQEVSEMKETAALVKEALETTERAQNAAIDAVKQAHNNTRGTLDLITSVESETAESEL
CLSNATLRLLQLERDVTLLRESSLGTSHHTQHTERLSETARQDAEQALQEFDLEVKGKYS
VVEGLVVTKAEGVSDARKRAELLQQEAKELLTQSSVKLQRFRELERSYAANQRTLEAKTV
QLAGLEKTARQLLNDISQKVMVYSTCS
NT seq 4944 nt   +upstreamnt  +downstreamnt
atgctgatattgcacatcgcatcacttttgaccctcgggtggcgctcctttgcccagctg
ccggagtttggggatgtgtgcactgaggggagctgctaccccgccaccggggaccttctg
attggccgtgcgcacaagctcacggcctcctccacctgcggcattgagaagcctgagcgc
ttttgcatcgttggtcacttggaggaggagaagaagtgttttgtgtgtgactccagagag
aagtatgatgagaggatgaaccacaccaccagccacagcatcgaaaacttggtcaccacc
ttcgcccccaaccgcctcaagacctggtggcagtctgagaatggtgagaatatgtgtgtg
tgggtgggtgtttgtgcgcatgtttttggttttactagtaaaataaggaatattcaggcg
agttgggacatttcgccggtccccacaaggaaaaaggctattttagtcttaaggtttagg
gttagtgttacaattatggttacagaatggacatcacatgttggggcgactatttcagtg
tgctggaccggtctgtttgagattgagacccctacagtcccggctacgatgtgtgtgtgt
gtgtatgtgtctccatatgtgtgtgtagacatgctgaagatcactaacctgcgtgtccag
ttcactaagctccacacactgggtgacaacctgctggactccagagacgaggtcacagag
aaatactactatgccctcttcgacatggtcgtccgcggcaactgcttctgctacggacat
gcctccaaatgcgcccctgttgatgggatacacgtaggcacagagggcatggtccatggt
cactgtatgtgtaaccacaacacagagggtctgaactgtgagcactgtaaggacttctac
aacgacctgccctggaggcctgcagagggacgcaacacaaatgcctgcaagatgtgcgag
tgtaaccaccactccaggtcatgtcactttgacatggctgtgtatctgtctacggggaat
gtgagtggaggagtgtgtgatgagtgtcaacacaacaccatggggcgtcagtgtgagcag
tgcagacccttctactaccagcaccccgaaagacacctgagagaccccaacatctgtgaa
cgtacgtcaccgtctctctgtgacctaagacaagggccaagagagttttacctgctaatc
ctgggcaactgccctggaggaagcccatgtgacattggacaccggaacctggcttctggc
aaacgccttgtcaccggcaggaactgtgaccggttgtctggttgttctcgatatcaggcc
agttttggtatggactggttcccaggccctagacctctgaaccgtgagtcctacctggac
aggggccggcaacaacttactgactccatgggaactacgagcatgcttattcgctacgaa
ccacagttgccggatcagtgggagcaggtggagatcagagtgatacgtccgtactcaatg
agagtggggcagccagccagtccatgtgaaaacacgcttcaaggaggagatcagcagttg
gtgtctcttcttccaggatccagacatgtgctgctcccgaggcctgtgtgtctggagaag
gggcggaactacactgtgcgtcttagtctgcctctttactcctctctcagtgacgtccaa
agcccctacacgctcatcgactccttggtgttgattccgcgggtgcgtaagctgctgttg
tttgagggttctcagggtgagggggcgtgggatacgttccagaggtaccgctgtctggag
agcagccaaagcgtcatcaagagccccatgacggacatctgcaacaactacatcttcagt
gtgtctgccctgctacatcagggggctatggcgtgccagtgtgactcccagggctctctt
agtgcagtgtgcgaccccagcggcgggcagtgccagtgtcggcccaatgtggcaggcagg
aactgtgaccgctgtgcccccgccaccttcctcttcagccccttaggatgcagacgctgt
gagtgtagtcctccgggctctgtgaacgctttctgccacgaggccacaggtcagtgcgag
tgtgttccaggggcgtcagggcgtcagtgtgcccactgcctgccaggctactggggcttc
cctcaatgccagccctgtcagtgcaacggcaacagcgactactgccaccctcagaccggg
gagtgccagggctgccgcgccttcaccaccgggcacatgtgtgaaaggtgtctggatggt
taccatggcgacccagtgttgggtttggggggtcactgccgcccctgcatgtgtcccgac
gggccggggagcgggcgccagtacgcagacagctgctaccagaccgccgacaactaccag
ctggtctgtgcctgcagccctggatacagaggagccaggtgtgacgagtgtgccccaggt
cactatggtaacccccaggtgcccagcgggcgctgtctgccctgccagtgtaacgacaac
atcgaccagctggacccggggtcctgcgacgctcgcacaggcatctgcctcaaatgcctg
caccataccgagggctatggctgccagcactgcaagctgggttactacggcaacgccgcc
agccagagctgcaggaggtgtatgtgttattcagtgggcacaatgtcggaggcgtgtctg
tctccgggggagtgtcactgtgacctgcagactggccagtgtccctgccggcctaacgtg
attggccagaactgcgaccgctgtgcccttgatacgttcaacattggaagcggaaagggc
tgccagacctgtgactgtgacccaacccactcctttgggacgtcgtgcaatgagctgtca
gggcagtgctcgtgcaggtcaggtttcgggggaagaaaatgcaacgagtgccgagataag
ttctggggagaccctgaggtcaaatgtcaagcgtgtgactgtgacctgcgtggcatcgcc
agcgagcagtgccaccgttcgtccggccagtgtgtgtgtgtggagggtgtgtctgggccc
aggtgtaaccagtgtgccagagggtaccatgggacgttccccgcctgcgaacgatgccac
cagtgctttgccgagtgggaccgtgtggtaggggaactgtccaatcagactcagcgtttg
aaggatcatgtgacagagctccagaccagtggggtgacggcgccgtacaaagacaccgtt
agcagtctggagattagtgctaatgctatcagtgcgatagtagagaacaaccctgctata
cagaagatggaagatgtacaacagatgatgcagcaggccactgagctggtggcagacctg
aacgagaggctgaacgtctcagaggaatccctgtcccgtctcgttgtcaatgccaacgac
accgaggccagtctggacacactgagaaagcaggcccaagagctagagagaaaagtcaca
gacattcgagaccacataaagactgtgaagaactctaacatagagggagcgatggacacc
atcaccaaggcccacttggagtctaagagggcggagatccgtgccaatcagaccaccagt
taccccgacaacactttggaacagtcggctacactacggcgtgaagcggaggccagactg
agccagaaccaggcggagtttgacctgagacaacagaaacacacagagagactggaaagg
ctcgccacagagctcaacactcttgacctatcagagctcagcaagcagacatgtggagca
gctaggggggaggaggggtgtgctgcgtccccctgtggaggggtggggtgtgtgtcggag
gacggcacccttcgctgtggtggggaggggtgtgacggtttggtcacacagacacaaagc
actctgaaaacagccaaggacttcgaccaggaaatcctctccaccctgcaggaagtggac
aagctctctaggatggtgtgggaggtgaaggtgcgtgcgggcgaggccaagttgaatgct
caagaggtgctgctgaagtccaaccagagcagagatagagtggaacagagcaacgagcag
ctccgcagcctcatcaaggagatacgaggcctactcactaacgaccgtgccaaagtggag
gttattgaagcggtttcaaatgaggtgttggccctggagatgcccacatcgcccgagcag
ctggaggccctgaccatggagatcagagacagggtgggaaccctcaccagcgtggaggac
atcctcagtcagagtgccaacgacatacacactgcagagaggctgctggagcaggcccgc
acggccagtcaggaggtgtctgagatgaaggagacagctgccctggtgaaggaagctctg
gaaacgactgagcgtgctcagaatgctgccatcgatgccgtcaaacaggcccacaacaac
accaggggaacacttgacctcatcacatctgtggagtcggagacggcggagtcggagctg
tgtctgagtaacgccacactgcgtctgctgcagctggagagagacgtgactctgctgaga
gagagcagcctgggcaccagccaccacacacagcacactgagagactgtctgagaccgct
aggcaggacgcagagcaggccctgcaggagtttgacttggaggtgaagggtaaatacagt
gttgtggagggcttggtagtgacgaaggcagagggcgtgtctgacgccaggaagagggcg
gagctactgcagcaggaggccaaggagttgctcacccagtccagtgtaaaactacagaga
ttcagagagttggagaggtcgtatgcggccaaccagcgtactctggaggccaagacagtt
cagctggccgggctggagaaaacagcacgccagctgctcaatgacatcagccagaaagta
atggtctacagcacctgttcttag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112215073
Entry
112215073         CDS       T05605                                 

Definition
(RefSeq) collagen alpha-5(IV) chain-like
  KO
K06237  collagen type IV alpha
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112215073
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112215073
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112215073
   00536 Glycosaminoglycan binding proteins [BR:otw00536]
    112215073
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   112215073
Glycosaminoglycan binding proteins [BR:otw00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   112215073
SSDB
Motif
Pfam: Collagen C4
Other DBs
NCBI-GeneID: 112215073
NCBI-ProteinID: XP_024229847
LinkDB
Position
15
AA seq 1692 aa
MNKNLKSLRNLAVGLVLVTLCIVVQESESAACHGCAAGSKCDCSGVKGGKGERGFPGLQG
QPGVPGFPGPEGPIGGRGEKGGDGPSGPSGPKGIRGPPGLPGFPGTPGIPGLPGQDGPPG
PRGTAGCNGTKGERGFPGSPGFPGTGGPIVFLVHLVRPGQKGDLGDVISNDRFGQKGGVG
LPGLPGVPGNTGPAGLSGPVGPPGPRGYEGRSGPPGPPGPKGNMGLNFQGPKGDKGDPGL
QGPPGPPGQVGEQKRPTELEIQRGEKGDQGLPGPAGDPGYTGPPGVSGGSKGEKGEPGEA
GKRGKPGKDGDPGPAGFPGSKGDLGGPGLPGRDGDRGDKGDRGYPGPPGVVINGQTGARV
GPKGEPGFPGSSGRKGDRGQPGLSGPPGQPGTPGTGGVGQPGSPGFPGERGQKGDEGQPG
ISLPGPPGRNGTPGLQGPPGPPGAAGVSTGGGNCLEGAPGLPGQQGDRGFQGETGQKGDK
GETCVNCFSRGNSIPGAPGPPGPPGFPGGPGGPGAKGDRGYPGGPGPSGSSGLPGPQGAP
GFPGEKGDPGEAIAVDGVRGDKGDTGFPGPPGLPGLDGGPGRNGVPGAPGPKGTSGSLLV
KGERGPPGEPGLQGLPGDRGSPGSPGFGPQGPPGEKGVQGVSGRTGTPGSPGTKGEPGQT
IAEKGLPGPRGQDGDPGLPGNPGNPGGPGQPGFPGLPGAKGDPGLSGIGLPGPPGAKGFP
GSSGVPGGPGGPGRPGVDGLPGEPGGPGAKGEPGFGLPGPQGPPGFPGPKGLPGPKGDSG
FPGNPGSPGRSGFDGGPGAKGDSGIPGISGARGPPGSPSIGSQGIPGPIGPPGPMGSPGY
SGANGEKGDPGSPGLDIPGLPGDRGSPGFPGNPGGVGPQGNPGGPGRDGLPGLPGGKGDM
GVMGAPGPLGSPGNPGAPGFPGPKGDDGFPGRPGGPGGSGLKGDRGEPGIAGLPGPSIPP
QELKGGKGEPGAPGLGGLPGQKGIPGLPGDAGIPGQDGRPGLPGPQGPKGDAGIPGGSGS
PGAPGAKGNMGEMGFPGPTGAKGTPGQSGRSGGPGSSGASGFPGAKGEPGSPGFGSPGAT
GPKGEPGQSGFPGQNGVKGTPGTPGLPGFPGSPGAKGDPGLPGFQGSPGIPGPKGLDGIP
GNPGLSGPPGRPGENGRAGSPGFPGDKGQAGRDGIPGPAGVKGDPGLPGFGGPGSPGLPG
LPGAKGDLGAPGSSGSPGFPGQKGEMGFSGLPGSPGSVGPPGAPGVALQGPKGNAGPPGP
PGRGGPEGPPGPPGSEGPRGPVGSGGTKGEKGISGIPGSPGFPGAKGDFGSPGFPGNAGI
PGAKGLKGDIGLPGVPGFPGPKGDSGIPGPSGLPGDPGDGGPAGPPGDPGFAPAPIVLKG
ERGSPGPSGLPGGRGATGPPGLEGLSGQPGQPGDSGPQGPPGFSGASGRKGDPGPAGQPG
ERGYPGPPGSDGLQGPPGPSGSASVAHGFLITRHSQGEDVPLCPEGTSLIYDGYSLLYVQ
GNERAHGQDLGTAGSCLRRFSTMPFMFCNINNVCNFASRNDYSYWLSTPTPMPMTMAPIT
GEGIKPYISRCAVCEAPAMVIAVHSQTIQIPTCPSYWEPLWIGYSFMMHTSAGAEGSGQA
LASPGSCLEEFRSAPFIECHGRGTCNYYGNSYSFWLATVDQSEMFRKPQSETLKAGNLRT
RVSRCVVCMKRT
NT seq 5079 nt   +upstreamnt  +downstreamnt
atgaataaaaacttgaagagtctgcgaaatctcgcggtggggttggtgctcgtaaccctg
tgtatcgtggtccaggagtcggaatcagcggcctgtcatggctgtgcagcgggatcaaag
tgtgactgcagcggggtaaaaggaggcaagggcgagaggggtttcccagggctacagggt
cagccaggcgtaccagggttccccggacctgaggggccaatcggaggcaggggagagaag
ggtggtgacggaccttcagggccatccggtccaaaaggaattaggggacctcctggactg
cccgggttcccaggaacaccaggaattccaggtctcccaggacaggacggtcccccgggc
ccaaggggaactgcaggctgcaacgggaccaagggtgagagaggattccctggaagtcca
ggattccccgggacggggggcccgatcgtctttttggtccacctggtccggccgggacaa
aagggagacctaggcgatgtcatctccaatgaccgcttcggacagaaaggaggtgtaggc
ctaccaggtttgcctggagtccctggtaacaccggccctgcgggattgtcgggccctgtc
ggtccacctggccccagaggttatgagggtcgttccgggcctcctggtcctccgggtcct
aagggtaacatgggattgaacttccaaggtcccaaaggagacaagggggatccaggcctg
caggggcctcccggtccacctggacaggtcggggagcagaagagacccaccgagttagag
atccagagaggagagaaaggtgatcaaggtttacctggtccagccggtgatcctggttat
actggtccccctggtgtatctggaggttcgaagggagagaaaggagagcctggagaagca
ggcaaacgcggcaaaccggggaaagatggcgacccaggtcctgctggattccctggtagt
aaaggagacctaggcggcccaggtctgccaggtcgggatggtgacaggggggacaaaggt
gaccgtggataccctggacctccgggcgtggtgattaatggtcagacaggagcacgtgtg
gggccaaaaggagagcctggtttccccgggtcatcaggaaggaaaggagacagaggacaa
cctggtctctcaggtcctccaggccaaccaggaaccccaggtaccggaggtgtaggccaa
cccggttccccaggcttcccaggagagaggggccagaagggagatgagggccagccaggc
atctccctccctgggcccccaggacgaaatgggacccctgggcttcagggaccaccaggc
cctcccggggccgcaggagtctccacagggggcggtaactgtttagaaggggcccccggc
ttaccaggacaacaaggagacagagggtttcaaggagagactggacagaaaggtgacaag
ggagaaacctgtgtgaactgtttctcacgtgggaactccatccctggagcaccaggccct
cccggccctcccgggttcccaggtggaccaggaggaccaggggctaaaggtgacagagga
tatccaggtggcccagggccctcaggttcttctggtttgcctggtccccagggtgcacct
ggtttcccaggagagaagggtgacccaggtgaggctattgctgtggatggggtgaggggt
gacaagggagacacagggttccccggaccccctggcctgcctggtctggacggaggacct
ggtcgcaatggagttcctggagctcctggccccaaaggaacatctggttctctgttagtg
aagggtgagcgagggcctccaggtgagcccggtctgcagggtctcccaggtgacaggggt
agccccggatccccaggcttcggcccccaggggccccctggagagaagggtgttcagggc
gtctcagggagaacgggaacacctggatcaccaggcactaaaggtgagccgggtcaaacg
atagcagagaagggactcccaggacccaggggacaggatggagaccccggtcttcctgga
aacccaggcaaccccggcgggccaggacagcccggtttccccggcttaccaggtgccaag
ggcgaccccggcctctccggcattggactgccaggaccccccggcgctaaaggattccca
ggctcatctggtgtgccaggtggtcccgggggtccaggaagaccaggagtggacggcctc
cccggtgagccaggtggacctggagctaagggagaaccgggatttgggctgccaggtccc
cagggccctccaggcttccctggacccaaaggattacctggacccaaaggagactccggt
ttccccggcaaccccggctcgcccggacgttctggcttcgacggtggccctggtgccaaa
ggtgactctggtatccctggtatatccggagcccgtggccctccaggttcaccctccatc
ggctctcagggcatccccggccccattggacccccaggacccatgggctctccaggatac
tcaggcgccaacggtgagaagggagaccccggttctcccggcctggacattccagggttg
ccaggcgacagaggaagtcccggtttccccggcaaccccgggggagttggaccacagggt
aaccctggtggccctggccgagacggactgcctggcctgcctggtggtaaaggagacatg
ggtgtgatgggagctcctggacctctgggatcccctgggaaccccggagcccccggcttc
cctggacctaaaggtgacgatggtttcccagggcgaccaggtggtcccggcggttcaggt
ctgaagggagacaggggagagcccggtatcgcgggactcccaggacccagcattcctccc
caggaactgaagggtgggaagggagaaccaggagcaccaggtttaggaggactaccaggt
caaaagggtatccctggtctccctggagacgctggtataccaggacaggacggacgacct
gggttgccaggacctcaaggtcccaaaggagacgcaggtatccctggaggatcaggctca
ccaggagccccaggagctaaaggcaacatgggagaaatgggcttcccaggacccacaggg
gcgaaaggaactccgggtcaatcaggtcggtcgggtggacccggtagttcaggagcatca
gggttccctggagctaagggagagcccggttcccctggctttggttccccaggagctaca
ggtcccaagggtgagcccggtcagtcaggattccccggacaaaacggagtaaaaggaact
cccggaacaccaggtcttccagggtttcctggcagccctggcgccaaaggtgaccccggc
ctcccaggattccaaggttctcccgggattcccgggccgaagggtctggatggtatcccc
ggtaaccccggtctcagcggaccacccggccgaccgggagagaacggccgtgccggatcg
cctgggttcccaggggacaagggtcaggcgggtcgtgacggaatccctggaccagcggga
gtcaaaggagacccaggtcttcctggttttggtggccccggttctcctggtctcccagga
ttaccaggtgctaagggagatcttggcgcccctggttcttccggtagccctggcttccct
ggtcagaagggagagatgggtttctctggcctgcctgggtcccctggtagtgttgggccc
cctggcgcaccaggtgtggccctccagggtcccaaaggtaacgccggaccccccggaccc
cctggaagaggaggtcccgaaggtcctccaggtcctcctggctccgaaggtccccgtggc
cctgtcggcagcggagggaccaaaggtgagaagggaatttccggaattcctggatcgcct
ggtttccccggagcgaagggagatttcggatcgcccggattcccgggtaatgctggcatt
cctggtgccaaagggttgaagggagacatcggactgcctggagttcccggattcccagga
ccaaagggagattctggaatccctggaccatctggtctccctggagaccccggagatggt
ggccctgctggacctccaggtgacccaggttttgctccagcccccatcgtgctgaaggga
gagcgtggctcccccggcccttctggtctaccaggcggccgtggcgccacaggacccccc
gggctggagggactctcaggtcagcccggtcagccaggagactccggtcctcagggaccc
ccaggattcagtggagcctccggccgcaagggagacccaggacccgccggacagccaggt
gagcgtggatatcccggtccccctggttcagatggcctgcagggccccccaggtccatct
ggatctgcctctgtggcgcacggcttcctgatcaccagacacagccagggcgaggacgtc
cccctctgcccagagggcaccagtctcatctacgacggctactctctgctctacgtacag
ggcaacgagagggcacacggacaggacctgggaactgctggtagttgcctgcgtcggttc
agcaccatgccattcatgttctgtaacatcaacaacgtgtgtaactttgcctcccgtaac
gactactcctattggctgtccacacccacgcctatgcccatgactatggcccccatcacc
ggagagggcatcaaaccttacatcagcaggtgtgcagtgtgtgaggcccctgccatggtg
atagctgtacacagtcagaccattcagatccccacctgccccagctactgggaaccactg
tggatcggatactccttcatgatgcacactagtgctggtgctgagggttcgggtcaggct
ctggcctctcctggctcctgtctagaggaattccggagcgctcccttcatcgagtgccac
ggtcggggaacctgcaactactacggcaactcctacagcttctggctggctaccgtcgac
caatcagaaatgttcaggaagccacagtcggagacgctgaaagcaggtaacctgcggacg
cgcgtcagccgctgtgtggtctgtatgaagaggacgtaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112215778
Entry
112215778         CDS       T05605                                 

Definition
(RefSeq) collagen alpha-3(IX) chain-like
  KO
K08131  collagen type IX alpha
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112215778
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112215778
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:otw00535]
    112215778
Proteoglycans [BR:otw00535]
 Extracellular matrix (ECM) proteoglycans
  Collagen family
   112215778
SSDB
Motif
Pfam: Collagen
Other DBs
NCBI-GeneID: 112215778
NCBI-ProteinID: XP_024230938
LinkDB
Position
16
AA seq 678 aa
MSIFSALGLLLLCQLLASSPAQRPGPRGAVGPPGPLGPAGKDGTDGKDGPAGLSGKAGPK
GKAGGAGGPGNPGLPGLPGVDGLTGADGPAGKDGPPGELGDAGPPGPGGPPGRGRPGAPG
PPGANGLAGGIGPQGPAGPEGLAGLAGPPGPDGPPGLPGALPDGSGDLLCPAICPPGPSG
PPGMPGFKGHTGHKGDKGELGKDGEKGYAGPSGPPGIPGTVGLQGPRGLRGLQGPMGAVG
DRGLPGFRGKPGIAGIIGKTGDVGEKGPEGFRGPKGEIGKIGPKGVPGGAGPKGEPGIPG
RDGKDGTQGLDGEKGDAGRNGVPGEKGPNGLPGLQGKAGSKGATGGVGDPGEMGEAGPSG
EPGIPGDIGIPGERGEAGTRGVAGGIGPVGNIGVRGSKGFQGIKGSLGDPGLPGPTGIRG
GFGERGPVGASGPKGDVGVAGADGLPGENGEPGPFGPVGQKGESGKRGELGPKGVVGPQG
ELGARGVPGKPGLMGFQGEQGLSGIAGKIGVPGKLASEQHIRELCGSMIDDQIAKLASNL
RRPLSPGQVGRPGIAGPPGKPGETGSIGHPGSRGPPGYRGLPGDLGDPGPRGDLGEQGDK
GPIGKAIEGPVGDQGYQGIPGVFGIVKDGRDGSPGDPGEPGEAGRTGRTGHSGSPGICDT
TACQGANVHAKTSNPKNH
NT seq 2037 nt   +upstreamnt  +downstreamnt
atgtctatattctcagctctcgggctgctcttgctgtgccagcttttggcatcatctcca
gcccagagacccggcccacgaggagcagtcgggccgccaggacccctgggaccggcaggg
aaggatggtactgacggcaaagatggccctgctggactttcaggaaaagctggacccaag
gggaaagcagggggagcaggaggaccagggaacccaggcctgcccggcctcccaggggtg
gacggattgacaggtgctgatgggcctgcagggaaggacggtcctccaggggagttgggc
gatgctggacctcccggaccaggtggacctcctggcagagggagaccgggagctccaggg
ccaccaggagccaatgggcttgcgggcggaatcgggccacagggaccagcaggccctgag
ggtcttgcaggattggctgggccacccggccctgacggacccccaggtcttcctggggct
ctccctgatggcagtggagatctgttgtgtcctgccatctgccctcctggcccctccggc
cctccaggaatgcctggattcaagggtcacacaggacacaaaggagacaagggagagctc
gggaaagacggagagaagggttatgctggcccatctggtcctccgggtattcccggcact
gtgggcctgcagggtcctcgtggtttgaggggacttcagggcccgatgggtgcagtagga
gacaggggtttacctggtttccgaggcaaacctggtattgctggcatcatcggcaagaca
ggtgatgttggagagaaaggaccagagggatttagagggccaaagggcgagattggcaaa
attggtccaaagggagttcccgggggagcaggacccaaaggggagcctggcatccccggc
agagacgggaaagatggcacccagggactggacggcgagaagggcgacgccggacggaat
ggggtacccggtgagaaaggacccaacggccttcctggtttacaaggaaaggctggctca
aagggagccacaggaggagttggcgacccaggagagatgggagaggcagggccgtctgga
gagccaggtattcctggcgacatcggtatcccaggagagaggggcgaggcgggaaccaga
ggagtggctgggggcatcggaccagtgggcaacatcggggttcggggcagcaaaggcttc
cagggaataaaggggtctctgggggaccctggccttcccggaccaaccggaatccgcggc
ggatttggtgagaggggtccagtcggagcatcaggccctaaaggagacgtgggtgtggca
ggagctgatggtttgcccggggagaatggagaacctggtccattcggtccagttggccaa
aaaggagagtctgggaagcgtggagagctgggacccaagggcgtggtgggaccacaggga
gagctcggagccagaggggttcctgggaaaccaggcctcatgggctttcagggtgaacag
ggtctgtccggaatcgctggcaagattggtgttcccggtaaactggcaagcgaacagcac
atcagagaattgtgtggatctatgattgatgatcagattgcaaagctggcttccaacctc
agaagacccctgtcccctggccaagtgggtcgccccggcattgccggacctccggggaag
ccaggcgagactgggtctatcggtcaccccggctcccgtggacctcctggctacagagga
ctgcctggagacctgggagaccccggtcccagaggtgatcttggtgaacagggtgacaag
ggacccattggaaaagccatcgaagggcccgttggagaccaaggataccaaggtatccca
ggagtatttggaatcgtcaaagacgggcgtgacggatccccaggagatccaggagaaccc
ggagaggcaggtaggacaggaaggaccgggcactcgggctccccaggaatctgcgacact
accgcctgccagggggcaaatgtccatgcgaaaacctccaatcccaagaaccattaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112215806
Entry
112215806         CDS       T05605                                 

Definition
(RefSeq) collagen alpha-1(II) chain-like isoform X1
  KO
K19719  collagen type II alpha
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112215806
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112215806
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:otw00536]
    112215806
Glycosaminoglycan binding proteins [BR:otw00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   112215806
SSDB
Motif
Pfam: Collagen COLFI VWC
Other DBs
NCBI-GeneID: 112215806
NCBI-ProteinID: XP_024230979
LinkDB
Position
16
AA seq 1489 aa
MFSFVDSRTVLLLVASQVVLISIVRCQEEDDQEAGSCIQDAQRYNDKDVWKPEPCRICVC
DSGSVLCDEIICEEIRECANPIIQPRECCPICPADASAPTEAVIGAKGQKGEPGEIADVV
GPNGPAGPMGPSGEQGPRGEAGAKGDKGNVGPRGRDGEPGTPGNPGTPGPPGPNGPPGLG
GNFAAQMAGGFDEKAGGAQMGVMQGPMGPMGPRGPPGPSGAPGPQGFQGNPGETGEPGPA
GALGPQGPPGPSGKPGSDGEAGKPGKAGERGPAGPQGARGFPGTPGLPGIKGHRGHPGLD
GSKGEGGAAGAKGEGGAPGENGAPGPMGPRGLPGERGRPGASGSAGARGNDGLPGPAGPP
GPVGPAGAPGFPGSPGSKGEAGPTGARGAEGAQGPRGEAGTPGSPGPAGASGNPGTDGIP
GAKGSAGASGIAGAPGFPGPRGPPGPQGATGPLGPKGQSGDPGIPGFKGEAGPKGELGPI
GPQGGPGPAGEEGKRGARGEPGAAGPLGPPGERGAPGNRGFPGQDGLAGAKGAPGDRGVP
GVGGPKGGTGDPGRAGEPGLPGARGLTGRPGDAGPQGKVGPGGAAGEDGRPGPPGPQGAR
GQPGVMGFPGPKGANGVPGKAGEKGLVGRQGLIGLSGKDGETGAAGPNGPAGPAGERGEQ
GAAGPSGFQGLPGPAGPPGEGGKPGDAGVPGEAGAAGVTGPRGERGFPGERGGAGSQGLQ
GPRGLPGTPGTDGPKGAIGPTGGAGSQGPPGLQGMPGERGAGGILGAKGDRGDNGEKGPE
GAPGKDGSRGLSGPIGPPGPAGPNGVKGEGGPSGPTGAAGARGAPGDRGEGGPPGPAGFA
GPPGADGQPGAKGEFGEAGQKGDGGAPGPQGPSGAPGPVGPTGVSGSKGGRGAQGGAGAT
GFPGAAGRVGSPGPNGNPGAAGPAGPAGKDGPKGVRGDAGTPGRQGDAGLRGVAGAPGEK
GDAGEDGPPGPDGPSGPHGLAGSRGIVGLPGQRGERGFPGLPGPSGEPGKQGASGAGGDR
GPPGPVGPPGLSGPAGEPGREGNAGSDGPPGRDGSTGVKGERGNTGPAGAPGAPGAPGAP
GPVGPLGKQGDRGEGGAQGPAGPAGPAGARGMAGPQGPRGDKGEAGETGERGQKGHRGFT
GLQGLPGPPGSAGDQGAAGPAGPSGAKGPPGPAGPAGKDGSNGTPGPLGPSGPRGRSGET
GAAGPPGNPGPPGPPGPPGPGIDMSAFAGLSQPEKSPDPLRYMRADEASSSLRQHDVEVD
STLKSLNYQIENLRSPDGSQKNPARTCRDIKLSHPEWKSGDYWVDPNIGSTADAIKVFCN
METGETCVYPSIANVPHKNWWTSKSKDRKHVWFGETMNGGFHFSYAEDGTNAASIQLTFL
RLLSTEASQSLTYHCKNSVAYMDASTGNLKKSLLLQGSNDVEIRAEGNSRFTYSVAEDGC
KKHTGQWGKTVFEYKTQKTSRLPIVDIAPMDIGGADQEFGVDVGAVCFL
NT seq 4470 nt   +upstreamnt  +downstreamnt
atgttcagctttgtggattcacggactgttctgctacttgtagcatcccaagttgtttta
atatccattgtcagatgccaggaagaggatgaccaggaggcaggcagctgcatccaggat
gcccaacgctataacgataaggatgtgtggaagccggagccgtgtcgtatctgtgtgtgt
gacagcgggtcagtgctgtgtgatgagatcatctgcgaggagatcagagagtgtgccaac
cccatcatccaacctagagagtgctgccccatctgccctgcggacgccagcgccccaact
gaggcggtgattggtgctaagggccagaaaggggaaccaggcgagattgcagatgttgta
ggaccgaatggaccagcaggccctatgggcccctcgggcgagcagggaccacgtggagaa
gctggcgctaagggtgataagggaaatgttggccccagaggcagagatggcgagcctgga
acccccgggaaccccggaacccctggccctcccggacccaacggacccccaggtcttggc
gggaacttcgcggctcagatggctggtggattcgatgagaaagccggaggcgcacagatg
ggagtgatgcaaggacctatgggccctatgggtccccgtggtccacctggcccttctgga
gcccctggcccacaaggtttccaaggtaaccccggagagactggagagccaggccctgct
ggtgcgctgggaccccaaggaccccctggaccttctggcaaaccaggaagtgatggtgag
gctggcaaacctggaaaggctggtgaacgtggacctgcaggacctcagggagctcgtgga
ttccccggaactcctggtcttcccggaatcaaaggacacagaggtcatcctggtcttgat
ggatctaagggagagggtggtgctgctggagccaagggcgagggtggcgctcccggagag
aacggcgcccctggaccaatgggaccacgtggtctgcctggcgagagaggccgtcccgga
gcttctggctctgctggtgcccgtggtaatgatggcttgcctggccctgctggtcctcct
gggcctgttggacctgctggagcacctggtttccctggatcccctggctccaagggagaa
gctggccccactggtgcccgtggagctgagggcgcacagggaccccgcggagaggctggc
acacccggatctcccggtcccgctggcgcctctggcaaccctggtactgatggtatcccc
ggagctaaaggatctgctggtgcttctggtattgctggtgcacctggtttcccaggaccc
cgtggcccccccggacctcagggagcaacaggacctcttgggcccaagggccagtcggga
gaccccggtattcctggtttcaaaggagaggctggacccaagggagagcttggccctatt
ggtccccaaggcggccctggccccgctggcgaggagggcaaacgaggagcaagaggagag
cccggtgctgctggaccacttggacctcctggcgagagaggagctcccggtaaccgtggt
ttcccgggtcaggacggtcttgctggtgctaagggagcccctggtgaccgtggtgttccc
ggcgtgggtgggcctaagggaggcactggtgaccccggccgcgcaggagagcctggtctt
cccggagccagaggtctcactggtcgccctggagatgctggtcctcaaggcaaagttggc
cctggtggtgctgctggtgaggacggtcgccccggcccacctggtcctcagggagcacgt
ggccagcctggtgtgatgggattccccggaccaaagggagccaatggtgtgcctggcaag
gcaggagagaagggtctcgtgggtcgtcaaggtctgataggtctgtctggtaaagatggt
gagactggcgctgctggacctaacggccctgctggacctgctggagagagaggagagcag
ggagctgctgggccatctggcttccagggtctgcctggacctgctggccccccgggagag
ggaggcaagcctggtgatgcgggtgttcctggagaggctggtgctgcaggcgttacggga
cccagaggcgagcgtggtttccctggtgagaggggcggtgcaggatctcagggtctgcag
ggacctcgtggacttcctggaactcccggaaccgatggacccaagggagccattgggcca
actggtggtgctggatctcagggaccccccggcctgcagggtatgccaggagagagagga
gctggtggtatccttggagccaaaggtgacagaggtgacaacggcgagaaaggacctgaa
ggcgctcctggaaaggatggttccagaggcttgtctggtcccattggtcctcctggccca
gctggtcccaacggcgtgaagggtgagggtggaccttctggcccaactggtgcggctggt
gcccgtggtgctcctggtgaccgtggtgagggtggtcctcctgggcctgctggcttcgct
gggcctcctggtgcagatggtcagcctggagccaagggagagtttggcgaggctggacag
aagggagatggtggggcccctggacctcagggaccctctggggcccctggacctgtgggt
cccactggtgtttctggatctaaaggaggccgcggtgcccagggtggcgctggtgctact
ggtttccctggtgctgctggaagagttggatctcccggtcccaacggtaaccctggtgct
gctggccccgctggtcctgctggtaaagacggtcctaagggagttcgcggtgacgctggc
accccaggaagacagggagatgccgggctgcgtggagttgctggagcccctggcgagaag
ggagatgctggagaagacggcccccctggccctgatggtccttcaggtccccatggtctg
gctgggtctcgtggtattgttggtctgcctgggcagcgtggagagaggggcttccctggt
cttcctggaccgtctggagagcccggtaagcagggagcttctggtgctggtggtgaccgt
ggaccgcctggccctgtgggaccccctggactgtctggacctgcaggagagcccggaaga
gagggcaacgctggatctgatggaccccctggtagagatggatccactggagtcaagggt
gagcgtggtaacactggtcctgctggtgctcctggtgccccgggcgctcccggtgccccc
ggccctgtcggccccctgggcaagcagggagacagaggagagggaggtgctcaaggacct
gccggacccgctggaccagctggcgctagaggaatggctggaccccaaggaccccgtgga
gacaagggagaggctggcgagacaggagagaggggacagaagggacaccgtggcttcact
ggtctgcagggtcttcctggacctcccggctccgctggagaccagggagctgctggacct
gccggacctagtggcgctaaaggaccccctggcccagccggtcccgctggtaaggatgga
tctaacggtacccctggacccctcggaccctctgggcctcgtggtcgttctggagagact
ggtgctgctggtcctcctggtaaccccggaccccctggtcctcctggtcctcccggccct
ggcatcgacatgtctgccttcgctggcctgtctcagccagagaagtctccggatcccctg
aggtacatgagggctgatgaggcatccagctccctgaggcagcacgacgtggaggtggac
tccacactcaagtcgctcaactaccagatcgagaacctgcgcagccccgacggtagccag
aagaaccccgcccgcacctgcagagacatcaaactgtcccaccccgagtggaagagtggt
gactactgggtggacccgaacattggcagcacagctgacgccatcaaggtcttctgcaac
atggagactggcgagacctgcgtgtaccccagcatagccaacgtgccgcacaagaactgg
tggacaagcaagagcaaggaccgcaaacacgtctggttcggagagaccatgaatggagga
ttccacttcagctacgctgaggacggtaccaacgccgccagtatccagctgaccttcctg
aggctgctgtccacagaagcgtctcagagcctcacctaccactgcaagaacagcgtggcc
tacatggacgcatccacgggcaacctgaagaagtctctgctgctccagggctccaacgac
gtggagatccgagctgagggcaacagccgcttcacctacagcgtggcggaggacggctgc
aagaaacacacaggccaatggggcaagactgtcttcgagtacaaaacacagaagacctcc
cgtctgcccatcgtggacattgctcccatggacatcggaggagcggaccaggagttcggc
gtggacgtgggcgcagtctgcttcttgtaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112216009
Entry
112216009         CDS       T05605                                 

Gene name
lamb2
Definition
(RefSeq) laminin subunit beta-2 isoform X1
  KO
K06243  laminin, beta 2
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112216009 (lamb2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112216009 (lamb2)
SSDB
Motif
Pfam: Laminin_EGF Laminin_N F5_F8_type_C Borrelia_P83 EzrA Trans_reg_C
Other DBs
NCBI-GeneID: 112216009
NCBI-ProteinID: XP_024231332
LinkDB
Position
16
AA seq 1797 aa
MHASLVMFICALAYATAREPDHAHGCTHGSCYPATGDLLVGREKSLKASSTCGSRKKDPY
CIVSHLQDEKKCFQCDSRRPYDPVYNTISHRIENVITTFKPHRKKSWWQSENGKPDVFIQ
LDLEAEFHFTHLIMIFKTFRPAAMVIERSADFGRNWQVYRYFAYDCASVFPGVSKGPLRK
VDDVICESRYSDIEPSTEGEAIYRVLDPAIHIEDPYSPNIQNQLKITNLRVNFTKLHTLG
DNLLDSRVEIKEKYYYAMYELVVRGNCFCYGHASECAPIDGIKDEEGMVHGRCVCKHNTK
GLNCELCDDFHSDMPWRPAEGRNTNACKKCNCNGHSNQCHFDMAVYLATGNAAGGVCDHC
LHNTMGRNCEMCKPFYYKDLSRDIRDPGVCTACDCDPDGSLNGGICDGHDEPSLGMIAGQ
CRCKDHVEGHRCDKCKSGFFGLSAANPRGCQPCQCDPRGTVSESPKCDPVSGDCFCKRLV
TGRSCDLCLPEHWALSHDMNGCRDCDCDVGGATDNHCSMENGQCRCRSHMMGRQCTQVES
GWYFMALDHYTYEAELAILGQGCSVEQREHQPGRPATWTGTGFAKVPEGSSLEFSINNIP
YSMEYDLLIRYEPQMPRDWGEVRVTIIRPGPIPTSSPCGNTIPADDMLTVSLPAGSRFVV
LPPPVCMERGVSYTLRFEFSRYLDGNSILILGTTAANILVDSISLIPRYSSLEMFIGGDP
ASIARKQSYERYRCHEGAKSVTRPQISNVCAKLITSMSAIINHGALPCLCDPQGSVSSVC
DTHGGQCRCRPNVIGLRCDQCAPGTYGFGPAGCKACECNLEGAVTRSCDQLTGQCPCRPG
AFGQRCDGCQAGHWGFPNCKRCLCNGHAEECHQRTGACLNCRDNTGGDKCDRCANGYYGN
PVLGTGMGNQCRACPCPDGPNSGRHFAASCYQDNRNRQVVCNCNQGYTGGMVKRSEGSFK
RSRCEECAPGYYGNPSQPGGRCQPCRCSNNIDMSDLDACDRRTGECKKCLYNTEGPDCGV
CKSGYYGDASRRNCRKCTCSFLGTEHTQCTARDECVCQRATGQCQCLPNTIGLTCDHCKP
NYWNLASGRGCEACGCDPNNAVNSACNEFTGKCQCRDGFGGKTCTDCQENYWGDPRIQCR
VCDCDPRGIETSQCDQKSGHCVCQQGVSGVRCDQCARGFSGQFPNCQPCHQCFGDWDRVV
QDLAVRTKTLSERAQEIQTTGLTGAYEKAFRDLEKKLAQAQGIVNARNTTAEAVSSLMEL
IEDLRSQIGETTDTLNRLEGDLTSVQNSNVEASNELSALEREAKQLNLTSDQLHRQLDIL
KNSNFLGAYDSIHSSYNKSRDAERRANQSTTTTPSTVSQSADTRRKTERLISAKKDDFNR
KNAANKRALGDLNAKAQTLDMKKINEKVCGTPGDAPCAESLCGGAGCRDDEGNRHCGGLN
CNGAVAMADNALERSKHAEKELNKAMGEVEELFHKVADAKTKAEEAKSKAQAALDKATNT
KNKVERSNNDLRDLIKQIRDFLMQEGADPDSIETVANRVLELSIPASPQQIRHLAEEIKD
RVRSLSNVDAILQQTQDDVRKAEQLLQEAKKARNRAEGVKSTAETVKQALEDAKKAQATA
EKAIQRARADIGETEARLAQIESETSSSEHDLNDAMDRMGNLGREINALKLKRAHNSVAA
ARAEETATMARDKANEAKQILDGELMDKYHTVQELVDTKAKTVQEAKKKAERLRDEAKEL
LKDAQNKLQRLAELEKDYEENQKTLEGKAQQLDGLEDKMKAILNDINKQIQIYNTCQ
NT seq 5394 nt   +upstreamnt  +downstreamnt
atgcacgcgtcactggtaatgttcatatgtgccctggcatatgccactgcccgggagcca
gaccacgcccacggctgtacccatggcagctgttacccggcaacaggagacctgttggtg
ggccgtgagaagagcctgaaggcatcatctacatgcggctccaggaagaaagacccctac
tgcatcgtcagtcacttacaggatgagaagaaatgtttccagtgtgactctcgccgccca
tatgatcctgtctacaacaccatcagtcaccgcattgagaacgtcatcaccacgttcaaa
ccacaccgcaagaagtcatggtggcagtcggagaatggaaagcctgatgtcttcattcag
ctggaccttgaggcagaattccattttactcatcttatcatgatcttcaagacatttcgc
ccagcagccatggtgattgagcgatcggcagattttggacgtaactggcaggtgtaccgc
tactttgcctacgactgtgcctcggttttccccggggtatctaagggacccctacgcaaa
gtagacgacgtcatctgtgagtcgcgctactctgacatcgagccgtccacagagggagag
gcaatctacagagttctggaccctgccatccacattgaggacccctacagccccaacatt
cagaaccagctgaagatcactaacctgcgtgtgaacttcaccaagctgcacactctggga
gataacctgctggactcccgcgtggagatcaaggagaagtactactatgccatgtacgag
ctggtcgtccgcggcaactgcttctgctatggccacgcctccgagtgtgcccccatcgat
gggatcaaggatgaggagggcatggtccatgggaggtgtgtctgcaagcacaacacgaag
ggtctgaattgtgagctgtgtgatgacttccatagtgacatgccctggagaccggctgag
ggacgcaacaccaacgcctgcaagaaatgtaactgtaacggccactccaaccagtgtcac
tttgacatggcggtttacttggccacgggcaatgccgccggtggcgtctgtgaccactgt
ctccacaacaccatgggacgcaactgtgagatgtgtaaaccattttactacaaggacctc
agtagggacatcagagaccccggggtctgtactgcctgtgactgtgatcctgatggttcc
ctgaatgggggcatctgtgacgggcatgacgagccatccctgggcatgatcgctgggcag
tgccgctgtaaggaccacgtggaagggcatcgctgtgacaaatgcaagtctggcttcttt
ggcctgagtgcagcaaacccccgcggctgccaaccctgccagtgtgaccccaggggtact
gtgtcagagagcccaaaatgtgaccctgtgagcggggactgcttctgcaagcgactggtc
accgggcgcagctgtgacctgtgtctgccagaacactgggcactgagtcatgacatgaat
ggctgcagagactgtgactgtgatgtgggcggagccacagataaccactgctctatggag
aatggccagtgccgctgtcgtagtcatatgatgggccgtcaatgtacccaggtggagtct
ggatggtacttcatggctctggaccactatacctatgaggctgagctggccatattggga
cagggctgtagtgtggagcagagggagcaccagcctgggcgccctgccacctggactggc
actgggtttgccaaggtcccagagggcagcagcctggagttctccatcaacaacatcccc
tactccatggagtacgacctcctcatccgctatgagccacagatgccacgggactggggg
gaggtccgtgtgacgatcattcggccagggcccattcccaccagcagcccttgtggaaac
accatccctgcagacgacatgctcactgtgtccctgcctgcaggatccaggtttgtcgtg
ctgcctccacctgtatgcatggagagaggagtgagctacactcttcgctttgagttcagt
cgctatctggatgggaacagtattctcattcttggtacaaccgctgccaacattttagtg
gactctatctccctgatccctcgttactcctccctggagatgttcattgggggtgacccc
gcctccatcgctaggaagcagagctacgagcgctaccgctgccacgagggggccaagagc
gtgacacgcccccagatcagcaacgtctgtgccaaactcatcaccagcatgtcagccatt
attaaccatggagccctgccttgcctgtgtgacccccagggctcagtcagctcagtgtgt
gacacgcacggaggtcagtgccgctgtaggccaaacgtgattggacttcgctgtgaccag
tgtgctcctgggacgtacggctttggacctgcaggatgtaaagcatgtgagtgcaatctg
gaaggtgcggtcactcggtcctgtgaccagttgactgggcagtgcccgtgccgcccgggt
gcgttcggccagcggtgcgatggctgccaggcaggacactggggcttccccaactgtaag
cgatgcctgtgtaatggacatgctgaggagtgccaccagaggaccggagcctgtctcaac
tgcagggacaacactggaggggacaaatgtgacagatgtgccaacggatactacggcaac
ccagtgttgggcacaggtatgggtaaccaatgtcgggcctgtccttgcccagatggccca
aacagcggacgccacttcgctgcctcctgttaccaggacaaccgcaacagacaggtggtc
tgtaactgtaaccaaggatatacaggggggatggttaagcgctccgagggttctttcaag
cgttcccggtgtgaggagtgcgcccctggttactacggtaacccctcccagccaggtggg
cggtgccagccgtgcaggtgcagtaataacattgacatgtcagatctggatgcgtgtgac
cggaggacaggagagtgtaagaagtgtctctacaacacagagggaccggactgtggcgtg
tgcaagagcggttactatggagacgcctcgcgacgcaactgcagaaagtgcacctgtagc
ttcctgggcacagagcatacccagtgtacagcgcgggatgagtgtgtctgccagcgtgcc
acggggcagtgccagtgtttacccaacaccatcggcctgacatgtgaccactgtaaaccc
aactactggaacctggctagtgggcggggctgtgaggcctgcggctgtgaccccaacaat
gctgtcaactcggcctgcaacgagttcactggaaagtgtcagtgtcgtgatggattcggt
ggaaagacctgcacagactgccaagagaactactggggagaccccaggatccagtgcaga
gtctgtgactgtgaccccaggggcatagagacatcccagtgtgaccagaagtcaggccac
tgtgtgtgtcagcagggggtgtcaggcgtgcgttgtgaccagtgtgcgaggggcttctca
ggccagttccctaactgccagccttgccaccagtgctttggggactgggaccgggtggtg
caggacctggctgtccgaaccaagaccctgtcggaacgggctcaagagatccagaccacg
ggcctgactggagcctatgagaaggccttcagagacctggagaagaagctggcacaggcc
cagggcatcgtcaacgcccgcaacaccaccgcagaggcagtcagcagcctgatggagctc
attgaagacctcaggtctcagataggtgagactacagacacactgaatcgtctggaggga
gacctgaccagtgtgcagaacagcaacgttgaggccagtaatgagctcagtgctctggag
agagaggccaaacagctaaacctgacctcagatcagctccaccgtcaactggacatcctc
aagaactccaacttcctgggtgcatatgacagcatccacagctcctataacaagtcccgt
gatgcagagcggcgagccaaccagtcaaccaccaccacgcccagcactgttagccaatca
gcagacacacgccgcaagacagaacgcctcatctctgccaagaaagatgacttcaaccgt
aagaacgctgccaacaagcgagccctgggggacctcaatgccaaggctcagaccctggac
atgaagaagatcaatgagaaggtctgtgggacccctggcgatgccccctgtgcagagagc
ctttgcggaggagcaggttgccgtgacgatgaggggaataggcactgcggaggcctgaac
tgcaacggtgccgtagcgatggcagataacgccctggagaggtccaagcacgcagagaaa
gagctgaacaaagccatgggggaggtagaggagctcttccacaaggttgcagatgccaag
accaaggcggaggaggcgaagagtaaagcccaggcagctctggacaaggccaccaacacc
aagaacaaggtggagcgctccaacaatgacctgcgggacctcatcaagcagatccgggac
ttcctcatgcaggagggtgcggatccagacagcattgagacggttgccaaccgtgtcctg
gagctgtccatcccagcctcaccacagcagatcagacacctggcagaggagatcaaggac
cgggtccggagcctctccaacgtagacgccattctgcaacagacacaggacgatgtgcgc
aaagcagagcagctgctacaggaggccaagaaggccaggaatcgggcagagggggtgaaa
tccacagcagagacagtaaaacaggcacttgaggatgctaagaaggcccaggccacagca
gagaaggccatacagcgggctcgggctgacattggtgaaacggaagctcgactagcacag
attgagtctgagacctcaagcagtgaacatgacttgaatgatgccatggaccgcatgggc
aacctaggtcgggagattaatgctctgaagctcaaacgtgcccacaacagcgtggcagca
gctcgagctgaggagacagccactatggcacgggacaaagccaatgaggctaagcagatt
ttagatggtgagctgatggataagtatcacacagtgcaggagttggtggacacgaaagcc
aagaccgttcaggaggcgaagaagaaagcagagcgcctaagagacgaagccaaagagcta
ctgaaggacgcccagaacaagcttcagagactagcagagctagagaaagactatgaagag
aaccagaaaacgttggagggcaaagcccagcagctggacggcctagaagacaagatgaag
gctatcctcaacgacatcaacaaacagatccagatctacaacacctgtcagtaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112216475
Entry
112216475         CDS       T05605                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: laminin subunit alpha-1-like
  KO
K05637  laminin, alpha 1/2
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112216475
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112216475
SSDB
Motif
Pfam: Laminin_G_1 Laminin_G_2 Laminin_EGF Laminin_N Laminin_B Laminin_II Laminin_I Laminin_G_3 ARA70
Other DBs
NCBI-GeneID: 112216475
NCBI-ProteinID: XP_024232236
LinkDB
Position
16
AA seq 2942 aa
MRLLCCAIVLLSASSAECQQRGLFPAIFNLASNAEITTNATCGEPEPEMYCKLVEHVPGR
RIRNSQCRTCNAQSQNPKEQHPITNAIDGTNGWWQSPSIKNGRQFHWVTLTLDLHQIFQV
AYVIIKAANSPRPGNWVLERSMDGVEFTPWQYYAISDTECLTRYNITPRLGPPTYKRDDE
VICTSYYSRLVPLEHGEIHTSLINGRPSADQLTSELLDFTSARYIRLRLQRIRTLNADLM
TLSYRDPKEVDPIVTRRYYYSIKDISVGGMCICYGHAQSCPWDPVAKKLQCVCEHNTCGE
SCNECCPGYHQEPWQPGTLSDGNTCEKCNCHDKANDCYFNQTVANLKMSMNSHGDFHGGG
VCISCTQNTAGVNCEACADGFYRPNKVSPHNENPCVECSCDMKGSLTPACIRDDNHAKPE
NGEALRAERCDPAVAFWLKGVPPVSAVMCSLRARLNIDPWHRLHLQGDVGGLTVVPVYAV
VSSTWEGSDPAGLAPEVLLRCFWGVSDVCESSPGLLSQGNGRTLRQMPPRQLLLTPLREQ
HVSVELLPQGFVDLHTGQRVDRDELMTALADVAGLRIRGHLNASAEGELRLSTVSLDMVD
INSTNTVQARDVEQCECPLGYSGTSCESCSSGFYRLGGILFGGNCLQCECNNHATECDIN
RVCLDCTHNTTGPHCDQCLHGYYGNPSEGTPEDCQRCACPLTVATNNFSPTCLLEGPGQV
TCDRCQQGYTGTKCERCANGYHGNPTVAGQECVVCECNGNVDPWEPGHCDTSSGMCLKCH
SHTSGDQCERCEDGYYGDAITAKNCQACACHDKGSYSGVCDLLTGQCTCKPNVVGEKCDQ
CQVGFHGLLSGQGCRECDCIQSGSVSVACEEDGRCQCIPGVAGDKCDRCHHSYFNYQGSG
CTQCECAHTHGNCNVTTGECICPPHTRGEMCDLCEEGHWGHDTVTGCKSCNCSEMGSYAT
QCGITNGQCQCRSDFAGQNCDRCVMGYRGYPECTVCNCNINGTREEFCDEALGVCSCEAP
GNCVCKDNVVGGGCDECKKGTLGLSVSNPAGCSPCFCFGVSSDCEELGGMVRVPITLGSD
PELLRVVSQSDLQGSVVGVYYRNPDMLLDTRDMETPSLAGPYYWRLPKHYQGNKLLSYGG
KLSYVVAFYAMDGAGLANYEPQVLMRGGHLGKQVIYIDMPAPDNGVTTRQDVPLTEHKWK
YFNSVSEKAVSHSDFMAVLSHIEYITIKASYGTGLQQSRISNITMDTALEAEQGLEDMEL
ASLIEICECPAGYAGLSCQECAPGYYRQPVTELNKRGKRPLIQPCVPCRCNNHSQACDLD
TGECLGCQHNTAGEHCSVCSSGYYGDVKGSVRDCSLCACPLKENSFSPTCALEGVVGDFR
CNACKPGYEGRYCERCSVGYYGNPSGPGGRCEACQCSTAGSLHPACDSLTGQCECKAGVR
GRLCDQCEARHVLDGDQCVLCDDECTRVLLDDLDAVECSFLSVNLTGVILSPYSTLVNLE
NDTQEVKTLMSSYRSPDYHLTRDEEDMTNLTQDIDGLLQKAMGVSADGEEVARSTENSVT
QGAELLEYINTIQTAIQALAEQAGRLNRTDNVEMNEAKSRRLMKQVAAMLETIRVVDLAQ
ANASISTELWLVSRSAEAPPPEGAESPPGAPGSDRVPDPQHLQKSDPTPTAASGRQALLN
TARENNNHTHTLLGSINTNCHSTGLRQNVGRLNQMAKTQLEEXQDILADAVNLAEDMSTV
PSQLEGAKEQLEQWNPXLRKHVDALVMELRKQEALELVYKAEDHAQELSKKAQALQRCVC
VPASGGLVWQDTGECLALKTSTGGLLANISDVTDRMALLINNLHNTSRLIPESAFLLHSR
PNGTSEQVLEAKEQAAMANSSLQRALEHLEELRVRLEESSKAVAQAKTSVSNTNQLFSDS
HSTARTAESKLNEAESRTERLYDRLKPLKTLRENLSRNLSEIREMINQARKQAASIKVSV
LADKDCVRAYKPEMSSSNFNTLTMTVKTSEPDNLLFYMGSSSSVDFMAVEMHRGKVGFLW
DAGSGHAKLEYPDIQINNNKWHRINATRFGRHGTLSVHQLESDPLPAVKTTSPRSATVLD
VNKFTLIFVGGLGRQIKTSSAVKMTQFKGCMGEASLNEKNIGLWNYAEREGQCRGCFMSP
QTEETSFHFDGSGYSVVEKPLRSTSTSIVLLFKTLSPNGLLLYLASNATRDFLSIELVEG
QVHLTFELGSGPLTLSSNKAYNTGSWYKITLQRNKRKAYISVMAADNSSDKEIIEAESPG
SASDLNRSDLDPIYIGGLPMSRPIRRQVVARSYVGCIKNMEIARSNFDLLRDSYGVKKGC
VLEPIRSVSVLREGYVELPSMSLGSQGELLASFSTRNHTGIILAGFSKAGTRKRRQARQP
ILAVMLVSGHLEVHVNMVEGGSVHKVVVKSRSGSFSDGQEHSVILQRNRKTMTVLVDEDH
QETVRLSSEKASLTFSSLYMGGLPPEEGVGLLRTTSSFYGCIRNLALDAKLLDLSAAVKY
HNVDMDSCLLEERPKRVFLPDDTDLEAEPTLDPSRPPPPPPTQLSALTPGTLTCASMDNS
TSLPEANQFGISRHSHKVLNINPNTVRRSFSLELSVRTFTQSGLIYYMAHANQMDYATLQ
LLGGRLFFTCDKGSGPATASFPVPVNDGQWHTVKTDFNKKSVVISVDSQASAPVLAKGNT
LDVENKLYLGGLPHTYTAKKIGNVTHSLAGCIQKVILNSVELDTQSPVSEHSTAHCFTAA
QDGTFFSGSGYAALMKEGYKVGSDVTVALEFRSTAPDGVILGVSSAKVDAIGLELASGQA
VFHVNNGAGRVSATSRLGRWLCDGRWHTLLAKKTKNALSLSVDGVTVLTDNPHPQSTSAE
TKDPIYVGGFPVGVKQNCLTSRSSFRGCMRNIRLIKGHVIDILDFSTAFTLQGVSPHSCP
AT
NT seq 8829 nt   +upstreamnt  +downstreamnt
atgaggctcttatgctgtgcaattgtgctgctatctgcatcctccgcggagtgccagcaa
agaggtctcttccccgccatcttcaacctggccagtaatgcagagatcaccaccaacgcc
acctgtggagagcctgagccagagatgtactgtaaactggtggaacacgtaccaggacga
cgcatccgcaactcccagtgtcggacctgtaatgcccagagtcaaaaccccaaagagcaa
catccaatcaccaacgccattgacggcaccaacgggtggtggcaaagccccagcattaaa
aatggcagacagttccactgggtgaccctcacactagatttacaccagattttccaggtg
gcctacgtcatcatcaaggcagccaactctcctcgtcccggtaactgggtgctggagcgt
tcaatggacggtgtggagttcacaccctggcagtactacgccatcagcgacacagaatgt
ctgacccgctacaacatcaccccccgcctcggaccccccacctacaaacgagacgacgag
gttatctgtacatcttactactcgcggctcgtacccctggagcatggagagatccacacg
tctttgatcaatgggcggcccagtgctgaccaactgacctcagagttgctggacttcacc
tcagcccgctacatccgcctgcgtctgcagagaatccgcacgctcaacgccgacctcatg
accctgagctaccgcgaccccaaggaggtggaccccatcgtcaccagacggtactactat
tcaatcaaagacatttcagtgggtgggatgtgcatctgttacggacacgcccagagctgt
ccctgggaccccgttgccaagaagttgcagtgtgtatgtgagcacaatacctgtggggag
agctgtaatgagtgttgccctggctaccaccaggaaccgtggcaaccgggaaccctctcc
gatggcaacacctgcgagaaatgtaactgccacgacaaggccaacgactgctactttaac
cagacggtggccaacctcaagatgagcatgaactcacatggtgacttccatggcgggggc
gtttgtatcagctgtacccagaacactgccggtgtcaactgtgaggcctgcgcagatggc
ttctacagacccaacaaggtgtctccgcacaatgagaacccatgtgtggagtgcagctgt
gacatgaaggggtctttgactcctgcctgtatcagagatgacaaccacgccaagcctgag
aatggagaggctttgcgggcggagcgctgtgaccccgctgttgccttttggctaaagggc
gttccccctgtgtccgctgtgatgtgcagtctgagggcccgcctcaacatcgacccctgg
cacaggctgcatctgcaaggagacgtaggggggctgactgtggtacctgtgtacgcagtg
gtttcttcaacctgggagggcagtgacccagcggggcttgcacctgaggttttgcttcgg
tgtttttggggggtctctgacgtgtgtgagagctcacctggtctactgtctcagggtaat
gggaggaccctgcgtcagatgccccccaggcagctcttgttgacgcccctgcgtgagcag
catgtttctgtggagctcttgccacagggcttcgtagacctgcacacaggtcagagggtg
gacagggacgagctgatgactgcactggccgacgtggccgggctgaggatcagaggtcac
ctcaatgccagtgcagagggggaactcagattgagcactgtatctctggacatggtagac
atcaattctactaacacagtccaggcccgggacgtggagcagtgtgagtgtcccttgggc
tactctggcacatcctgtgagtcctgttcatctgggttctatcgcctcggggggatcctg
ttcggaggcaactgtctccagtgtgagtgtaacaaccatgctacggaatgtgacatcaac
agagtgtgtctggactgtactcacaataccactgggccccactgtgaccaatgcctccac
ggttactatggcaacccctctgagggcaccccggaggactgccagagatgcgcttgcccg
ctgacagtggcaacgaacaatttcagccccacctgtctcctggagggccctgggcaggtg
acatgtgaccgatgtcagcagggctacactgggactaagtgtgaaaggtgtgctaacggt
taccatggcaacccgacggtggcaggccaggagtgcgtggtgtgtgagtgtaacggtaac
gtggacccctgggagccgggccactgtgacaccagcagcggtatgtgtctgaagtgtcac
agccacaccagcggagaccagtgtgagaggtgtgaggacggctactacggtgacgccatc
accgccaagaactgccaggcttgtgcttgccatgacaaagggtcgtactcgggagtgtgt
gacctgctcactggacagtgtacctgcaaacccaacgtggtgggagagaagtgtgaccag
tgtcaggtgggcttccacggtcttctcagcggacaggggtgcagagaatgtgactgtatc
cagtcaggatctgtgtccgtggcctgtgaggaagatgggaggtgccaatgcatcccaggg
gtggcgggggacaagtgtgaccgctgtcatcacagttactttaactaccagggcagtggc
tgtacacagtgtgagtgtgcccacacccatggcaactgtaacgtgacgacaggcgagtgt
atctgtcctccccacaccagaggagagatgtgtgatctgtgtgaggaaggtcactggggt
cacgacactgtgacaggctgtaagtcatgtaactgcagtgagatgggcagctatgccacc
cagtgtggcatcacaaatgggcagtgccagtgccgctctgatttcgctgggcagaactgt
gaccgctgtgtcatgggctacaggggctacccagaatgcacggtgtgcaactgcaacatc
aacggcaccagagaggagttctgtgatgaggcactgggcgtgtgcagctgtgaggcccca
gggaactgtgtgtgcaaggacaatgtggttggaggtggctgcgatgagtgtaagaaggga
accttgggcctatctgtttctaacccggccggctgcagcccctgcttctgtttcggggtc
tcctcagactgtgaggagctgggtgggatggtccgggtgccgatcacactgggttctgac
ccagagctgctgcgtgtggtcagtcagagtgacctccagggcagtgtagtgggggtctac
taccggaacccagacatgctgctagacactagggacatggagacccccagcctggctgga
ccctactactggaggctgcctaaacactaccagggaaacaagttgttgtcgtatggaggg
aagctatcctacgtggtggcgttctatgctatggacggggccggcctggccaactacgag
cctcaggtcctgatgagggggggtcatctggggaagcaggtcatctacatagacatgcct
gcccctgacaacggggtaacaacccgtcaggacgtcccactgactgagcacaagtggaag
tatttcaactctgtgtcagagaaagctgtgagtcactctgacttcatggcagtcctgagc
cacatcgagtacatcaccatcaaggcatcgtatggtacagggctacagcagagcagaata
tccaatatcactatggatacggccctagaggcggagcaagggttggaggatatggagttg
gcgagtctgatcgagatctgtgaatgtccagctggctacgccggactgtcctgccaggag
tgtgccccgggctactaccgccaaccagtgactgagctgaacaagcgggggaagagaccc
ctgatccagccgtgtgtgccctgccgttgtaacaaccacagccaggcctgtgacctggac
acgggagaatgtctgggctgtcaacacaacacagcaggggagcactgtagcgtgtgttcc
tcggggtactatggcgacgtgaaaggctccgtcagggactgctcgctgtgtgcctgcccc
ctcaaagagaacagcttcagtcctacctgtgctctagagggagtggtgggagacttccgc
tgcaacgcctgcaagcccggctatgaggggcgctactgtgagaggtgttcagtgggttac
tatgggaacccgtctggtccaggagggaggtgtgaggcgtgtcagtgtagtactgcaggt
tctctccatccggcgtgtgactctctgacgggccagtgtgaatgtaaagccggggtcagg
ggacgcctgtgtgaccagtgcgaggcgagacacgtcctggatggggaccagtgtgtcttg
tgtgatgatgagtgtaccagggtgctcctggatgacctggatgcagtagagtgttccttc
ctgtctgtcaacctgaccggggtcatcctgtcaccctacagcacactggtcaacttggag
aacgacacgcaagaggtcaagactctgatgtcttcgtataggagcccagactatcacctg
accagggatgaggaggacatgacaaacctcacccaggacatagacggactgctacagaag
gctatgggtgtgtctgctgatggagaggaagtggcccggtccacagagaacagcgttacc
cagggggccgagcttctggagtacatcaacaccattcagactgctatacaagccctggcg
gagcaagctggccgtctgaacaggacagacaacgtggagatgaacgaggctaagagcaga
cggctaatgaagcaggtggcggccatgttggaaacaatcagagtggtcgacttagcccag
gccaacgccagcatctctacagaactctggttggttagccggtctgccgaggctcctcct
ccagagggtgcagaaagccctccaggagccccagggagtgatagagtcccagaccctcaa
catctccagaagtctgacccaacaccaacagcagctagtggacgccaggcccttctgaac
actgccagggagaacaacaaccacacacacaccctgctgggcagcatcaacaccaactgc
cacagtacaggtctgaggcagaatgtgggccggctgaaccagatggcaaaaacacaactg
gaggagnctcaggacatcctggctgatgctgtcaatctggcagaggacatgagcaccgtc
ccctctcaactggagggggccaaggaacagctggagcagtggaaccccnatttgaggaag
catgtggatgctctggtgatggagctgaggaagcaagaggctctggagctcgtctacaag
gctgaggaccacgcccaagaactgagcaagaaggcccaggctctgcagaggtgtgtgtgt
gtgccggcgagcggcgggctggtgtggcaagatactggggagtgtctggccctgaaaacc
agcactgggggtctcctcgctaacatcagtgatgtgacagacagaatggccttgttgata
aataaccttcataacaccagcagactgatcccagagtcagccttcctgctccatagccgg
cccaacggcaccagtgagcaggtgctggaggccaaagagcaggctgccatggccaactcc
tccctgcagagggcactggagcacctggaggagctcagggtcagactggaggagtccagc
aaggcagtggcccaggccaaaaccagcgtctccaacacaaaccagctgttctctgactca
cactcaaccgccaggactgctgagtctaagctgaatgaggcagagagtcgtaccgagagg
ctgtatgaccgtcttaaacccctgaagaccctgcgggaaaacctgagcagaaacctgtct
gagatcagagagatgatcaaccaggcccgcaaacaggctgcctcgatcaaggtgtcagtg
ctggcagacaaagactgtgtgagggcctacaagcctgagatgtcctccagtaacttcaac
actctaactatgaccgtcaagaccagcgagcctgacaacctgctcttctatatgggcagc
agctccagcgtggacttcatggcagtggagatgcatcgtggcaaggtggggttcttgtgg
gacgcgggttcaggccacgccaaactggagtaccccgacatccagatcaacaacaacaag
tggcatcgcatcaacgccacacgctttgggaggcacggcacgctgtcagtccaccagctg
gagtcagaccccctgcccgcggtcaagaccacctcaccacgctctgctacggtcctggat
gtcaacaagtttaccctcatatttgttggtggcctgggacgccagatcaagacgtcctcg
gcagtgaagatgacccagttcaagggctgtatgggggaggcatcgctcaacgagaagaac
atcgggctgtggaactacgccgagagggagggccagtgtcgcggctgcttcatgagtccg
cagacggaggagacgtccttccactttgatggcagtggctactcagtggtagagaaaccc
ctccgctccacctccacttccatcgtactgctgttcaagaccctctcccccaacggcctg
ctgctctacctggcctccaatgccacgagggacttcctgtccattgagctggtggagggc
caagtccatctaacctttgaacttggctctggtcctctgaccctctcctccaacaaagcc
tataacactggcagctggtacaagatcaccctgcagaggaacaaacgcaaagcttatata
tctgtgatggctgcagacaactcatcagacaaagagattatagaggcagagtctcctggc
tccgcctctgatctcaaccgctccgacctggacccaatctacatcgggggactgcccatg
tctcgacctatcaggagacaagtagtagcacggtcctatgtgggctgcatcaaaaacatg
gagatcgcccgctccaactttgaccttctccgagactcctatggtgtcaagaaaggctgt
gtgttagagccaatccgcagtgtgtctgtactgagagagggctatgtggagctgccatca
atgtctcttggctcccagggggagctgctggcctccttctccacccgcaaccacactggc
atcatcctggcaggcttcagcaaggcaggcacccgcaaacgcagacaggcacgccagccc
atcctggcggtcatgctggtgtcggggcacttggaggttcacgtcaacatggtggagggc
gggagcgtccacaaggttgtggtcaaatcacgctctgggagcttcagtgacggacaggag
cactctgtcatcctacagaggaacaggaagacgatgacggtactggtggatgaggaccac
caggagacagtgcgcctgtcctcggagaaggcctctctgaccttctcctctctgtacatg
ggtggcctcccgccagaagagggcgtcggactgctacgaaccacttcctccttctatggc
tgcatcaggaacctggccctggatgccaagttgttggacctgtcagctgcagtgaagtac
cacaatgtggacatggacagctgtctattggaggagaggcctaagagggtcttcctacct
gatgacactgacctggaggccgagcccaccctggacccttccagaccccctccaccaccc
cccactcagctcagcgctctcacccccggcacgctcacgtgtgcatcgatggacaacagc
acatccctcccagaggccaatcagtttggcatctccagacacagtcataaggtcctcaac
atcaaccccaacacagtgaggaggagtttctctctggagctgtctgtgcgtacctttacc
cagagtggtttgatctactacatggcccacgccaaccagatggactacgccactctgcag
ctgctagggggtcgtctgttcttcacctgtgacaagggcagcggccccgccaccgcctcc
ttccctgtgccggtcaacgacggccagtggcacacagtgaagacagacttcaataagaag
agtgtggtaatcagtgtagacagccaggcgtcagctccagtgctggctaaaggcaacact
ctggatgtggagaacaagctgtacctgggaggactgccccatacctacactgccaagaag
ataggcaacgtgacccacagcttggcgggctgcatccagaaggtgatcctgaacagcgtt
gaacttgacacccagagtccagtgtctgaacactcgactgctcactgtttcactgcagcc
caggacgggaccttcttcagtgggagcggatatgctgctctgatgaaagaggggtacaag
gtgggctcagacgtgacggtggcgctggagttccgcagcacggcgcctgacggggtcatc
ctgggggtcagcagcgccaaggtggatgccatcggcctggagcttgccagcggacaggcg
gtgttccacgtgaacaatggcgccgggcgggtgtcggccacgtcgcggctgggccggtgg
ctgtgtgacggtcgctggcacaccctgctggccaagaagaccaagaacgctcttagtctg
agcgtggacggggtcacggtgctcactgacaacccccacccccagtctacctccgctgag
acgaaggacccaatctacgtgggaggcttccctgtcggagtgaaacagaactgcctgact
tccagatcctcattccgtggttgtatgcgtaacatccgcctgatcaagggccacgtgatc
gacatcctggacttcagtaccgcattcaccctccaaggagtgtctccacactcctgccct
gccacataa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112216685
Entry
112216685         CDS       T05605                                 

Definition
(RefSeq) collagen alpha-5(IV) chain-like
  KO
K06237  collagen type IV alpha
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112216685
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112216685
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112216685
   00536 Glycosaminoglycan binding proteins [BR:otw00536]
    112216685
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   112216685
Glycosaminoglycan binding proteins [BR:otw00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   112216685
SSDB
Motif
Pfam: Collagen C4
Other DBs
NCBI-GeneID: 112216685
NCBI-ProteinID: XP_024232436
LinkDB
Position
17
AA seq 1669 aa
MTYFLTFSPLLLSVLLLLLSGIITPAYTDDVCSCTGKSRCHCDGVKGSKGEPGYPGYDGL
PGVVGYPGSEGNPGPFGPKGNLGFPGLSGPKGSRGLPGKPGFSGPPGQPGIPGNEGPMGP
SGTPGCNGTKGDSGYPGLPGVPGPVGLPGVHGLPGFKGDSYYFPPAADIDGHLGPQGRDG
VKGQRGLPGRPGLPGLEGPSGTPGLPGLTGVQGEKGQEGPSPVIPGPRGQKGDQGPPGIP
GQKGIKLYAEGPKELKGEPGDTGEKGCTGQNGLPGRRGYKGNKGDQGEPGALGKPGKDGD
PGTYGIQGEKGDVGYQGPPGTEGSMGDKGDRGPTGPPGDLIQINGRIKGLQGFPGPLGPP
GYTGNQGVIGFPGMKGEPGLSFPGAPGNPGPPGLAGDKGERGEPAPYIIGPPGPTGPPGN
DGPIGDRGPPGIPDLLRGNPGPPGPKGIKGIPGQPGDRGGFGETGEKGDVCRLCMPTNVS
PGPPGPAGEPGRPGDTGRDGDPGSKGSRGVKGLGGPPGPQGPYGLPGVPGSTGPKGDKSP
MSPGDRGPVGSPGAPGVPGSDGTDGVAGYPGLKGQPGLKGNPGPPGPKGDRGDAGSQGIR
GRTGQMGTQGPPGVGPPGGPGQKGNLGVQGLRGRPGDPGEKGSAGETITTTGDPGLKGEK
GHQGNPGPSGNPGINGYPGFPGNFGAKGDRGLSVRGPPGNTGPKGEKGQPGVAGSPGIGS
MGRPGPSGAPGMPGPKGDFRPGLPGLPGRPGPPGEDGSLGLTGDSGLPGLGRSPGLPGRD
GPQGDRGSKGAEGLPGLPGVAGECTLGIPGTPGAVGLKGIIGLTGTRGQKGVQGDSGLPG
RGAPGLIGPFGRPGFDGPPGPGGAAGLNGFRGRDGVPGVPGLRGDMGPSGACGTPGPDGG
PGPGGRLGPKGLMGADGVKGRVGARGPVGDSGAPGDIGVTTYIDVPGDPGDPGPTALRGL
TGAKGDLGVIGHNGASGKDGIPGSAGPQGAVGDPGRDGQKGSPGFNGNPGVAGDMGVPGV
KGEKGGTGGRGEPGSSGRPGPNGVNGVKGEPSLPGPGAKGRQGEKGVPGFPGFPGEKGEM
GVAGRFGTLGAIGPTGPKGREGLQGSRGPPGPAGEKGINGLPGNAGCHGQNGLQGSPGLA
GDPGTAGPRGSQGRDGIPGPAGEKGDMGAPGIGPKGTDGKTGQSGLKGDVGIPGRFGPPG
PSGLLGDIGPPGPPGPMGLSGSPGRDGMCFEGLKGDRGQNGVPGPQGMQGPRGPPGPPGP
GFKGDKGNKGAMGLLGTPGYRGDTGVQGRPGNDGRPGGLGVKGEMGQLGDIGPNGQKGDA
GPAGPVGCLGQKGQSGAPGPKGKDDLTMVVLIPGEQGLPGDLGGRGEPGPTGAQGRNGPP
GLPGPKGVLGLDGPIGLPGFQAAKGDRGFPGPQGIQGEQGTPGAKGPRGSPGPYFAGPIE
DGFLFTRHSQRQNVPQCPGGSNFIYSGYSLLFINGNNRGHGQDLGTLGSCLPRFSTMPFL
FCNTDSTCRYASRNDYSYWLSTDEAMPSDMALISGGSLESYVSRCAVCETKANIIAVHSQ
TNQIPVCPRGWLSLWAGYSFVMQTGAGAEGSGQPLASPGSCLEEFRKIPFIECHGRGTCN
YYTDSYSYWLASLDPENMFSKPRPQTVKGDCPGSIVSRCQVCMKQWQRP
NT seq 5010 nt   +upstreamnt  +downstreamnt
atgacatactttctcactttttccccactgctcctgagcgtcctgttgctactgctcagc
ggcatcatcacacctgcatacacagatgatgtgtgtagctgcaccggaaagtccaggtgt
cactgtgatggagtaaaaggcagtaagggtgagcctgggtatccaggttatgatgggttg
ccaggagtggttggttatccaggttctgaaggtaatcctggaccttttggccctaaggga
aatcttggctttcctggattgtcaggacccaaaggctcacggggtctccctgggaaacct
gggttctctggaccacctgggcagccaggaatcccaggaaatgaaggaccaatggggcca
tcaggaaccccaggatgcaatgggacgaagggggacagtggatacccagggttacctggg
gtgccgggacctgttggattaccaggtgttcatggattgccaggatttaagggagactcc
tactacttcccacccgctgctgacattgatggacatcttggaccgcaagggagagatggt
gtcaagggtcagcgagggttacctggacggccgggtcttcctgggctggagggaccgagc
gggactccaggattacctgggttaacaggtgtacagggagagaagggccaggaaggtcca
agccctgtaattccaggcccaagaggtcaaaagggtgaccaaggccctcccgggatacct
ggacagaagggcataaagctgtatgcagagggacccaaggaactgaagggggagccaggt
gatacaggagagaaggggtgtacaggccagaatggtctccctgggcgtcgtggatataaa
gggaacaaaggcgaccaaggagaacctggggctctggggaaacctgggaaagatggggac
cctgggacctatggaattcagggtgagaaaggtgatgtgggctaccagggacctcctgga
acagaaggttcaatgggtgacaaaggtgaccgcggacccacaggtcctccaggggatttg
attcagatcaatgggagaatcaaaggcttgcagggttttcctgggcccctcggaccccct
ggctatactggtaatcaaggtgtgattggttttcctggaatgaagggggaaccagggttg
tctttccctggggcccctgggaatcctggtccccctggtttagctggggataaaggggag
aggggggagcctgccccctacataattggcccccctggacccactggcccccctggaaac
gatggccccataggcgaccgtggtccccctggaattccagatctgttgagaggcaaccct
ggaccacccggtcctaaaggcatcaaaggcatcccaggacaaccaggagatagaggcggg
ttcggagaaacaggtgagaagggtgatgtctgtcgactctgcatgcccactaatgtgagc
cctggaccaccaggacctgccggagagcctggtaggcctggagatacaggtcgagatggt
gatcctggatccaagggatctagaggagtcaaaggtcttggaggtccaccaggtccacag
ggtccctatggtttaccaggtgtgccaggttctacaggacccaagggggacaaaagtccc
atgtccccaggagacagggggcctgttggctcacctggggctccaggagttcctgggagc
gatgggactgacggggtcgctggatacccaggactgaaaggccagcctgggctaaagggc
aaccctggacctccggggcccaagggtgatcggggcgatgccggctctcagggtatacgt
ggacggacaggccagatggggactcagggccccccaggtgtggggcccccagggggccct
ggacagaagggcaacctgggggtgcaaggcctgcgagggagacctggagatccaggagag
aaaggctcagcgggtgagacgataacaaccacaggagacccaggactgaagggagagaag
ggtcatcaaggcaacccaggaccttcagggaatcctggtataaatggctatcctggcttc
cctggcaatttcggcgccaagggggatagaggtctgtctgtccggggccctcctggaaac
actgggcctaaaggtgagaagggccagccgggggttgctggttccccagggattggtagt
atgggacgaccaggaccatccggagctcccgggatgccaggccctaagggtgatttcaga
ccagggctcccagggctgccaggtagaccaggccccccaggggaggatggttctctgggg
ctgactggagactctggtctgcctgggcttggtagatcgcctggcctaccaggaagagat
ggtccacagggagacagaggcagtaaaggtgctgagggcttgcctggtctgcctggggtt
gctggggagtgtacgctaggcattccaggcactccgggggctgtaggtctcaaaggaatc
attggcttaacagggaccagaggacagaagggggtacagggcgattcaggtctgcctggc
agaggggccccaggattgattgggccgtttggacggcccgggtttgatggacccccggga
cctgggggggctgccggcctgaatggattcagaggaagagatggtgtacctggggtacca
ggcctgagaggagacatggggccatcaggagcgtgtggtacaccaggaccagacggaggc
ccaggaccagggggacgacttggccctaaaggtctgatgggtgctgatggggtgaagggc
cgtgtaggagccaggggacctgtgggagactctggggctcctggagatattggagtcaca
acatacatcgatgtccctggggaccctggggacccaggacctacagctctaaggggctta
acaggtgccaaaggagatctaggtgtgatagggcacaatggagccagtggcaaggatggg
attcccgggagcgccgggccgcaaggtgctgttggcgacccaggcagagatggccagaaa
ggaagtcctggtttcaatggaaatcctggagtcgcaggagatatgggtgtgccaggtgta
aagggtgagaaagggggaacaggaggtcgtggagagcctggttcatcgggaagaccaggc
ccaaatggagtaaatggagtgaaaggagagcccagcctccctggaccaggagctaaagga
cgacaaggagaaaagggagtgccagggtttccaggttttccaggagagaagggggagatg
ggtgtagcagggaggttcggaaccctgggggccatcggccccacaggacccaagggaaga
gaaggactacagggatcacgaggacctccgggaccagccggggagaagggcattaatggt
ctcccaggcaatgctggctgtcatggccagaatggcctgcaagggagcccaggattggct
ggtgacccagggactgcaggccccagaggttcccagggtagagacggcatccctggccca
gcaggagagaaaggagacatgggagcccctggcattggaccaaaaggcacagacggaaag
acgggccaatctggacttaagggggatgtggggatacctggccgctttggccctcctggt
ccctcagggcttttgggggacattggacctccaggcccccctggtcctatgggactgtct
ggaagtcctggccgggatggaatgtgctttgaagggctaaaaggagaccgtggacaaaat
ggtgtccctggaccccaaggtatgcaggggccacggggacctcctggtccaccaggacct
ggctttaaaggagataaagggaacaaaggtgccatgggtcttctgggtacgcctgggtac
agaggagacacaggggtacagggcagaccgggtaatgatggcagaccaggtggtttggga
gtcaaaggggagatgggacagttaggagacatcggaccaaacggtcagaaaggagatgca
ggacctgcaggacctgtaggttgccttggacagaaagggcagtctggagcaccagggcct
aaggggaaagatgatctcaccatggtggtactgatccccggagaacaggggctgccgggt
gacctggggggcagaggagagcctggacccacaggagctcagggacgcaacggaccacca
ggactcccaggtccaaaaggtgtcttgggcctagatgggccaataggactgcctggattc
caggcagccaagggagacagagggttccctggaccacaaggtatccaaggtgagcagggg
actccaggagccaaaggcccccggggctctccaggtccttactttgccgggccaatagag
gatggcttcctattcacccgtcacagccagaggcagaatgtgccccagtgcccagggggc
agcaacttcatctactccggatactccctcctcttcatcaacggcaacaacagaggtcat
ggccaggatctgggtacactgggaagctgtctgcctcgtttctctaccatgcccttctta
ttctgcaacacggacagcacgtgccgctacgcctcccgtaacgactactcctactggctg
tccacggatgaggccatgccaagcgacatggccctcatctctggtggttcactggagagc
tatgtcagcaggtgtgcagtgtgtgagaccaaagcaaacatcatcgctgttcacagtcag
accaaccagatccctgtttgtccacgcggctggctctctctctgggctggctactctttt
gtcatgcaaacaggggctggagcggagggctctggccagcccctggcctctccgggctcc
tgcctagaagagttccggaagattcctttcattgagtgccatgggcgagggacatgcaac
tactacactgactcctacagttactggctggcctccctggaccccgaaaacatgttcagt
aaacccaggcctcagacagtgaagggagactgcccgggtagtatagtcagtcgttgtcag
gtctgtatgaagcagtggcagcgaccctaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112216718
Entry
112216718         CDS       T05605                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: vitronectin-like
  KO
K06251  vitronectin
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112216718
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112216718
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112216718
   00536 Glycosaminoglycan binding proteins [BR:otw00536]
    112216718
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   112216718
Glycosaminoglycan binding proteins [BR:otw00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   112216718
SSDB
Motif
Pfam: Hemopexin Somatomedin_B
Other DBs
NCBI-GeneID: 112216718
NCBI-ProteinID: XP_024232507
LinkDB
Position
17
AA seq 450 aa
MKLSVVLLALALASAFAAEESCVGRCHSFNRMAKCQCDSMCRYYSSCCMDFDSACPRKIA
RGDTFDAPEDNVVNTPTTAVNTTAVPTTTLAPTTTTHTPTLPPDPEAVPCSGKPFDAFLQ
LKNGSIYAFRGDYFFELDERAVVPGYPKLIYDKWGIRGPIDAAFTRINCQGKTYIFKGNK
YWRFEDDVLDADYPRDISVGFEKVPTDVDAAFAIPAPGHHGKEKVYFFKGDQYYQYEFKH
QPSHEECVRLTKSSPSVLFTRYTDLYCDDTWENLFTMLFQGLHGHKKGPRFINKDWVGIK
SPIDAAMVGRLYISPKPTPSPSPTPRRXANRWRKDRRRGQRGRARQSRSAYFEDFFLDDH
DWMGGGFTYDSDYSDYTPTHTTHDKTLPVQNVYFFKKDKYYRVDLQTKHIDFASPPYPRS
IAKYWLGCKQESGPDREEIDRHYEPMAEKK
NT seq 1353 nt   +upstreamnt  +downstreamnt
atgaagttgtcagttgttctgctggcacttgcactggcctctgcgtttgctgcagaggag
tcgtgtgtgggtcgctgtcacagcttcaaccgcatggccaagtgccagtgtgactccatg
tgtcgctactacagcagctgctgcatggacttcgacagtgcctgccctaggaagattgcc
cgcggtgacacatttgatgccccagaggacaatgtagtgaacacccccactacagcagtg
aacacaactgctgtccccaccaccaccctggccccgaccaccaccacccatacccccacc
ctcccccctgacccagaggcagtgccctgcagcgggaagcccttcgacgccttcctccag
ctcaagaacggatccatctacgccttcagaggtgattatttctttgagctcgatgagagg
gcggttgtccccggttaccccaaactgatctacgacaagtggggcatcagaggacctata
gatgctgcctttactcgcatcaactgccagggcaagacctacatcttcaaaggaaataag
tattggcgttttgaggatgatgttctggatgccgattaccctcgggacatctctgtaggg
tttgagaaggttccaactgacgtcgacgctgccttcgccataccagctcccggtcaccat
ggcaaagagaaggtctacttcttcaaaggggaccagtactaccagtatgagtttaagcac
cagccgtctcacgaagagtgtgtgcgcttgactaagtcgtccccctctgtgctcttcacg
cgctacaccgacctgtactgtgatgatacctgggagaaccttttcacaatgcttttccaa
ggcctgcatggccacaaaaagggcccacggttcatcaataaagactgggtggggatcaag
tcccctatagacgctgccatggtgggccgtctttacatcagccctaaacccactccctcc
ccatcccccacacccaggagatgagccaataggtggaggaaggacaggaggcggggtcag
agaggcagggccagacagagtcgctcagcgtactttgaggatttttttttagatgaccac
gactggatgggaggaggcttcacatatgactctgactacagtgactacacccccacacac
actacacacgacaagacactgcctgtacagaacgtctacttcttcaagaaagataaatac
tacagggtggatctccagaccaaacacattgactttgccagccctccctacccacgatcc
attgccaagtactggctgggctgcaaacaggagtctggcccggacagagaagagatagac
agacattacgagccaatggcagaaaagaaatga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112216823
Entry
112216823         CDS       T05605                                 

Definition
(RefSeq) laminin subunit beta-1-like
  KO
K05636  laminin, beta 1
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112216823
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112216823
SSDB
Motif
Pfam: Laminin_EGF Laminin_N F5_F8_type_C
Other DBs
NCBI-GeneID: 112216823
NCBI-ProteinID: XP_024232688
LinkDB
Position
17
AA seq 1780 aa
MLILLIASLLTLWWRSFAQLPEFGDVCTEGSCYPATGDLLIGRAHQLTASSTCGIEKPER
FCIVGHLEEEKKCFVCDSREMYDERLNHTTSHSIENLVTTFAPNRLKTWWQSENGVENVT
IQLNLEAEFHFTHLIMTFKTFRPATMVIERSMDFGKKWQVYRYYSYNCESAFPGISVGPM
VKVDGIICDSRYSDIEPSAEGEVIFRVLDPAFEIEDPYSPRIQNMLKITNLRVQFSKLHT
LGDNLLDSRDEVTEKYYYALFDMVVRGNCFCYGHASKCAPVDGIHVGTEGMVHGHCMCNH
NTEGLNCEHCKDFYNDLPWRPAEGHNTNACKMCECNHHSRSCHFDMAVYLSTGNVSGGVC
DECQHKTTGRQCEQCRPFYYQHPERHLRDPNICEPCSCDPAGSLQGGACDGRTDVSAGLI
AGQCRCKTSVEGERCDHCRQGHYGLGQGPNGCLQCTCNPLGTLPGGSPCDMDTGNCFCKR
LVTGRNCDQCLPRHWGLSNDMDGCRPCDCDQGGAVNNDCSPISGQCQCREHMYGRRCVQL
ESGYYFIALDHYTYEAEDAKHGPGVTVVPRPYPLNRSPTWTGAGFVNVPEGAHLEFHINN
LPDSMDYDMLIRYEPQLPEQWEQVEIRVIRPYSMRVGQPVSPCENTLPGGDQQSVSLPPG
SRHVVLLRPVCLDKGRNYTLRLSLPLYSSLSDVQSPYTLIDSLVLIPRVRELELFEGSQG
EEAWDTFQRYRCLESSQSVIKSPMTDICNDYIFSVSALYPGAMACQCDSQGSLSAVCDPR
GGQCRCRPNMAGRNCDRCAPATFQFSPSGCRPCECNPVGSVNAFCHEATGQCECVPGASG
RQCAHCLPGYWGFPQCRPCQCNGNSDFCHPQTGECQGCRASTTGHMCERCLDGYHGDPVL
GLGGHCRPCMCPDGPGSGRQYADGCYQTANNYQLVCVCSPGYRGARCDECAPGHHGNPQV
PSGRCLPCQCSGNIDQLDPGSCDARTGVCLKCLHHTEGYGCQRCKLGYYGLAATQSCRRC
MCYSVGTTSEACPSPGECHCDLQTGQCPCRPNVIGQNCDRCAPNTFNIGSGQGCQTCDCD
PTHSFGTLCNELSGQCSCRPGFGGRKCNECRDKFWGDPEVKCQACDCDLRGIASEQCHRS
SGQCVCVEGVSGPRCNQCARGYHGEFPACQRCHQCFGEWDSVVGELTNQAQRLKDHVTEL
QTNGVTAPYTDTVSSLEISANAISGIVENNPAIQKMEDVQQMMQQVTEMVADLNERLNVS
EDSLSRLVVNANYTEASLDTLREQAQELERTVKDIGDRIKTVKNSNIEGAMDTITDAHLE
SKRAEIRVNQTTSYPDNTLEQSATLRREAEARLSQNQAEFDLRQQKHTERLERLTMELET
LDLSELSKQTCGAAGGEEGCAASPCGGVGCVSEDGTHRCGGDGCDGLVTQTQSTLKTAKD
FDQEILSTMQEVDKLSRMVWEVKVHADEAKLSAREVLLKSNQSRDGVEHTNKQLRSLIKE
IRDLLTNDRANVEVIEAVSNEVLALKMPTSPGQLEALTKEIRDRVGTLTSVEDILSQSAN
DIHTTERLLEQARTASQEASEVKETADLVKEALDTTKHAQNAAIDAVKQAYNNTRGTLDL
ITSVESETAESELRLSNATLRLLQLERDVTLLRESSLDTSHRTQNTERLSETAKQDAERA
LQEFDSEVKGQYSVVEGLVVTKAVGVSDAKKRAELLQQEAKELLTQTSGKLQRLRELERS
YAANQRTLEAKAGQLSGLEKTARQLLDDISQKVMIYSTCS
NT seq 5343 nt   +upstreamnt  +downstreamnt
atgttgatattgctcatcgcatcacttttgaccctctggtggcggtcctttgcgcagctg
ccggagtttggggatgtgtgcactgaggggagctgctaccccgccaccggggaccttctg
atcggccgtgcgcaccagctcacagcctcctccacctgcggcattgagaagcctgaacgc
ttttgcattgttggtcacctggaggaggagaagaagtgttttgtgtgtgactccagggag
atgtatgatgagaggctgaaccacaccaccagccacagcatcgaaaacttggtcaccacc
tttgcccccaaccgcctcaagacctggtggcagtctgagaatggcgtggagaatgtgacc
attcaactgaacctggaagctgagttccacttcacacatctcatcatgacctttaagacg
ttccgtccggctaccatggtgatcgagcgttccatggattttgggaagaagtggcaggtg
taccgttactatagctayaactgtgagtccgccttccctgggatatccgtgggacccatg
gtcaaagtggacggcatcatctgtgactcccgctactctgacatagagccatccgcagag
ggagaggtgatattcagggtgctggacccrgcgtttgagattgaagacccttacagtccc
aggatacagaacatgctgaagatcactaacctgcgtgtccagtttagtaagctccacaca
ctgggtgacaacctgctggactccagagacgaggtcacagagaaatactattatgccctc
ttcgacatggtcgtccgcggcaactgcttctgctacggacatgcctccaagtgtgcccct
gtcgatgggatacatgtaggcacagagggcatggtccatggtcactgcatgtgtaaccac
aacacagagggtctgaactgtgagcactgtaaggacttctacaacgacctgccctggagg
cctgcagagggacacaacaccaatgcctgcaagatgtgcgagtgtaaccaccactccagg
tcatgtcactttgacatggctgtgtatctgtctacggggaacgtgagtggaggagtgtgt
gatgagtgtcaacacaagaccacggggcgtcagtgtgagcaatgcagacccttctactac
cagcaccccgaaagacacctgagagaccccaacatctgtgaaccgtgtagctgtgacccg
gcgggctccctgcagggtggtgcgtgtgacggccggacagacgtgtctgctggtctgata
gcaggacagtgtcgctgtaagaccagtgtggagggagagcgctgcgaccactgtagacag
ggacactacggcctgggacagggcccaaacggctgcctgcagtgtacatgtaaccctctg
ggcacgctacctggaggaagcccatgtgacatggacacaggaaactgcttctgcaaacgc
cttgtcaccggcaggaactgtgaccagtgtctgccacgtcactgggggctgagcaatgac
atggacggctgcagaccatgtgactgcgaccagggcggagccgtcaacaatgattgttct
ccgatatcaggccagtgtcagtgtcgagaacacatgtatgggaggcgttgtgtccagctg
gagtcgggatactacttcatcgccctggaccactacacctacgaggccgaggacgccaag
cacggccctggtgtgacggtggttcccaggccctatcctctgaaccgtagtcctacctgg
acaggggcagggtttgtcaacgtacctgagggagcccacctggagttccacatcaacaac
ctacctgactccatggactatgacatgctgatccgctatgaaccacaattgcctgagcag
tgggagcaggtggagatcagagtgatacgtccatactcaatgagagtggggcagccagtc
agtccttgtgaaaacacgctaccaggaggagatcagcagtcggtgtctcttcctccagga
tccagacatgtggtgctcctgaggcctgtgtgtctggacaagggacggaactacaccctg
cgtctcagtctgcctctctactcctctctcagtgacgtccaaagcccctacacactcatc
gactccttggtgttgattccgcgggtacgtgagctggagttgtttgagggttctcagggc
gaggaggcgtgggatacgttccagaggtaccgctgtctggagagcagccagagcgtcatc
aagagccccatgacggacatctgtaacgactacatcttcagtgtgtctgctctgtaccca
ggggctatggcgtgccagtgtgactcccagggctcgctcagtgcggtgtgcgaccccaga
ggcgggcagtgccggtgtcgacccaacatggcgggcaggaactgtgaccgctgtgccccc
gccaccttccagttcagcccctcaggatgccgaccctgtgagtgtaaccctgtgggctct
gtgaacgctttctgccacgaggccacaggtcagtgtgagtgtgtgccaggggcatcaggg
cgtcagtgtgcccactgcctgccaggctactggggcttccctcaatgccggccctgccag
tgcaacggcaacagcgacttctgccaccctcagactggggagtgccagggctgccgtgcc
tccaccaccgggcacatgtgtgaaaggtgtctggatggttaccatggcgaccccgtgttg
ggtttggggggtcactgccgcccctgcatgtgtccagatgggccggggagcggacgccag
tatgcagatggctgctaccagaccgccaacaactaccagctagtctgtgtctgcagccct
ggatacagaggagccaggtgtgacgagtgtgccccaggacaccatggtaacccccaggtg
cccagcgggcgctgtctgccctgccagtgtagcggcaacattgaccagctggacccgggg
tcctgcgacgctcgcacaggcgtctgcctcaaatgcctgcaccataccgagggctatggc
tgccagcgctgcaagctgggttactacggccttgccgccacccagagttgcaggaggtgt
atgtgttattcagtgggcacgacgtcggaggcgtgtccatccccgggggagtgtcactgt
gacctgcagactggccagtgtccctgccggcctaacgtgattggccagaactgtgaccgc
tgtgcccctaatacgttcaacataggaagcggacagggctgccagacatgtgactgtgac
ccaacccactcctttgggacgttgtgcaacgagctgtcggggcagtgctcatgcaggcca
ggttttgggggaagaaaatgcaacgaatgccgagataagttctggggagatcctgaggtc
aaatgtcaagcttgtgactgtgacctgcgtggcatcgccagcgagcagtgccaccgttcg
tccggccagtgtgtgtgtgtggagggtgtttctggaccccggtgtaaccagtgtgccaga
gggtaccatggggagttccccgcctgccaacgatgccaccagtgcttcggcgagtgggac
agcgtggtaggggaactgaccaaccaggcgcagcgtttgaaggatcatgtgacagagctc
cagaccaatggggtgacggcgccgtacacagacaccgtcagcagtctggagattagtgct
aatgctatcagtgggatagtagagaacaaccctgctatacagaagatggaagatgtacaa
cagatgatgcagcaggtcactgagatggtggcagacctgaacgagaggctgaacgtctca
gaggattccctgtcccgtctcgttgtaaatgccaactacactgaggccagtctggacaca
ctgagagagcaggcccaagagctagagagaacagtcaaagacattggagaccgcataaag
actgtgaagaactctaacatagagggagcgatggacaccatcaccgatgcccacttggag
tctaagagggcggagatccgtgtcaatcagaccaccagttaccccgacaacactttggaa
cagtcggctacactacggcgcgaagcggaggccagactgagccagaaccaggcggagttt
gacctgagacaacagaaacacacagagagactggagaggcttaccatggagctcgaaact
cttgacctatcagagctcagcaagcagacatgtggagcggctggtggggaggaggggtgc
gctgcgtcaccctgtggaggggtggggtgtgtgtcggaggacggcacccatcgctgtggt
ggagatgggtgtgacggtctggtcacacagacacaaagcactctgaaaacagccaaggac
ttcgaccaggaaatcctgtccaccatgcaggaagtggataagctctctagaatggtgtgg
gaggtgaaggtgcatgcggacgaggccaagctgagtgctcgggaggtgctgctgaagtcc
aaccagagccgagatggagtggagcacaccaacaagcagctccgcagcctcatcaaggag
atacgagacctactcactaacgaccgtgccaacgtggaggttatcgaagcggtgtcgaac
gaggtgttggccctgaagatgcccacgtcgcccgggcagctggaggccctgaccaaggag
atcagagaccgggtgggaaccctcaccagcgtggaggacatcctcagtcagagtgccaac
gacatacacactacagagaggctgctggagcaggctcgcactgccagtcaggaggcgtct
gaggtgaaggagacagctgacctggtgaaggaggctctggatacaactaagcatgctcag
aatgctgccatcgacgccgtcaagcaggcctacaacaacaccaggggtacacttgacctc
atcacgtctgtggagtcggagactgcggagtcagagctgcgtctgagtaatgccacactg
cgtctgctgcagctggagagagacgtgactctgctgagagagagcagcctggacaccagc
caccgcacacagaacactgagagactgtctgagaccgccaagcaggacgcagagcgggcc
ctgcaggagtttgactcggaggtgaagggtcagtacagtgttgtggagggcttggtggtg
acgaaggcagtgggcgtgtctgatgccaagaagagggcggagctactccagcaggaggcc
aaggagctgctcacccagaccagcggaaaactacagagactcagagagttggagaggtca
tatgcagccaaccagcgtactctagaggccaaggcaggtcagctgtccgggctggagaaa
acggcacgccagctgctcgatgacatcagccagaaagtcatgatctacagcacctgttct
tag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112217524
Entry
112217524         CDS       T05605                                 

Definition
(RefSeq) laminin subunit alpha-4-like
  KO
K06241  laminin, alpha 4
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112217524
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112217524
SSDB
Motif
Pfam: Laminin_G_2 Laminin_G_1 Laminin_II Laminin_EGF Laminin_I Laminin_G_3
Other DBs
NCBI-GeneID: 112217524
NCBI-ProteinID: XP_024233624
LinkDB
Position
18
AA seq 1879 aa
MSATRALPCLCLLFSIILSGIVCPAAPNGLDLEQRSVVKVCAKGYFLSNQNKCLPCNCKG
HSETCEEITGICISCQDHTTGNFCEICEDGYMPDVNTYGRHSCRPCACPLSIPSNNFAEH
CDRSSNILRCKCQEGYAGHYCERCAPGFSGNPMMIGDSCKRCDCNGNSDPNHIFNECHNV
TGFCQNCWGDTSGANCERCAPGFYGDAISAKNCRACECSKCGTGSCDDRTGTCHCKPGVT
GRLCDRCEEGHTGFNGCQGCRRCDCGAAGLRPTCHPLTHSCQCQPGAGGRYCERCLPDHW
NYGPSGCQKCDCASGHCDMHTGECLPEAAMVNPCNISCDECIWHLTGDLRLSNKTLDQVK
VSVLNISTGAAANDRLKYYNYTAHRLQTQFMNWRNKSSMMRTQTGQLEEASAALLSDMNH
LAETESVVKSMGDRVDEDTLQSVTLADELTTNLTTLNVLLEEMISDWELYSVHQDLDPEV
IRKKTAMAEGMVTLMKKLDLSPREPTATDESTEAHDLLRNVRQLEKKLISTEGRMAPVRE
GLSRFTKKLSEAQEILQKAANTVQETEDMNKANTVKFQRSEAKQQILVENYEAVNDTLQT
AEDLVKDTENTVAEMVLLVQNVTEYHAAIDGASKLLQEKTEALSLADRDLVQRAQDHAKD
LQSQATELEYDLKGSDANGFVQKALVAANVYNNIVQYIEEANITGLTTLDLATRAEDATN
GINTQLGFLKTQRDNIFKESISLHSEQLEVETEVLDKIKYIEETKETMDDNTKKLEEVLK
DIKEIESGRTTKRLELTREVAEGTLNRSVEVLQTITPIHEKVEEWATNMKNQDYSAAAFD
RAVVSAGKAVENLSELVPELLDKLRVIEKKPVNNVTTNIMRIRELIAQARSVAKKVQVSM
KFNGQSSVEVQPHINVADLKTVTTISLFIRVDPDKDPIEDRFIFYLGDRNGKKDYMGLAI
KNDNLVYIYNLGGEDVEIPLGSKPVSQWPPVFNLIKVERLGRHGKVFLTVPSQTSTDEQK
FIQKGEAFGTDSLFNLDPEDTVFFVGGVPADVRLPPALSLAPFVGCIELASLNNDVISLY
NFKQTHKMDVVASTPCPRYKLAFSQSRIASYLFDGTGYALINNMERRGKFGIVTRFDIAV
RTVANNGILLLMVTGDKFFLLELKNGFLRLMYDFGFSGGPIVMESNLPKLQINDARYHEV
SVIYHYSKKIILLVDKSHVKSMENEKKTLPFSDIYIGGAPSRILLSRPELSSLMGLKGCV
KGFQFQKKDFNLLEEPGTIGISSGCPEESFMSRKAYFTGESYLGSAAKISPFDAFEGGLN
FRTLQPTGLLFYHTEGSDEFTIALENGAVVLNSRGTRVKSHKKQYNDGMTHFLVASANND
KYELVVDDKDKHEKKRPSSPASASTVRSFYLGGSPSSSIKNFTGCISYAYISRQDRDIEP
EDFQKYTENVQTSLQDCPVERPPAALLSKHKNSAKSNQGHTRKVGRDKINQPQGLLGLNS
DDQEPGETEETPCYLSARPHATRHAHHYGGIANSRQEYTDIPESLAERSHFSLSLKTQSS
FGLIFYASDEAEDNYMALFLSHGKLMYTFNLGQEQVKVKSPEKYNDGTWHNVIFIRDGNL
GRLIIDGLTLLEDRAQGSNVSWHVSSTLYVGGVPPGRAQQNILRNSAYSFTGCVKNFQLN
GQWLSSVSQAFGVTPCFEGLYEPGTYFSEEGGYVVLDDTFNLGRRFELVVEVRPRVASGV
LLHVYTAAEEYLTMYIHQGAVVVLVNNGVREFFTQVTPRLGLCDGSWHRITVIRDANVIQ
LDVDSDVNHVVGPLYHSTQNARAPVFIGGAPESLLPEGIATRRAYTGCVRNLTVNESQVA
FSKAALVSGAVSVGSCPAA
NT seq 5640 nt   +upstreamnt  +downstreamnt
atgtctgctactagagctctgccatgcctctgccttcttttctccatcatcctctcaggg
atcgtctgcccagcggctcccaacggtttagatttggaacagcgttcggtggtaaaagtg
tgtgcaaaaggatatttcctcagtaaccagaacaaatgcctaccatgtaactgcaaaggc
cattcagaaacctgtgaggagatcactggtatttgtatatcatgtcaggaccacaccact
gggaatttctgtgagatctgtgaagacggatacatgcctgatgtcaacacatacggacgt
cactcctgccggccgtgcgcctgtcccctctcgatcccctccaacaactttgcagagcac
tgtgacagaagcagtaacatcctacggtgcaagtgccaagagggctatgctggacattac
tgtgagagatgtgctccaggtttctctggcaaccccatgatgattggtgactcctgtaag
aggtgtgactgtaacggtaattcggaccccaaccacatcttcaatgagtgccacaacgtg
accggcttctgtcagaactgctggggggacacgtctggagccaactgtgaacggtgtgcc
ccgggtttctacggtgatgccatcagtgccaagaactgcagagcgtgtgagtgcagcaag
tgcgggacaggatcgtgtgacgacaggaccgggacgtgtcactgtaagcctggcgtcacc
ggccgactctgtgaccgatgtgaggagggtcacacaggtttcaacggttgccagggctgc
cggaggtgtgactgtggggctgccggtctccggcctacttgtcatcctctgacccacagc
tgccagtgccaaccaggggccggaggccgatactgcgagcgctgcctcccagaccactgg
aactacggcccctcagggtgccagaaatgtgactgtgctagcgggcactgtgacatgcac
actggggagtgtttgccagaagcagccatggtcaacccctgcaacatcagttgtgatgag
tgtatctggcacctgactggtgacctgaggctgtccaataagacgctggaccaggtgaag
gtcagtgtgttgaacatctccactggggctgcagccaatgacaggctcaagtactacaac
tacaccgcccaccgtctgcagactcagtttatgaactggagaaataagtcatctatgatg
aggacacagacagggcagctggaggaggccagtgctgctctactctcagacatgaaccat
ctggcagagacggagagtgtagtgaagtccatgggggaccgagtggatgaagacacacta
caaagcgtcactctggctgacgagctgaccactaacctcaccactctcaacgtactcctt
gaagaaatgatcagtgactgggagctctacagtgtccatcaagacctggacccagaggtc
atcagaaagaagacggccatggccgagggcatggtgacattgatgaagaaactggacctg
tccccacgagagcccaccgccaccgatgagtccacggaggcccacgacctccttagaaac
gtgcgtcagctggagaagaagctgatcagtacggaaggccgcatggccccggtacgggag
gggctctcccgcttcaccaaaaagctctctgaggcccaggagatcctccagaaggctgcc
aacactgtgcaggagacggaggacatgaacaaagccaacaccgtcaaattccagaggagt
gaggccaagcagcagatactggtggagaactacgaagctgtgaatgacaccttgcagaca
gctgaagacctcgtcaaggacactgagaatactgttgctgagatggttctcctggtgcag
aacgtgactgagtaccacgctgcgatcgatggcgccagcaagctgctgcaggagaagact
gaggcactgtccctggcagacagagacctagtccagagagcccaggaccacgcaaaggat
ctacagagtcaagctacagagctggagtatgacctgaaaggcagcgatgccaacggattc
gtgcagaaggctctggttgcagccaatgtgtacaacaacatagtccagtacatcgaagag
gccaacatcactggactgacaacactggatttagcaacaagagctgaggatgccaccaac
gggatcaacacacagctggggttcctgaagacccagagagacaacatcttcaaggaatct
atttcattgcattctgagcaacttgaggttgaaactgaggttctggacaagattaaatat
attgaggagaccaaggagaccatggatgacaacaccaaaaaactagaggaagtactgaaa
gacatcaaggaaattgagtcaggcagaaccaccaagcgtctggagctcaccagggaggtg
gctgaaggcaccctgaaccgctctgtggaggtcctgcagaccatcacccccatccacgag
aaggtggaggagtgggccaccaacatgaagaaccaagattactctgctgcagcctttgac
cgtgctgtagtctctgctgggaaagcagttgagaacctgtctgagctggttcctgagctg
ctggacaagctgcgtgtcattgagaagaagccagtgaacaatgtgaccaccaacatcatg
aggatcagagagctcatcgcccaggccaggagtgtggccaagaaggtccaagtgtccatg
aagttcaacggtcagtcgtcggttgaagtgcagccccacatcaacgtggcagaccttaag
acagtgaccaccatcagtctgttcatcagggtggacccagataaggaccctattgaggac
cgcttcatcttctatctgggagacagaaacggtaagaaggactacatgggtctggccatc
aagaatgacaacctggtgtacatctacaacctgggaggggaagatgttgaaatcccgctg
ggttcaaagcctgtcagccaatggcctccagtcttcaacctcatcaaagtggagaggctg
ggcagacatggaaaagtgttcctgactgtgcccagtcagacatccactgacgagcagaag
ttcatccaaaagggcgaagcctttggcaccgactccctgttcaacctggaccctgaagac
actgtcttcttcgtgggtggcgtccccgctgacgtcaggcttccacctgcactcagccta
gctccttttgtgggctgcatcgagttggcctctttaaataatgatgtcatcagtctttac
aatttcaaacagacgcacaagatggatgtagttgcttcaacaccttgtcccaggtataag
ctggcattctcgcagagtcgtatcgccagctacctgtttgacggaactggatatgccctc
atcaacaacatggagaggaggggtaaatttggcatcgtcacccggtttgacattgctgtt
cggacagtagcaaacaacggcatcctgttactcatggtcaccggggacaagttcttcctg
ttagagttgaagaatggcttcctacgtctcatgtatgactttggcttcagcggaggcccg
atcgtcatggagagtaacttacctaaactacagatcaatgacgcaagataccatgaggtg
tcagtcatctatcattactccaagaagatcattctattggtggacaagagtcacgtgaag
tccatggagaatgaaaaaaaaacattgcccttctccgatatctacataggaggggccccc
tcgcgcattctcctctccaggcctgagctatcctcccttatggggctgaagggctgtgtg
aagggcttccagttccagaagaaagactttaacctcctggaggaaccaggcactattggc
atcagcagcggttgtcctgaggagtcctttatgtcccgtaaagcctacttcactggagag
agctacctggggtctgcagcaaagatatctcccttcgacgccttcgagggtggcctgaac
ttcaggacactgcagcctactggtctcctgttctaccacaccgaggggtctgatgagttt
accatcgctctggagaacggagcagtggtattgaactccaggggcaccagagtcaaatca
cacaagaagcagtacaacgatggaatgacccatttcctggtagcttcagcgaataatgac
aaatatgagctggtggtggatgacaaagacaagcatgagaagaaacgtccgtcctccccc
gcctcagcctccacagtgaggagcttctacttaggaggctctcccagtagcagcatcaag
aacttcactggctgcatcagctacgcctacatcagcagacaagacagggacattgagcct
gaggactttcagaagtacactgagaatgtccagacctccctgcaggactgccctgtggag
cgaccgcccgctgccctgctctcaaagcacaaaaactctgccaaatccaaccagggccat
actaggaaggtgggcagagacaagatcaaccagccacaaggcctgttgggactgaacagt
gatgaccaggagccaggagagacagaagagacaccatgctacctgtccgccaggccccat
gccacccgccacgcccaccactacgggggtatcgccaacagcaggcaggagtacactgac
atcccagagtccctcgctgagaggtctcacttctccctgtccctgaagacccagtcctcg
ttcggcctcatcttttatgcatcagacgaggcagaggacaactacatggctctgtttctt
tcccatgggaagctgatgtacaccttcaacctgggtcaagaacaggtcaaggtcaagagc
ccggagaagtacaacgacggaacatggcacaatgttatttttattcgtgatgggaatctg
ggccgattaatcattgatgggctgacactgctggaggatagagctcagggctccaacgtc
tcctggcacgtcagcagtaccctctatgtgggaggggtgccaccagggagggcccagcag
aacatactgagaaactctgcgtacagcttcactggctgtgtgaagaacttccagttgaat
ggccaatggctgtcctccgtgtcccaggccttcggggtgacgccgtgcttcgagggactc
tatgagccggggacatacttctctgaagagggaggatatgtcgtcttggatgacacgttc
aacctggggcggaggtttgagctggtggtagaggtgcgccctcgtgtggcgtcaggggta
ctactgcatgtctacacagcagcagaggagtacttaacgatgtatattcatcaaggagcg
gtggtggtgctggtgaacaatggggtccgtgagttcttcactcaggtcactcctagactg
ggtctgtgtgatgggagctggcacaggatcacagtgatccgagatgccaatgtaatccag
ctggatgtggactcagatgtcaaccatgtggtgggacctctctaccacagtacccagaat
gccagggcccctgtgttcattggtggagctccagaatctcttctcccagagggcattgcc
actaggagggcctacacaggctgtgtgaggaacctgacggtgaacgagagccaagtggcc
ttcagcaaagcggccctggtcagcggggctgtcagtgtgggctcctgtccagctgcctaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112217557
Entry
112217557         CDS       T05605                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: laminin subunit alpha-2-like
  KO
K05637  laminin, alpha 1/2
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112217557
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112217557
SSDB
Motif
Pfam: Laminin_G_1 Laminin_G_2 Laminin_EGF Laminin_N Laminin_B Laminin_I Laminin_II Laminin_G_3 DUF745
Other DBs
NCBI-GeneID: 112217557
NCBI-ProteinID: XP_024233678
LinkDB
Position
18
AA seq 3184 aa
MKGLSFFTLIALLWQCSRAQQRGLFPAVLNLASMADISTNATCGETGPEMYCKLVEHVPG
QQVRNTQCRICNDNSERQFERHPIEYAIDGTNRWWQSPSIKNGMDYHYVTVTLDLQQVFQ
IAYMILKAANSPRPGNWVLERSLDGVTFTPWQYYAITDTECLTRFNILPRTGPPSYTRDD
EVICTSFYSKIQPLENGEIHTSLINGRPSADDPSPTLLNFTSARYIRLQFQRIRTLNADL
MTLAFNDPRDVDPIVTRRYYYSIKDISVGGMCICYGHAKACPLNNQTKKFSCECEHNTCG
ESCDRCCPGYNQKPWMAGTFLTRHVCEKCNCHGKSEECYFNQTVAGNKQSLNSQGEYVGG
GVCVGCTRNTAGVNCQTCADSYYRATGLSPEESDPCQPCSCDPEGSLSPACVPDQSQAEG
DLTAGSCHCKQGYGGQQCDRCTFGYSGYPKCIRCNCSLDGSRNKDPCLLPCVCKMNVRGG
ELRRCKLGFYHLLGERLHGCEKCYCSGXASDCSDSHWTYHNETSMAGWSLTAEDGEGKVW
PAASRDRDRSQTLRIDNQEARRHLPAIYYWSAPGEYLGNKLPAYGGSLVYTVSYDAGEKD
QDIRVNSSPNVIIEGGGIKMIDSRFGLPVYPFSESTKRTLLYPDHFENQETGLPVSKRDF
MMALTNVSSLLIRASHSNERVAIYRLHSVSLEVASEFPSSEKMANAVEMCQCPPGYGGTS
CEMCSSGHRRVNSTLFKGVCEPCDCQGHATNCDDITGQCLGCTDHTTGFHCDECIPGFYG
DATKGTANDCLPCACPLNIPSNNFSPTCHVDPRGELICDRCQPGHTGPRCDRCSNGYFGQ
PTVKGGSCQLCQCNGNLDLASPRSCDPITGSCLRCRDGYGGTTCDTCAEGFYGDAIKAKN
CQHCQCHNNGSVSEVCHQENGQCPCKQHVVGRQCDECMPQTYGIQSAGVCAPCNCNSFGS
KSFDCDESGQCRCQPGVTGPKCDRCAPGHFNFQEGGCAPCQCTHVGNNCDANTGQCVCPP
NTVGERCDKCAPNHWGHDIMAGCKACGCNQVGSVTQQCNPNTGCCMCRDQFQGEKCSECK
LGYRDFPQCISCKCNVAGSDSQTCDADQEVCACADRTGQCSCKVNIQGLKCDQCKSRTFG
LSTSNPLGCSQCYCFGMSSTCTEAQGLIRMWLSLKPEQTKLPLVDKANLQETTSGVTFQH
PEIIANADLVTQKLTELYYWRLPEQFHGSMITAYGGKLKYAIYFEGRDETGRTSYEPQVI
IKGGPNRDKVMVRHMQGLQIGQLTRHEIDMTEHEWKYEDKKAMTREDFMDVLFYVDYVLI
KASHGNMMRHSRISEISMEVAEEGRPSVESERAHQIEKCDCPLGYSGLSCEECGAGFYRL
SARSGGAASRAGIGSCAQCQCNRHSEACDPETSICQNCQHDTEGDRCERCAPGYYGVVRG
RPDDCKPCACPLTNHENNFSPTCVTEGFNDYHCTACPEGYEGKYCERCATGYHGDPRAPG
GKCEECKCDPYGAWPQPCDPRSGQCHCRPGATGRTCSQCMERHVCGPSGIVSCDDDCAGL
LIRDMDRLHRIITSVNLTTPLPPPYKVLYRFENMTQELKHMLSPQNSPERRLQLADSNLG
SLVTEMDDLLSRATKVSADGEQTGDDANRIHKRAEDLELFVKNTLLAAEVLKVKAKELNE
TLGRRNGAPEKSLNEMHQEIETMLAELRKRQLGGKKHISEEELGLAEALYQKVKRLFGDP
HQATEDLKAEVTEKMGDHRAKLDDAQALMKDAQGKSREAGALSGQNQRNLTTLERKRDAV
SSVKKGTEDVLADGERILAEANGLSDSINKEIEDLEEMEHELGPLHEQLDYRVSRLTQGL
SGNTLTDLRRTLEHAAELNESSNILDRTDRQTDRHNRQAQRLVTDSVIGWCPNQVSCCLL
IASWRKPRTVLNATAAFNAYSNIKDFIEEADKEAKQARHVAHTHTQASGPKGSLKDNAKN
SVRKSAQLWNEAKQLENDVKENAESVGSLQARVKAGGFKNKGLLKDLDDTLRKLNAIPND
TAAKLQATKAKAGDANDTANDVLARLRDMNLSLMGLKKNYSKLEDDVNKANNMIQDPEKN
TIIHAAGAKVKDLEDEADRLLDKLKPIKELQDNLKRNISQIKELINQARKQANSIKVSVS
SGGDCIRAYRPEIKKGRYNTITVNVKTTSPDNLLFYLGSAKYIDFLAIEMRKGKVNFLWD
VGSGVGKVEYPDMTINDGNWHRIEASRNGINGTISVHALEGPKAGIMPTSKSGTSPEGYT
ILDVDQNAYLFVGGMLGSVKKADAVKTTTFSGCMGETYLDNKPIGLWNYRDREGDCKGCV
VSPQPSDTEGTVQFDGEGYAAVSRPTRWNPNVSTVMFKFRSFSTDSLLMYFATKDTKDFM
SAELSDGLVKVSFDLGSGTGSVLSIKRHNDGRWKSFTMARMKKQATVTIVDIDTNEEEKL
VVSSQGSATGLNLKEEERIYFGGLPTIGNYSIKSRSEVTKKRYAGCMRDIEVSRTPYNLL
SSSDYTGLTKGCAVENLHTVSFSKPGHMELRSMSFDVGTEISLSFATKSDKGIILFGSGS
TNGASSQFQLPKRRRRQSGEPFLAVLLNKGSLEVLVFTGSHSPRRVVRKPDQGILHDGRE
HTLRIERLGGRSFAVQVDEELKREQALPNDQPMGIKRLFIGGIPPDVELSSQRPNDPFEG
CIWNLMINTILTDFSQPVAFKNAEIGQCPDLAPPPPPLPLPEEEEEGTKGEDVSQPLQPE
APAVPPPTPTPRQSPPPPTDPPPVVPPELSPATEEPDHGAVTAPPLSCAAEASPVVLEKA
KQFGLSKNSHVAFEFDDTKVKNRLIIEFELRTTAESGLVFYMARINHADFATVQVKEGMA
HLGYDLGHGNTSVSVPRIINDGHWHKIRVMREKQRGILVIDSRYSKQTTSPKKADILDVV
GMLYIGGLPVNYTTKRIGPVLYSINGCIRNFKMLGNVLDMDAPTSSHHVGSCFISTEKGT
YFDGSGYVKAVGSYRVGLDVSLELEFRTSQSNGVLLAVSSQVDTKMEGLGIELHNGKLLF
HVDNGAGRITAEYQPEVEAGLCDGQWHSVTAHKLRHRLEIIVDGRKEEAESPNARSNTAD
TNDPIYVGGYPEGLKQFGLTSSTSFKGCMRNLKITKASKVLEVQFNKGLEFKGVQPLTCP
ANAA
NT seq 9555 nt   +upstreamnt  +downstreamnt
atgaaaggtctatcgttttttacactcatagcgttgctatggcaatgcagccgagcgcag
caaaggggtctgttcccagcggtgctgaacctggcctctatggcagatatcagcaccaac
gctacctgtggagagacaggaccagagatgtactgcaaactggtggagcacgtccccgga
cagcaagtcaggaatacccagtgccgtatctgtaacgacaacagcgagaggcaatttgag
cgtcacccgattgaatatgccatcgatggaactaacagatggtggcagagccccagcatt
aagaacggcatggactaccattacgtcacagtcactctggacttacagcaggtgttccag
atagcctatatgattctgaaggctgccaactcccccaggccaggtaactgggtgctggag
cgttccctggatggggtgacctttaccccctggcagtactatgccatcacagacacagag
tgcctcactcgcttcaacatccttccccgcaccggaccgccatcctacacacgcgacgac
gaggtcatctgcacctctttctactccaaaatccaacccctggagaatggagagatccac
acctctctgatcaatggaaggccgagcgctgatgacccctccccgactttactgaacttc
acctccgcacgctacatccgcctgcagttccagcgaatcagaaccctcaacgctgacctc
atgaccctggccttcaacgacccccgcgatgttgaccccatcgtgacccggcggtattac
tactctatcaaagacatctcagttggagggatgtgtatctgctatggccatgctaaagcc
tgtcctctgaacaaccagaccaagaaattcagctgtgagtgtgaacacaacacgtgcggg
gagagctgtgaccgctgttgccccggatacaaccagaaaccctggatggctgggaccttc
ctcactcgccacgtctgtgagaagtgtaactgccatgggaaatctgaggagtgttacttc
aaccagacagtggcaggcaacaaacagagcctgaactcccagggggagtacgtgggggga
ggggtgtgtgtagggtgcaccaggaacacagccggagtcaactgccagacctgtgctgat
agctactacagagccactgggttgagtccagaggaatccgacccgtgtcagccctgctcc
tgtgacccagaaggttctctgtccccagcatgcgttccagaccagtcccaggctgaagga
gacctcacggctggatcctgccactgtaagcagggttacgggggacagcagtgtgacagg
tgtacctttggctacagcggctaccccaaatgtatccgctgtaactgcagtctagacgga
agccgaaacaaggatccgtgcctgctgccctgtgtctgcaagatgaatgttagaggggga
gaactgcgacgctgcaaactgggtttctatcatctcctgggcgagcgtctccacggctgt
gagaagtgctactgttccggcntggcgagtgactgctccgattcccactggacataccat
aatgagacatccatggccggctggtccctcacagcagaggatggggaggggaaggtgtgg
cccgccgccagcagagacagagacaggtcccagacactcaggatcgataaccaggaagcc
aggagacaccttcctgctatctactactggagcgcacctggagagtacctgggaaacaag
ctcccagcctatggaggaagtcttgtctatacagtctcatatgatgcaggggagaaagac
caggacatcagggttaactcttctcctaatgtcataatagagggcggcgggataaaaatg
attgacagtcggttcggtctgccggtgtaccctttctcggaaagcacaaagagaactctg
ctctaccctgaccactttgagaatcaggagacaggcctgcctgtcagcaagagagatttc
atgatggctctaactaatgtgagcagcctcctcatcagagcctcacacagcaatgagcgg
gtcgccatctacaggctacattctgtcagtctggaggtggccagtgagttccccagcagt
gagaagatggccaatgctgtggagatgtgtcaatgtccccctggatacggtggaacgtct
tgtgagatgtgttcatcgggtcatcgaagggtcaacagcaccctgttcaaaggagtgtgt
gaaccatgcgactgccaaggccatgccacaaactgtgatgacatcactggacaatgcttg
ggctgcactgaccacaccactggattccactgtgatgaatgtatccctggtttctatggg
gacgctaccaagggaacagccaatgactgcctgccctgcgcctgccccctcaatatcccg
tccaacaatttcagccccacgtgccatgtggacccgcgaggggagctgatatgtgaccga
tgccagccggggcacaccggaccacgctgtgacaggtgctcgaatggctactttggtcag
ccgacggttaagggaggctcgtgccagctctgccagtgtaacggtaacctggacctggcc
tcaccgcggagctgcgaccccatcaccggctcctgtctgaggtgtcgggatggctacggg
ggaaccacctgcgacacctgcgccgaggggttctacggggacgccatcaaggccaaaaac
tgccaacattgccagtgtcacaacaatggctctgtgtcggaggtctgccaccaggagaat
gggcaatgcccatgcaagcagcatgtggtgggacggcagtgtgacgagtgcatgccccag
acttacggcattcagtccgctggagtctgtgccccctgcaactgtaactcctttgggtcc
aagtcctttgactgtgacgagtcgggccagtgccggtgccagcctggtgtcactgggccc
aagtgtgaccgatgcgctccgggacacttcaacttccaggagggtggctgcgcaccgtgc
cagtgcacccatgtggggaataattgcgacgccaacacaggacagtgcgtctgccctccc
aacaccgtgggggagagatgtgacaaatgtgcccccaatcactggggtcatgatatcatg
gcgggctgcaaggcctgtggctgtaaccaggtgggctcagtgacgcagcagtgtaacccc
aacaccggctgctgcatgtgccgggaccagttccagggagagaagtgcagcgagtgtaaa
ctgggctaccgggacttcccacaatgcatttcctgcaaatgcaacgtggcaggttcagac
agccagacttgtgatgcagaccaggaggtgtgcgcctgtgcagacaggactggacaatgc
agctgcaaggtgaatatacagggtctgaagtgtgaccagtgtaagtcgaggactttcggc
ctgagcacaagcaacccactaggctgcagtcagtgttactgctttggtatgtccagcacc
tgtactgaggcacagggcctcatccgcatgtggctgtccctgaaaccagagcagaccaag
ctgcccctagtggacaaagccaacctgcaagagaccacaagcggagtgaccttccagcac
ccagagatcatcgctaatgctgatctggtcacccagaagctgaccgaactctactactgg
agactgcctgaacaattccatggttccatgatcacagcctacggcggcaagctgaagtac
gccatctactttgaggggcgtgacgagacaggccgcacctcctacgaaccccaggtcatc
ataaagggaggacccaacagagacaaggtgatggtccgccacatgcagggactgcagatt
ggacaactcacccggcacgagatcgacatgacagagcacgagtggaagtacgaagacaag
aaggccatgacacgcgaggacttcatggacgtgctgttttatgttgactacgtcctcatc
aaggcttcccatgggaacatgatgagacacagcaggatctctgagatttctatggaggtg
gcagaggagggaaggccgtccgtggagagtgagcgggctcaccagatagagaaatgtgac
tgccccctgggctactccggcctgtcctgtgaggaatgtggggccgggttttaccgcctg
tctgcccgcagcggtggcgcagcctccagagcaggcatcgggagctgtgcgcagtgccag
tgcaacaggcacagtgaggcctgtgacccagagacatccatctgccagaactgccagcac
gacacagagggggacaggtgtgaacgctgtgccccaggatactatggtgtagtgaggggc
agacctgacgactgcaagccctgtgcctgccccctcaccaaccatgagaacaatttcagc
cctacctgtgtaacagagggattcaacgactaccactgtactgcctgccctgagggctat
gagggaaagtactgtgagagatgtgccacgggttaccatggcgacccccgtgcccccggc
gggaagtgtgaggagtgtaagtgtgacccgtacggggcgtggccccaaccgtgtgacccc
cgctcaggccagtgccactgccggcccggggccactggacgcacctgcagccagtgcatg
gagaggcatgtgtgtgggccctctgggattgtgtcctgtgatgatgactgtgccgggctc
ctcatcagagatatggatagactgcatcgtatcatcaccagtgtcaacctcaccacacct
ctgccaccgccctacaaagtcctctaccggtttgagaacatgacgcaggaactcaagcac
atgctctcgccacagaattcgccggagaggcgcctgcagctggccgacagtaacctgggc
agcctggtgacagagatggacgatctgctgagtcgggcgaccaaagtgtcggcagacggc
gagcaaacaggtgacgatgctaatagaatccacaaacgagccgaagacctggaacttttc
gtcaagaacaccctactggctgcagaagttctgaaggtcaaggctaaagagctgaatgag
actctgggcaggaggaacggagctccagagaagagcctaaacgagatgcaccaggagatc
gagaccatgttagccgagctccgcaaacgccagctgggaggcaagaagcacatctcagag
gaggagctgggactggcggaggccctgtaccagaaggtgaagcgtctcttcggggacccc
caccaggccacggaggacctgaaggcagaggtgacagagaagatgggtgaccaccgggcc
aagctggatgacgcccaggccctgatgaaggacgcccagggaaagagcagggaggctggg
gccttgtccggacagaaccagcggaacctcaccaccctggaaaggaagagggatgctgtg
agctcagtgaagaaaggaactgaagacgtgctggcagacggagagcgcattctggctgaa
gctaatggtctctcagacagcatcaataaggagattgaggatctggaggagatggagcat
gagctgggtcctctccatgagcagctggactacagggtgagccgtctgacccagggcctg
agtggcaacaccctgactgacctgcgcaggacgctggaacacgctgctgagctcaacgag
tcctcaaacatactggaccgtacagacagacagacagacagacataacaggcaggcacag
aggctggtcacagacagtgttattggctggtgtcctaaccaagtctcttgctgtctcctc
atagcatcctggcggaagccaagaaccgtccttaatgccacggcagcattcaacgcgtac
agcaacatcaaggacttcatcgaggaggctgacaaggaggcaaagcaggccaggcacgtg
gcacacacacacacacaggcatcaggacccaaaggctctttgaaggataacgccaagaac
tctgttcggaagagcgctcaactgtggaacgaagccaagcagttagagaacgatgtgaaa
gagaacgctgagagtgtgggcagtctccaggccagggtgaaagctggcggctttaagaac
aagggcttgctcaaggatctggacgatacgctacggaagctgaatgcaatccccaatgat
accgcagccaagctccaggccaccaaggccaaggcaggagatgccaacgacacagccaac
gatgttctggccagactgagagacatgaacctgagcctgatgggcctgaagaagaactac
agcaagctggaggatgacgtcaacaaggccaacaacatgatccaggaccctgaaaaaaac
acaataatccatgcagcgggggccaaggtgaaagacctggaggacgaggcagaccgactg
ctggataagctgaagcccatcaaggagttgcaggacaacttgaagaggaacatctctcag
attaaagagttgatcaaccaggcgcgcaagcaggccaactctattaaagtgtccgtgtcc
tccgggggagactgtatccgtgcttatcggccagaaatcaagaaaggtcgttacaacacc
atcactgtgaatgtgaaaaccacctcccctgacaacctactcttctacctgggcagtgcc
aaatacattgacttcctggccattgagatgcgcaagggcaaggtcaacttcctgtgggac
gtgggctctggagtgggcaaggttgagtaccctgacatgactatcaacgacggcaactgg
catcgcatcgaggcctcacggaatggtatcaatggcactatctctgtccatgcactggag
ggtcccaaagctggcatcatgcccacctctaagagtggcacttctcctgagggctatact
atcctggatgtggaccagaatgcctacctgtttgtcggtggcatgttgggcagtgtgaag
aaagcggacgcggtcaaaactactactttctccgggtgtatgggagagacatacctggac
aacaaacctattggcctgtggaactacagagacagagaaggagactgcaaaggatgtgtg
gttagcccccagccgtcagacacagaggggacggtacagtttgatggggagggctatgct
gctgtgagccggcccaccagatggaaccccaacgtctccaccgtcatgttcaagttccgc
tccttctccaccgactccctgctcatgtacttcgccaccaaggatacgaaggacttcatg
agtgctgagttgagtgatggtctagtgaaggtgagttttgacctgggctcaggcaccggc
tcggtgctcagtatcaagagacacaacgacggcaggtggaagtccttcactatggcccgc
atgaagaagcaagccacggtgaccatcgtggacatagacaccaatgaagaggagaagctg
gtggtatcatcccaaggctctgccaccgggctcaacctcaaggaggaggagaggatttac
ttcgggggtttgccaaccattggaaactacagtatcaagtcaaggtcagaggttaccaag
aagaggtatgctggctgtatgagagacattgaggtttccagaacaccctataacctgctg
agcagctccgactacaccggcctgaccaaaggctgcgctgtggagaacctccacacagtg
agcttctccaaaccaggtcacatggagctgaggtccatgtccttcgacgtcggcacagag
atcagcctgtccttcgcaaccaagagcgataaggggatcatcctgtttggcagtgggagc
accaatggagccagttcccagttccaactccccaagaggagacgcaggcagtctggggaa
cccttcctggccgtgttgctgaacaagggttccctggaggtgttggtgttcacaggcagc
cacagcccacgcagggtggtccgcaagcctgaccagggcatcctgcacgacgggagagaa
cacacactgcgcatcgagagactgggcggcaggtcgtttgccgtccaggtggacgaggag
ctgaagagggagcaggcccttcccaacgaccaacccatgggcatcaagagactgttcatc
gggggtatcccccctgatgtagagctcagctcccagagacccaacgaccccttcgaaggc
tgcatctggaacctcatgatcaatactatcctcacagacttctcccagcccgtggctttt
aagaacgcagaaatcggccagtgtcccgacctggctcctccccctcccccgctgcccctc
ccagaagaagaggaggaggggaccaagggagaagacgtgtcccagccgctccaacctgag
gctcctgctgtaccaccacccaccccgacacccagacagagccctccacctcccactgac
ccgccccctgtcgtacctccagagctcagccccgccacagaggaacctgaccacggtgct
gtcacagccccaccgctttcctgtgctgccgaggcatctccagtggtcttagagaaagcc
aaacagtttgggctctccaaaaacagccatgttgcatttgaattcgatgacaccaaggtt
aagaacagactgatcatagagtttgagctgcggaccacagcagagtccggcctggtgttc
tacatggcgaggatcaaccacgccgacttcgccaccgtccaggtgaaggagggcatggcc
cacctcggctacgacctgggccacggcaacacctcggtcagcgtcccacgcatcatcaac
gacggacactggcacaagatccgggtgatgagagagaaacagagaggtatactggtgata
gacagccgctactccaagcagaccaccagccccaagaaggctgacatcctggatgtggtt
ggcatgctgtacataggtggcctgcccgtcaactacaccaccaagaggatcggaccagtc
ttgtacagtatcaatggctgcatcaggaatttcaagatgctgggtaatgtgttggacatg
gacgcgcccacctccagccaccacgtgggcagctgtttcatcagcactgagaagggaacc
tactttgatggctctggatatgtcaaagcagtgggttcctacagggtgggtctagacgtg
tctctggagctggagttccgtacgtcccagagcaacggggttctgctggcggtcagcagc
caggtggacaccaagatggagggcctgggcatcgaactgcacaatggaaagctgctgttc
cacgtggacaacggagctggccggatcacagcggagtaccagcctgaagtagaggcaggc
ctctgtgacggtcagtggcactcggtcacagcccacaagcttcgccacaggctggagatc
atagtggacggcaggaaggaggaagcagagagccccaacgccaggtccaacaccgctgac
accaacgaccccatctacgtcggtggatacccagaggggctcaagcagtttggcctgact
tccagcacttcattcaaaggctgcatgcgcaacctgaagataaccaaggcatccaaggtg
ttggaggttcaattcaacaagggcctggagttcaagggggttcaacccctcacttgccca
gccaatgcagcctaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112217958
Entry
112217958         CDS       T05605                                 

Definition
(RefSeq) thrombospondin-1-like
  KO
K16857  thrombospondin 1
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04115  p53 signaling pathway
otw04145  Phagosome
otw04350  TGF-beta signaling pathway
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    112217958
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112217958
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    112217958
  09143 Cell growth and death
   04115 p53 signaling pathway
    112217958
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112217958
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112217958
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:otw00536]
    112217958
   04990 Domain-containing proteins not elsewhere classified [BR:otw04990]
    112217958
Membrane trafficking [BR:otw04131]
 Endocytosis
  Phagocytosis
   Opsonins
    112217958
Glycosaminoglycan binding proteins [BR:otw00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   112217958
Domain-containing proteins not elsewhere classified [BR:otw04990]
 Thrombospondin domain-containing proteins
  Thrombospondins
   112217958
SSDB
Motif
Pfam: TSP_C TSP_3 TSP_1 TSP1_spondin VWC TSP1_ADAMTS EGF_3 EGF_CA Laminin_G_3 EGF TSP1_CCN cEGF Laminin_G_2
Other DBs
NCBI-GeneID: 112217958
NCBI-ProteinID: XP_024234348
LinkDB
Position
18
AA seq 1172 aa
MKLTGIFLLLMLLTCESVRVAENRDDNSVYDLFELVQVSKKNHGVTLVKGDDPYSPAYKI
LNPDLIPELPESSFRDLIDSIHAERGFLLLLNFKQFKRTRGSLLTVEKRDGSGAVFEIVS
NGKANTLDVVFSTVNKQQVVSIEDVDLATGHWKNITLFVQEDRAQLYVGCEEVNTAELDA
PIQSILTQETPATARLRIGKGAVKDRFMGVLQNVRFVFGTTLDAILRNKGCQNSVLTDEI
VLIDDTINGSSPAIRTDYTGHKTKDLQMICGFSCEDLAGMFKELKGLGVVVKELSNELRK
VTDENXFLMNRVGIHSGVCLHNGIVHKNKAEWTVDDCTECTCQNSATVCRKISCPLIPCA
NATVPDGECCPRCGTPSDYAEDGWSLWSEWTHCSVSCGRGIQQRGRSCDRINNNCEGTSV
QTRDCYLQECDKRFKQDGAWSHWSPWSSCSVTCGAGVITRIRLCNSPTPQLEGKDCQGEG
RQTETCTKSPCPINGNWGPWSLWDTCSATCGGGAQTRKRLCNDPAPKYGGKECQGDSKAT
QQCNKNACPIDGCLSNPCFPGTKCTSFPDGTWRCGKCPSAYSGDGIKCEDIDECKEVPDA
CFVFNGVHRCENTDPGYNCLPCPARYSGPQPFGRGVEEATARKQVCTPRNPCLDGSHDCN
KNARCNYLGQFADPMYRCECKPGYAGNGHICGEDTDLDGWPNQDLVCVENATYHCKKDNC
PNLPNSGQEDYDKDGVGDACDNDDDNDGIPDDRDNCPFVYNPRQYDYDRDDIGDRCDNCP
YNSNPDQTDTDNNGEGDACSVDIDGDGILNEKDNCPYVYNVDQKDTDLDGVGDMCDNCPL
EHNPDQVDSDDDRVGDKCDSNQDIDEDGHQNNLDNCPYIPNANQADHDKDGKGDACDHDD
DNDGIPDEKDNCRLAFNPDQIDSDGDGRGDACKDDFDQDNVPDIYDVCPENFDISETDFR
KFQMVPLDPKGTSQIDPNWVVRHQGKELVQTVNCDPGIAVGFDEFNSVDFSGTFFINTER
DDDYAGFVFGYQSSSRFYVVMWKQITQTYWNNKPTKAQGYSGLSIKVVNSTTGPGEHLRN
ALWHTGNTPGQVKTLWHDPKNIGWKDFTAYRWHLIHRPRTGHIRVVMYEGKKIMADSGSI
YDKTYAGGRLGLFVFSQEMVYFSDLKYECRDA
NT seq 3519 nt   +upstreamnt  +downstreamnt
atgaagttgacaggaatatttctgctgttgatgcttttgacctgcgagagcgtacgagtt
gcagagaaccgagacgacaatagcgtgtacgacctgttcgagctggtccaagtctccaag
aagaaccacggagtgaccctagtgaagggcgacgacccatacagtcccgcctacaagatc
ctcaacccggacctgatccccgagctccccgagagctccttcagggacctcatcgattcc
atccatgccgagaggggcttcctcctcctgcttaacttcaagcagtttaagcggaccagg
ggctccctcttgaccgtggagaagcgggacggatcaggagccgtgttcgagattgtctcg
aatggaaaagcgaacaccctggatgtggttttctccaccgttaataagcaacaggtggtc
tcgatagaagatgtggacttggcgacgggccactggaagaatattacgctgttcgtgcag
gaggaccgggcgcagctgtatgttggctgtgaggaggtgaacacggcggaactggacgct
cccatccagagcatcctcactcaggagactcccgccacagcgcgcctcaggatcgggaag
ggagcggtgaaggaccggttcatgggggtgctccaaaacgtgcgctttgtctttggaacc
actttggacgcgattctgcgcaacaagggatgtcaaaactctgttctgactgatgagatc
gtccttatcgacgacaccatcaatgggtccagccctgccattaggacggactacactggc
cacaaaactaaagacctgcagatgatctgtgggttctcctgtgaggacctggctggcatg
ttcaaggaattgaaggggctgggagtggtggtgaaggagctgtctaacgagctgcgcaaa
gtgacggacgagaacwagtttttgatgaacagagttgggatccacagtggagtctgtctg
cacaacggcatcgtccacaagaacaaggccgagtggaccgtcgacgactgtaccgagtgc
acttgtcaaaactctgccaccgtgtgccgtaagatctcctgccccctgatcccgtgtgcc
aacgcaaccgtgcccgatggagagtgctgcccgcgctgtggaacaccgagtgactatgcg
gaggacggctggtccctgtggtctgaatggacccactgttccgtgtcttgtgggcgggga
attcagcagagaggccgctcctgcgaccgcatcaacaacaactgcgagggaacctcggtc
caaaccagggactgctaccttcaggagtgtgacaaacgcttcaagcaggacggtgcctgg
agccactggtccccctggtcatcctgctcggtcacctgtggggcgggtgtcatcacccgt
atccgcctctgcaactcccccacaccccagctggaaggcaaggactgccaaggagaggga
agacagactgagacgtgcaccaagtcaccctgcccaatcaacggtaactggggaccctgg
tcgctatgggatacctgctctgccacctgtgggggaggagctcagacacgtaaacgtctc
tgcaacgaccccgcccctaaatatggtggtaaggagtgccagggtgattccaaggccact
cagcagtgcaacaagaacgcctgtcccatcgatggctgtctgtccaacccttgcttccct
gggaccaagtgcaccagctttcctgatggaacatggaggtgtggaaaatgcccctctgct
tactctggtgacggcatcaagtgcgaggacattgatgagtgcaaagaggttcctgacgct
tgcttcgtgttcaacggagtccaccgctgtgagaacactgaccctggttacaactgtctg
ccctgtcctgcacgctactctggacctcagcccttcggaaggggagtggaggaggccacc
gccaggaaacaggtgtgtacaccacgtaacccctgcctggatgggagccacgactgcaac
aagaacgcccgctgtaactacctgggacaatttgccgaccccatgtaccgctgtgagtgt
aagcctggctatgctggaaatggacacatctgtggtgaggacacggacctggacggatgg
cccaaccaagacctggtctgtgtggagaacgccacctaccactgcaagaaggacaactgc
cccaaccttcccaactcaggccaagaagactacgacaaggatggtgttggtgacgcgtgt
gacaacgatgatgacaacgatggcattcctgacgacagggataactgtccgttcgtgtac
aaccccaggcaatatgactatgacagagatgatattggagatcgttgtgataactgtcct
tacaacagcaaccctgaccagaccgacacagacaacaatggggaaggagacgcctgctct
gtggacattgatggagatggcattctgaatgagaaagacaactgcccgtacgtctacaac
gtggaccagaaagacactgacctggacggtgtgggagacatgtgtgacaactgtcctctg
gaacacaaccctgaccaggttgactctgatgacgatcgtgtgggagataagtgtgacagc
aaccaggacatcgatgaagatggccaccagaacaacctggacaactgcccgtacatcccc
aacgctaaccaggccgaccacgacaaagacggcaagggagacgcctgcgaccacgatgat
gacaatgacgggatcccagacgagaaagataactgcagactggccttcaaccctgaccag
atcgactccgatggtgatggtcgaggagacgcttgcaaagatgactttgaccaagacaat
gtgcctgacatttacgacgtgtgtccggagaactttgacatcagcgagacggacttcagg
aagttccagatggttcctctggaccccaagggaacgtcccagatcgaccccaactgggtg
gtcagacatcagggcaaagagctggtccagaccgtcaactgtgaccctggcattgctgtt
ggttttgatgagttcaactctgtggacttcagtggtaccttcttcatcaacacagagcga
gatgatgactacgccggctttgtgttcggctaccagtccagctccaggttctacgtggtg
atgtggaagcagatcacacagacctactggaacaacaaacccaccaaggctcagggatac
tcaggactgtccatcaaggtggtcaactccaccactggacctggtgagcacctcaggaac
gctctctggcacactggtaacaccccaggacaggtgaagactctttggcacgaccctaag
aacattggctggaaagacttcacagcctacagatggcacctgatccacagaccaagaaca
ggacacatcagagtggtcatgtacgaggggaagaagatcatggctgattctgggagcata
tatgacaagacctacgcaggcggaagactaggcctctttgtcttctcgcaagagatggta
tacttctcagacctcaagtatgaatgcagagatgcataa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112219921
Entry
112219921         CDS       T05605                                 

Definition
(RefSeq) laminin subunit gamma-3-like
  KO
K06247  laminin, gamma 3
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112219921
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112219921
SSDB
Motif
Pfam: Laminin_N Laminin_EGF Laminin_B
Other DBs
NCBI-GeneID: 112219921
NCBI-ProteinID: XP_024237185
LinkDB
Position
20
AA seq 1619 aa
MDTPLTTPLLLTLLLHSLSLIHGAMDSCYDDNKGVPSRCMPKFENAAFNRTVMASNVCGS
PPENYCMQTGSTRSCHHCRVSDPGLSHNASLLTDFHTDEEPTWWQSQSMFYGVQHPNSVN
LSLHLSKAFEITYVSLKFYTSRPESFAIYKRTSEDGPWIPYQYYSASCTKTYGKNDKGYI
RPGDDERMAVCNDEFSDISPLTGGNVAFSTLEGRPSAYNFDQSAVLQEWVTATDLLISLD
RLNTFGDEFFKDAKVLRSYFYAISDFSVGARCKCNGHGSECVLDEQGALVCDCQHHTVGV
DCQRCHPFYQDRPWARATGDSANQCMKCNCSGQADVCVFDAEQYRSTASGGRCVDCRDQT
DGPHCERCRENHYRRSSQDPCSPCDCNTMGSVSLQCGVEGKCECRPSVSGVKCDTCQPGF
HSLSPGGCRLCDCDRRGSVGVCSVLDGGCHCRVNVEGQACDSVKPGSFNLQENNPAGCTP
CFCFRHSLACRSSNHHAAVNITSDFLEDTDGWSGQFSGGQEYPLLWKEGGVYLLPLSEDD
LGFYRAPERFLGNHLLSYGQLLSLTFTAEAQYLLPHSATVLLEGSGTTLSADLSPQHGPV
HQPGLAPQHTFTLRLHKEETRLRPSLSAFQFHHLLFNLTAIQISNAGGHNYTSQLSGVTL
ASAAPFSSPVIPSTPPALWVEVCTCPPGFGGQFCELCAPGFSREVPNGGPLSPCVPCTCH
QHGPCHPETGVCVCINFTTGPTCERCLGGYYGNALIGTPNDCRPCPCPDRTSCAQMSTGE
VVCTNCPSGQRGIRCEMCEDSFHGDPLGRSGPVQPCEKCDCNDNVDPNALGVCDHMTGCC
LKCLGHTEGDHCQRCRQGYYGDALDRTVAHKCKRCGCSPAGTSGSLEDCDPQTGSCLCLS
HVTGRDCGQCEVGFFNLQSGVGCERCTCNPIGSSSMACHQITGQCVCRLGLEGRLCSTCR
MGFYGFSSRGCRACNCDQWVPAPCVPHQRNLSRPPGLRGAGRLKARLQELENLLARFDCR
SGYGNHHHVQEYHMRQLHERQHHERGYQGEDSLPNALGDFLAIQEAKEALVKQFALMEMS
THTLSAQLHNVTPAMNCSASMEEEQEEEKKEKGKEDGRRTLCSTLGDALSVVRIAQTQLK
QATLDLDNVVIPFEVPPVPNRWNSAVNQSEVLMKSHTEMSGHIESIATKAFMASNQTYSL
LMDLLEDNSTKEYISNLTEQLADMQQIKENLTAQVNRTLANQLSLEEESADVLVALGNLT
SSLLELSQRRPKSTSGTNQSDLRPTQGYNQSDPSLAPAANQSEDVELSNRTAELAFNVQS
KEELVNKIREEMKPRIQTAHNNMAAVKDIYKLTAHAQGSKVLALSSVVTGKEMESEVITL
RRELEDMQREWPRRQVQTKAALKKETLLREVFEDINKKVNQTERVLRPALENATLSNATA
GQAEHTAHSLSKEAKATLTKAKHARTASAQLSSSVDTAMQQLAELENHTAQAQAQLNVEP
VESLTSVKGDIQAAKFQLEAYSLTLTQLIRNMDGSMVLERFDRILSETVVRLGVLRGCVE
SLALNVKIQSLWSAAQDQKNQLTHLEQDLQEIRQERDSLKDIALYLPQTCPQASGIEGH
NT seq 4860 nt   +upstreamnt  +downstreamnt
atggataccccactgaccaccccactcctcctcaccctcctcctccactccctctccctc
attcatggggccatggactcctgctacgatgacaacaagggtgtcccaagccgctgcatg
cccaagtttgagaacgcagccttcaaccgcacggtcatggcctctaacgtgtgcggttcg
cccccggagaactactgcatgcagacgggctcgacgcggtcctgccaccactgtagagtg
tcggacccgggcctcagccacaacgccagcctgctgacggacttccacacggatgaggaa
cccacctggtggcagagccagtccatgttctacggagtccagcaccctaactctgtaaac
ctctccctgcacctcagcaaagcctttgagatcacctatgtgagcctcaagttctacacc
agtcgaccggagagctttgccatctacaagcgaacaagtgaggatggaccatggatcccc
taccagtactacagcgcctcctgtaccaagacctatgggaagaacgacaagggatacatt
cgcccgggggacgatgagaggatggcagtctgcaacgacgagttcagtgacatctcccct
ctgaccgggggcaatgtggccttctctaccctggagggacgacccagcgcatacaacttt
gaccagagcgccgtgctacaggagtgggtgacagccactgacctgctcatctctctggac
aggctcaacacattcggagatgagttcttcaaggacgccaaggtgctgcgatcctacttc
tacgccatctccgatttctccgtaggcgccaggtgtaagtgtaatggccatggcagtgaa
tgtgtgttggacgagcagggggctctggtgtgtgactgccagcatcacactgtcggggtg
gactgccagaggtgtcacccattctaccaggacaggccttgggccagggccaccggagac
tctgccaaccagtgtatgaagtgtaactgcagtgggcaggcggatgtgtgtgtcttcgat
gcggagcagtaccgcagcacagcaagtggggggcgctgtgtagactgtagggaccagact
gatggaccgcattgtgaacgctgtagagagaaccactaccgacggtcatcacaggacccc
tgcagcccctgtgactgtaacaccatgggctctgtgagtctgcagtgtggtgtggagggg
aagtgtgagtgcagacccagtgtgtcaggggtgaagtgtgacacctgtcaacccggtttc
cactccctcagccctggcggctgcaggttgtgtgactgtgaccgtaggggcagtgtgggc
gtctgctctgtgctggatggtggctgtcactgcagggttaacgtggagggacaggcgtgt
gacagtgtaaagccaggctccttcaacctgcaagagaacaatccagctggatgtacgccc
tgtttctgcttcagacactcattggcctgcagatcgtccaatcaccatgcagctgtcaac
atcacatcggactttcttgaagacacagatggctggtcaggacagttttccgggggacag
gagtatcctctgctgtggaaagaagggggtgtctacttgctaccactcagtgaggatgat
ctcggcttctacagagctccagagaggttcctggggaaccatctcctgagctacggtcag
ctcctttccctgaccttcacggccgaggcccagtacctcctccctcacagtgccacagtg
ctcctggaaggatcgggaaccaccctgtcagctgacctttcaccccaacatggacctgtc
caccagccgggcctcgctccccagcacaccttcactctcagacttcacaaggaggagacg
aggctgaggccttctttgtctgccttccagttccaccatcttctcttcaacctcactgct
atacagatcagcaacgcaggaggacacaactacacgtcccaactctcaggggtaaccctg
gcttccgctgcccccttctccagtcctgttatcccctctacccctcctgcactctgggta
gaggtgtgtacatgccctcctggatttgggggtcagttctgtgagctctgtgccccagga
ttcagcagagaggtccctaacggaggacccctgtctccctgtgtgccttgcacctgccac
cagcatggaccatgccaccctgagacaggtgtgtgtgtgtgtatcaacttcaccacagga
ccaacctgcgagcgttgtctgggtggttactatggtaacgcgttgattggcacgcccaat
gactgcagaccttgcccctgcccggaccgtaccagctgtgctcaaatgagcacgggggag
gtggtctgtaccaactgcccttcaggacagaggggcatcagatgcgagatgtgcgaggac
agtttccacggcgaccccctgggccggtcagggccggttcaaccgtgtgagaagtgcgac
tgtaacgataatgtggaccccaacgcgctgggcgtgtgtgatcacatgacgggctgttgc
ctgaagtgcctgggacacaccgagggagaccattgccaacgctgccgacaaggttactat
ggggacgccctggaccgcactgtggcccataagtgcaaacgctgtggctgcagtcctgca
gggacttctgggtcgttggaggactgtgacccccagacaggaagttgtctgtgccttagt
catgtgaccgggcgagactgtggtcagtgtgaggtgggcttcttcaacctgcagtctgga
gtaggctgtgagaggtgcacctgtaaccccattggctcatcatccatggcttgccaccaa
atcacaggccagtgtgtgtgtcggctgggactggaggggcggctgtgcagcacatgtcgt
atgggcttctatggtttctcctcacggggctgcagagcctgtaattgcgaccaatgggtt
ccagctccatgcgtgccacaccaacgcaacctgtcccggccgccagggcttcgtggggca
gggaggctgaaggctcggctgcaggagttggagaatctcctagcacgcttcgactgccgg
agtggctacgggaaccaccatcatgtgcaggagtatcacatgcgacagcttcacgagcga
cagcatcacgagcgtgggtatcagggggaggacagcctgcccaatgcgctgggggacttc
ctggctatccaagaggcaaaggaagccttggttaaacagtttgctctcatggagatgtct
acacacactctctcagcccagctgcacaatgttaccccagctatgaactgtagtgccagc
atggaagaagagcaggaggaggagaaaaaggagaaggggaaggaggacgggcggagaaca
ttgtgtagtacccttggtgacgctctatcagtggtcagaattgcacagacacagctgaag
caggcaacactggacctggacaacgtggtcattcctttcgaggtgccaccggtgcccaac
cgatggaactcagcggtgaaccaatcagaggtccttatgaaaagccacacagagatgtct
ggtcatatagagtctatagctaccaaggcattcatggcctccaaccagacctactctcta
ctgatggacctactggaggacaactctacaaaggaatacatcagcaacctcacagagcaa
ctggcagacatgcagcagataaaggagaatctgactgcccaagtgaataggactctagcc
aatcaattgtctctggaggaggagtctgctgatgtcttggttgccctaggaaacctcacc
tcctccctattggagctgtcccagaggaggcccaaatccacatcaggaaccaaccaatca
gatctcagaccaacacagggttacaaccaatcagaccccagcctcgcaccggctgccaat
cagtcagaggatgttgagctaagcaacaggacagctgagctggcgtttaatgtccagtct
aaagaggagctggtcaataagatcagagaggagatgaagcctcgcatacagaccgctcac
aacaacatggctgctgtaaaggatatttacaagctgacagctcatgcccaggggtcaaag
gtcctggccctgtcatcggtggtgacagggaaagaaatggagtcagaggtcatcaccctg
cggagagaactggaagacatgcagagagagtggcctcgaaggcaggtccagaccaaggct
gctctgaagaaggagacgctgctgagggaggtttttgaagacatcaataagaaggtgaac
cagacagagagagtcctgaggcctgccctggaaaacgctaccctctccaacgctactgca
ggacaggcagaacacactgcacactccctgtctaaagaggccaaggccaccctgaccaag
gccaagcatgcgaggacagcgtctgcccagctcagctcctctgtggacacagccatgcag
cagctggctgagctggagaaccacactgcccaggcacaagctcaactcaacgtagagcct
gtagagtctctgaccagtgtgaagggggacatccaggcagctaagtttcagctggaggcc
tattcactcacactcacccagctcatccgtaacatggatgggagcatggtgctggagcgg
tttgaccgtatcctgagtgagacggtggtgcggttgggtgttctgcgaggctgcgtggag
agccttgccctgaacgtgaagatccagagcctatggtcagctgcccaggaccagaagaac
caactgacccacctggaacaggacctgcaggagataagacaggagcgagacagtttgaag
gacatcgccctgtacctgccccagacttgcccccaggcctcggggatagaaggacactag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112220314
Entry
112220314         CDS       T05605                                 

Definition
(RefSeq) tenascin-like isoform X1
  KO
K06252  tenascin
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112220314
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112220314
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:otw00536]
    112220314
Glycosaminoglycan binding proteins [BR:otw00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   112220314
SSDB
Motif
Pfam: fn3 Fibrinogen_C EGF_Tenascin EGF_2 EGF Pur_ac_phosph_N hEGF
Other DBs
NCBI-GeneID: 112220314
NCBI-ProteinID: XP_024237862
LinkDB
Position
20
AA seq 2389 aa
MSTKSILGCLFLTLLFSLCQSGLVRKILRHKRATLTATGGDNITLPSADQPVVFNHVYNI
NVPASSLCSVDLDAPGSTSLEPQDAVPPSGLHTTEHTMDGQNQIVFTHRINIPQQACACT
EGFPDLKDLLSRLEILEGELSTLRDQCTTGDSGFCSAQPVTGEVGTKPYCNGRGNYSADT
CGCICKPGWKGPNCTESECPNDCQDQGRCIDGKCICFEGFGGNDCLLEVCKVDCGENGQC
IGGVCICAEGFIGEDCSQTDCLNNCQGRGKCVDEECVCEEPWTGSDCSELICPNDCYDRG
HCVNGTCYCEEGFTGEDCGETTCPSDCMSHGFCVNGQCVCSAGYTGEDCSKLTCPSDCND
RGTCFNGMCICDAGYQGEDCSQLACLNNCHNRGQCVNGQCHCDVGYQGEDCSELSCPNNC
LNRGRCVNGQCVCDEGFGGEDCSIKTCPSDCYGRGDCVDGQCVCYAGFTGEDCSELSCPN
NCLNRGRCVDGQCVCDEGFTGEDCSEKRCPNDCLGQGYCVDGKCVCQDSYAGDDCSGLTC
PDNCNNRGLCVNGKCICEEGYVGDNCGELSCLNNCQDKGRCVNGQCLCEEGYIGEDCSEV
SPPKGLTVTEVTTETVDLTWNNEMLVTEYLITYVPNGPGGLYQEFTVGGDKTAATVSELE
PGIEYLINVYAILSNKKSIPISARVATYLPEPEGLKFKSVRETSVEVLWDQLDIPFDAWE
LYIRNTKEESGKTLTTLPSSQTLYEQTGLGPGQEYEVSVGVIKNNTRGPQSTKIITTRID
GPRQVEMRDVTDISGLVTWFHPVAQVDGVTVSYGPSSNPTNRTSVDLSTSDKQYSIDSLS
PDTEYQVSLVSRRGNSTSDPVTEIFTTDLDSPKDLQPLGQSDNSVTLEWKNSRADVDSYR
VKYSPISGGSHGEEVFPRGPGGNTQATITGLKPGTEYGIGVTAMKNERESLPATTNAATN
LDGPKDLEVSESTETSMTLVWKRPRAKIPVYRLVYISKDGRREEVEVPGTATSYNLNNLN
PGMMYTITLVAERGSKKSTPATLSASTASFTFYIANPAPELTTPIGSEDNIISFVSLDPS
DPDLQISGMGLELEDKLGELTVSVVTSEGFELSWEPKAHVVYDSYILECRDTLGLWDVKE
VHLHGDAKGSRFQGLRESTEYRVKLYGVSNSQRSSPLEAVTVTAPKSTSTDVVALSVKSA
QTTQSPDTGAVHPTVLPLAPLITEGPTSTSLYPTGDIPSGAESEPEASSLETLGDLNVTD
VSPTSVRLAWSAPDEAFDSFLVEVNALSGMAQAHVTTVPGSARKTLIEGLSPGTRYEVSL
YGKVEGEQSLPLHAFANTEELRPVVANLTVSDVTWDSFNVYWTPEDGEFESFVIEVTNLE
GGPESENLTLSADAFNLGISGLSSNTLYRIGLYGLHQGSFQEPVYTEATTVSEPVVGNLY
VSNLTSESFSISWNGTEGEFDGYVLEIIDSDWLKEPKEYNISQNAMSHDITGLRPSTDYI
AYLTGIVKGSRTHAVSIIASTAAEPDLSRLVVSNVTSDRLSLSWRRGEKAFDNFIVEVRE
SALPSQAMGRTLPGAARATVMTGLKGSTTYDIKLYASSAGQNTQPLFAVVTTEAVPQLGS
IAVSESSPDNFTLSWGTVAGHFDGFVIRVGDPEQLFDTLEFTPSGEVRNITVTGLVDATD
YDIELYGISHGRRTPSVLAHAVTASLPKVENLTISEITPFGFRVSWRAHHPQQQEGAPST
GGFGHFHIVVSDSGWLLEPQEFIVPGNQSFLDIWGLITGIGYEVRLTGVSSTGLVSRPLT
TVAVTEAEPEVEHMFVSDITSDSFRLAWTADEDMFDRFVIKIKDSTKFAHPQEVNVLGDE
RTKILTGLTGGTEYEIELYGVTLEQRSQPITGVARTGLGAPRGIRFSEVTESSAIVHWIM
PRARVDNYRIIYVPLQGGSPMTVLADGTETQAMLPNMLPGVTYQVTIFAGKGLEESDPGT
ENITTALDRPQALSAVNVTDTTALLLWQPAQATVDGYVITYSADSVSPVMEHVSGNTVEF
EMGSLVPATHYTVGVYAMREAQKSGTITTEFTTDVDSPRDLAATNVQTDGATLTWKPPRA
AITGYILTFTSPDGTVREVVLSPTATSYSMSELSGSSEYSVRLQAIAGAQRSRHVTNVFT
TIGGLYRYPKDCSQALLNGDTISGTYNIYLGGDESQPIQVYCDMTTDGGGWMVFLRRQNG
NLEFFRNWKNYTGGFGDMNDEFWFGLANLHKMTASGQYELRVDLRDNGKSAYAQYDKFTI
AEPRSRYKIYLGRYSGTAGDSMTYHHGRPFSTYDNDNDIAVTNCALSYKGAFWYKNCHRV
NLMGKYGDNSHSKGINWFHWKGHEHSIQFVEMKIRPVNFRNVESRRKRS
NT seq 7170 nt   +upstreamnt  +downstreamnt
atgagtactaaaagcattctaggctgcctcttcctgactctccttttcagcctctgccaa
tctgggctggtgagaaaaatacttaggcataaacgggcaactctgacagccacgggagga
gacaacataaccctccccagtgctgaccagccagtggtcttcaaccatgtctacaacatc
aacgtccctgctagctccttgtgctcagtggacctggatgcgccaggaagtaccagcctt
gagccccaggacgcagttccgccatcaggcctccacaccaccgaacataccatggatggg
cagaaccagattgttttcacccaccgcattaacattcctcagcaggcgtgtgcatgcacc
gaagggttcccggatttgaaggacctcctgagcaggttggagattctggagggagagctg
tccacgctgagagatcagtgcactactggagactctggcttctgcagcgctcagccagtc
acaggtgaagtggggaccaagccttactgcaatggccgtggcaactacagtgctgacacc
tgtggctgtatttgcaagcctggctggaagggacccaattgcactgagtctgaatgcccc
aatgactgccaggaccaaggtcgatgcatagacgggaaatgcatctgcttcgagggcttt
ggcgggaacgactgtttgcttgaggtttgcaaagtggactgtggtgagaacggacaatgc
attggcggggtctgcatctgtgccgagggtttcattggagaggactgttctcagacggac
tgcctgaacaactgccaaggccgtggaaagtgtgtagatgaggagtgtgtgtgtgaagag
ccctggacgggttctgactgctcggaactcatctgccccaacgactgctatgaccgtgga
cactgtgtcaatggaacctgctactgtgaagaaggtttcaccggggaggactgtggggag
acaacctgccccagcgactgcatgagtcatggtttctgtgtgaacggccagtgtgtctgc
agcgctggctacaccggagaggactgctccaagctcacctgccccagtgattgcaacgat
agaggtacctgcttcaatggcatgtgtatctgcgatgctggctaccaaggagaagactgt
agccagctggcttgcctcaacaactgccataacagggggcagtgtgtcaatgggcagtgc
cattgcgacgtagggtaccagggagaggactgctctgagctctcctgccccaataactgc
ctcaaccggggccgctgtgtcaacggacagtgtgtatgcgatgaaggctttggtggagag
gactgcagtattaagacctgcccctcggactgctacggccgtggagactgtgtggacggc
caatgtgtctgctatgctggcttcactggtgaggactgcagcgagctgagctgccccaac
aactgcctgaaccgtggacgctgcgttgacgggcagtgtgtctgtgatgagggcttcacc
ggtgaggactgcagtgagaagcgctgtcccaatgactgcctgggccagggatactgtgtg
gatggaaaatgtgtctgccaggacagctatgcgggtgacgactgctctggactcacctgc
cctgataactgcaacaacaggggactctgtgttaatgggaaatgcatttgtgaggaggga
tacgtgggagacaactgcggagagctgagctgcctcaacaactgccaggacaaaggccgc
tgtgtgaatggacaatgtctctgtgaagagggatacatcggagaagactgctcagaagtt
tcccctccaaagggcctgaccgtaacagaggtcaccactgagacagtggacctgacctgg
aataatgagatgctggtgacagagtatctgatcacttacgtgccaaatggtcctgggggt
ctgtatcaggagttcacagtgggcggagacaagactgctgccactgtcagcgagctggag
cctggcatcgagtacctgatcaacgtctatgccatcctcagcaacaaaaagagcatccca
atcagcgccagggtggccacatatctgccagaaccagaaggcttgaagtttaaatcggtg
agggagacctcagtagaggtgctgtgggatcagctggacattccttttgatgcctgggag
ctctacatccgcaacacgaaagaggagagtgggaaaacccttaccacccttccatcctcc
cagaccttgtatgagcagacggggctaggtcctggtcaggagtacgaggtttcagtgggc
gtcatcaagaacaataccaggggacctcagtctactaaaatcatcactaccaggattgat
gggcccaggcaggtagagatgcgtgacgtgacagacatttcaggcttggtcacctggttc
catcccgtggctcaggtggatggtgtcaccgtgtcctatggccccagctccaaccccaca
aataggaccagcgtggacctgtccacctcagacaaacagtacagcattgacagcctcagc
ccagacactgagtaccaggtgtccctggtctccaggaggggaaacagcaccagcgatcca
gtcactgagatattcaccacagacctggactctcctaaggacctgcagccactgggccag
tcagacaacagcgtcacactggagtggaaaaacagccgggcagacgttgacagctaccgg
gtgaagtacagccctatctctgggggttcccatggcgaagaggtgttcccccgtgggcca
ggaggcaacactcaggcaactatcactggattgaagccgggtacagagtacggaattggt
gtgaccgccatgaagaacgagagggagagcctgcctgccaccacaaatgcagcaaccaac
cttgatgggcccaaggacttggaagtgagcgagtccacagagaccagcatgacgctggtg
tggaagagaccccgagccaagatccccgtctacaggctggtgtacatctccaaggatggc
cggagggaggaggtggaggtccctggaacagccacctcctacaacctaaacaacctgaac
cctggcatgatgtacaccatcaccctggttgctgagaggggctcaaagaagagcacacct
gccaccctgtccgcatctacagcctctttcacgttttacatagccaaccctgcccctgag
cttaccactcccataggctcggaggacaatatcattagttttgtgtcgttagacccctct
gacccagacctacagatctcagggatggggcttgagctcgaggataagctgggagagctg
actgtctcagttgtaacatccgaaggatttgaactttcgtgggaaccaaaggcacatgtt
gtctatgatagttatattttagaatgtagagacactctgggattatgggatgtaaaagag
gtccatctccatggagatgccaaaggttctagatttcaaggcctgagggaatccacagaa
tatcgagtaaagctttacggagtaagcaatagccaaagatcctctccgcttgaagcagtc
acagttacagcacccaagtctacctctactgatgtagtcgctctgagtgtcaaaagtgct
cagacgacacagtctcctgacacaggagctgttcatccaacagtccttcccctggctcct
ctgatcacagaggggcctacatctacatctctgtaccccacgggggacatcccctctggg
gctgaatctgaaccagaggcctccagcctggagacgctaggggacctcaatgtcacagac
gtgagccccactagcgtgaggctagcctggtcagccccagatgaagcctttgatagcttt
ttggtggaggtgaatgctctgtcagggatggcacaagctcatgtgaccacggtaccagga
agtgccaggaagacccttatagaaggcttgtcccctgggacacgttatgaggtttcgttg
tatgggaaggtggagggggagcagtctctgcctcttcatgcttttgccaatacagaggag
ctgaggcctgtggtggccaacctcacagtctctgacgtgacatgggacagcttcaatgtg
tactggactcccgaggacggggagtttgagagctttgtcattgaggtgacaaacttagag
ggaggtccagagagtgagaatctcaccctgtcggctgatgccttcaacctgggcatttct
ggcctgagctctaacactttgtataggattggcctgtacgggctccaccagggctccttc
caggagccggtgtatactgaagccactacagtgagcgagccagtggttggcaatctgtat
gtatctaatttaacgtcagagagtttctccatctcctggaatggcactgagggagagttt
gacggttatgtcctggagattattgattcagattggctgaaggagccaaaggaatataac
atatcccagaatgcaatgtctcatgacatcacagggctaaggcccagcactgactatata
gcttacctcactgggattgtcaagggatcacgaacccatgccgtcagtattattgcatca
acagctgcagagcctgacttgtccaggctagttgtttctaacgttacctcagacagactt
tcactgtcatggaggagaggggagaaggcttttgataactttatagtagaagtcagagag
tctgctttgccctcgcaggccatgggccgcaccctgcctggagcggctcgcgccacagtt
atgactggcctcaaagggagtacaacctacgacatcaaactgtacgctagctccgctgga
cagaatacacagcccctattcgccgtagtcaccacagaggcagtcccacagttgggctca
atagctgtgtccgaatctagccccgataacttcaccctgtcctggggcacagtggctggt
cactttgatggctttgtcatccgggtcggtgaccctgaacagctgtttgatacactggag
ttcacgccgtctggcgaggtccgtaacattacagtcaccggcctagtggacgccactgac
tatgacattgaactgtacggtatttctcatgggcgccgcaccccttccgttttagcccat
gccgtcacagcatcattacccaaagtggaaaacttgaccatttctgagatcaccccattc
ggcttccgcgtgtcctggagggcgcatcatcctcaacaacaggaaggggctccctctact
ggtggcttcggccactttcacatagtggtgtcagactcaggctggctactggaacctcag
gagttcattgtccctggcaaccagagcttcttggacatctggggcctgatcactggcata
ggctatgaggtcaggctgactggggtatccagtactgggctggtctcccgcccactgacc
acagtggctgtgacagaggctgagccagaagtggagcacatgtttgtctcggacatcact
tcagacagtttccgcctggcctggaccgcagatgaagacatgtttgatagatttgtgatc
aaaattaaggactccacaaagtttgcgcatccgcaagaagtcaacgtccttggtgacgag
cgaaccaagattttaacgggactcaccggcggcaccgagtacgaaatcgagctgtacggt
gtcactttggaacagcgctcccaaccaattaccggtgttgctcgaacaggcctgggcgct
ccaagaggcatccgcttctctgaagtgactgagtcctcggccatagtacactggatcatg
cctcgtgccagagtggataactaccgcatcatctatgtgcctctccaaggaggcagccca
atgacagtgctagcagatgggactgagacccaggccatgttgcctaacatgttgccagga
gtgacctatcaggtcaccatctttgctgggaagggcctggaggagagtgacccggggaca
gagaacatcaccacagctctggacaggcctcaagctctttctgctgtcaacgtcactgac
acgaccgccctgctgctatggcaaccagctcaggccactgtcgatggctacgtcatcacc
tacagcgcagattcagtgtccccagtgatggagcacgtttctgggaacacggtggagttt
gagatgggctccctggtccctgccacacactacacagtaggggtgtacgccatgagggag
gcacagaagagtggcaccatcaccactgaattcacaacggatgtggattctcctcgtgac
ctggcggccactaatgtccagacagacggtgccactctcacctggaagcctccgcgtgcc
gccatcaccggatacatcctcaccttcacctcacccgacggcacagtccgggaagttgtc
ctgagccctacagccacatcgtacagcatgagtgagttgagtggctcttcagagtacagc
gtcaggctacaggccatcgctggagcccagcggagccgccacgtcaccaatgtcttcacc
accattggaggattatacagataccctaaggactgctcgcaggctctgctgaatggagac
acgatctctggcacctacaacatctacctgggaggggacgagagccagcccatccaggtc
tactgtgacatgaccacggacggaggaggatggatggtgttcctgaggcgccagaatgga
aatctggagttcttcaggaactggaagaattacaccggtggctttggggacatgaatgat
gaattctggtttggtctggccaacctccacaagatgacggcatcaggccagtacgagctg
cgtgtggacctgagggacaacgggaagtcggcctacgctcagtatgacaagttcaccatc
gcagagccacgtagccgctacaagatatacttaggaagatatagcggcacagcaggtgac
tctatgacctatcaccatggtcggcccttctccacgtacgacaatgacaacgacattgca
gtaaccaactgtgcactgtcctataagggtgccttctggtacaagaactgccatcgtgtc
aacctcatgggaaaatatggtgacaatagtcacagcaagggtatcaactggttccattgg
aagggacacgagcattcaatccagttcgtcgagatgaagattagacccgtcaacttcaga
aacgttgaaagccgacggaaaagatcatag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112221344
Entry
112221344         CDS       T05605                                 

Definition
(RefSeq) laminin subunit beta-2-like
  KO
K06243  laminin, beta 2
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112221344
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112221344
SSDB
Motif
Pfam: Laminin_EGF Borrelia_P83 EzrA DUF812 Trans_reg_C Alanine_zipper
Other DBs
NCBI-GeneID: 112221344
NCBI-ProteinID: XP_024239267
LinkDB
Position
22
AA seq 1090 aa
MPQDWEEVVLLSFGLGPFPPAAHCGNTIPADDMLTVSLPAGSQISLLPRYSSPGDVIGGP
RSIARKRVTSATAAMTGAKMWGNAPRSVTSVPNHIPSMSATLNHGALACECSLEGAVTRF
CDQLTGQCPCSQGAFGQRCDGCQAGHWGFPNCKQCLCNGHAEECHQRTGACLNCRENTGG
DKCDRCANGYYGNPVLGTGNGNRCQPCPCPDGPNSGRHFATSCHQDNRNRQVVCNCNQGY
TGGMVKRSEGSFKRSRCEECAPGYYGNPSQPGGRCQPCRCSNNIDMSDLDACDRRTGECR
KCLYNTEGPDCGVCKSGYYGDASRRNCRKCTCNFLGTAQTQCTARDECVCQRATGQCLCL
PNTIGLTCDHCEPNYWNLASGRGCEACGCEPNNAVNPACNEFTGKCQCRDGFGGKICTDC
QENYWGDPRIQCRACDCDPRGIETSQCGQKTGHCVCQQGVSGVRCDQCARGFSGQFPNCQ
PCHQCFGDWDRVVQNLAVRTKTLSERAVEIQNTGLTGAYEKAFRDLEEKLARAQGIVNAR
NTTTEAVSSLMELIEDLRSQIGETTDVLNHLEGDLTSVGNSNVEASNELSALEREAKELN
LTSDQLHRQLDILKNSNFLGAYESIRSSYNKSRDAEQRANQSTTTTPSTVSQSADTRRKT
ERLISAKKDDFNRKNAANKRALGDLNAKAQTLDMKKINEKVCGGPGDSPCVESHCGGAGC
RDDEGNRHCGGLNCNGAVAMAENALEKSKHAEKELNIAMKEVEELFHKVADAKTKAEEAK
GKAQAALDKATNTKNKVERSNNDLRDLIKQIRDFLMQEGADPDSIETVANRVLELSIPAS
PQQIRHLAEEIKDRVRSLSNVDAILKQTQDDMRKAEQLLQEAKKARNRADGVKSTAETVK
RALEDAKTAQAAAEKAIQRAKVDIGETEVRLAQIESETSSSEHDLNNAMDRLGNLGRGID
GLKLKRAKNSMAAARAEETATMARDKANDAKQILDGELTDKYHTVQDLVDRKAKTVQEAK
KTAERLRDEAKELLKDAQDKLQRLAELEKDYEENQKKLEGKARQLDGLEDKMKAILNDIN
KQIQIYNTCQ
NT seq 3273 nt   +upstreamnt  +downstreamnt
atgccacaggactgggaggaggtcgtgttactatcgttcggcctgggcccattcccacca
gcagcccactgtggaaacaccatccctgcagacgacatgctcactgtttccctgcctgca
ggatcccagatctccctcctccctcgttactcctcccctggagatgtcatcggcggaccc
cgctccattgcccggaaacgagttacgagcgctaccgctgccatgacgggggctaagatg
tggggcaacgcccccagatcagtgacgtctgtgccaaaccacatccccagcatgtcagcc
acattaaaccatggagctttggcctgtgagtgtagcctagaaggtgcggtcactcggttc
tgtgaccagctgactgggcagtgcccatgcagccagggtgcgtttggccagcggtgcgat
ggctgccaggcaggacactggggcttccccaactgtaagcagtgcctgtgtaacggacat
gctgaagaatgccaccagaggaccggagcctgtctcaactgcagggaaaacactggaggg
gacaaatgtgacaggtgtgccaatggttactacggcaacccggtgctgggcacaggtaac
ggtaaccgatgccagccctgcccctgcccggatggcccaaacagcggaagacacttcgct
acctcctgtcaccaggacaaccgcaacagacaggtggtctgtaactgtaaccaaggatac
acaggggggatggttaagcgttccgagggttccttcaagcgttcccggtgtgaggagtgt
gccccaggttactacggtaacccctcccagccaggtgggcggtgccagccatgcaggtgc
agtaacaacattgacatgtcagacctggatgcgtgtgaccggcggacaggggagtgtagg
aagtgtctctacaacacagagggaccggactgtggcgtgtgcaagagcggttactatgga
gacgcctcgcgacgcaactgcagaaagtgcacctgtaacttcctgggcacagcgcaaacc
cagtgtacagcgcgggatgagtgtgtctgccaacgtgccacagggcagtgcctgtgtcta
cccaacactatcggcctgacatgtgaccactgtgagcccaactactggaacctggctagt
gggcggggctgtgaggcctgcggctgtgaacccaacaacgctgtcaacccggcgtgcaac
gagttcactggaaagtgtcagtgtcgtgacggatttggtgggaagatctgcacagactgc
caagagaactactggggcgacccaaggatccagtgtagagcctgtgactgtgacccccgg
ggcatagagacctctcaatgtggccagaagacaggccactgcgtgtgtcaacagggggtg
tcgggcgtgcgttgtgatcagtgtgcccggggcttctcaggccagttccctaactgccag
ccctgccaccagtgctttggggactgggaccgggtggtacagaacctggctgtccgaacc
aagaccctgtcggagcgggctgtggagatccagaacacgggcctgactggagcctatgag
aaggccttcagagacctggaggagaagctggcacgagctcagggcattgtcaatgcccgc
aacaccaccacagaggcagtcagcagcctgatggagctcattgaagacctcaggtctcag
ataggggagaccacagatgtactgaatcatctggagggagacctgaccagtgtagggaac
agtaatgttgaggccagtaatgagctcagtgctctagagagagaggccaaagagctcaac
ctgacctcagatcagctccaccgccaactggacatcctgaagaactctaacttcctgggt
gcatatgaaagcatccgaagctcctataataagtcccgtgacgcagagcagcgagccaac
cagtccaccactaccacgcccagcactgtcagccaatcagcagacacccgccgaaagaca
gaacgcctcatctctgccaagaaagacgacttcaaccgcaagaacgccgccaacaagcga
gccctgggggacctcaatgccaaggcacaaaccctggacatgaagaagatcaacgagaag
gtctgtgggggccctggcgattccccctgtgtagagagccattgcggaggggcgggttgc
cgtgacgacgaggggaacaggcactgtggaggcctgaactgcaacggtgccgtagcgatg
gcagagaacgccttggaaaagtctaagcacgcagagaaagagctgaacatagccatgaag
gaggtagaggagctcttccacaaggtggcagatgccaagaccaaggcggaggaggcaaag
ggtaaagcccaggcagctctggacaaggccactaacaccaagaacaaggtggagcgctcc
aacaacgacctgcgggacctcatcaagcagatccgggacttcctcatgcaggagggtgct
gatccagacagcattgaaacggtggctaaccgtgtcctggagctgtccatcccagcctca
ccacagcagatcagacacctggcagaggagatcaaggaccgggtccggagcctctccaac
gtagacgccattctgaaacagacacaggacgacatgcgcaaggcagagcagctgctgcag
gaggccaagaaggccaggaatcgggcagacggggtgaaatccacagcagagacggtgaaa
cgggcacttgaggacgctaagacggcccaggctgcagcggagaaggccatacagcgggcg
aaggttgacattggtgaaacggaagtccgactagcacagatcgagtctgagacctccagc
agtgaacatgacctgaataatgccatggatcgccttggcaacctgggtcgggggattgac
ggtctgaaactcaaacgtgcaaaaaacagcatggcagcagctcgagctgaggagacagcc
actatggcacgggacaaggccaatgatgccaagcagattttagatggcgagctgacggat
aagtatcacacagtgcaggacttggtggacaggaaagccaagaccgtccaggaggccaaa
aagacagcagagcgactgagagacgaggccaaggagctactgaaagacgctcaggacaag
ctccagagactagcagaactagagaaagactatgaagagaaccagaaaaagttggagggc
aaagcccggcagttggacggcctagaagacaagatgaaggctatcctcaacgacatcaac
aaacagattcagatctacaacacctgtcagtaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112222151
Entry
112222151         CDS       T05605                                 

Definition
(RefSeq) collagen alpha-1(II) chain-like
  KO
K19719  collagen type II alpha
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112222151
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112222151
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:otw00536]
    112222151
Glycosaminoglycan binding proteins [BR:otw00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   112222151
SSDB
Motif
Pfam: Collagen COLFI
Other DBs
NCBI-GeneID: 112222151
NCBI-ProteinID: XP_024240564
LinkDB
Position
22
AA seq 1420 aa
MFSFVDSRTVLLLVASQIVLLSIVRCQEEDDHVVIGAKGQKGEPGEIADVVGANGPAGPM
GPSGEQGPRGSAGAKGDKGNVGPRGRDGEPGTPGNPGPPGPPGPNGPAGLGGNFAAQMAG
GFDEKAGGAQMGVMQGPMGPMGPRGPPGPSGAPGPQGFQGNPGETGESGPAGPLGPHGPP
GPSGKPGSDGEAGKPGKAGERGPAGPQGARGFPGTPGLPGIKGHRGHPGLDGAKGEGGAA
GAKGEGGAPGENGASGPMGPRGLSGERGRPGPSGSAGARGNDGLPGPAGPPGPVGPAGAP
GFPGSPGAKGEAGPTGARGTEGAQGPRGEAGTPGSPGPAGASGNPGTDGIPGAKGSAGAS
GIAGAPGFPGPRGPPGPQGATGPLGPKGQSGDPGIPGFKGEAGPKGELGPIGPHGAPGPA
GEEGKRGARGEPGAAGPLGPPGERGAPGNRGFPGQDGLAGSKGAPGDRGVPGVGGPKGGT
GDPGRTGEPGLPGARGLTGRPGDAGPQGKVGPGGAAGEDGRPGPPGPQGARGQPGVMGFP
GPKGANGEPGKAGEKGLVGRQGLIGLAGKDGETGAAGPLGPPGPAGERGEQGAAGPSGFQ
GLPGPAGPPGEGGKPGDAGVPGEAGAAGATGPRGERGFPGERGGAGSQGLQGPRGLPGTP
GSDGPKGAIGPSGGAGAQGPPGLQGMPGERGAGGISGAKGDRGDNGEKGPEGASGKDGSR
GLTGPIGPPGPAGPNGIKGEGGPSGPTGAAGARGAPGDRGEGGPPGPAGFAGPPGADGQP
GAKGELGEAGQKGDGGAHGPQGPSGAPGPVGPTGVSGPKGARGAQGASGATGFPGAAGRV
GSPGPNGNPGAAGPAGPAGKDGPKGVRGDSGTPGRQGDAGLRGAAGAPGEKGDAGGDGLP
GPDGPSGPQGLGGSRGIVGLPGQRGERGFPGLPGPSGEPGKQGAPGAGGDRGPPGPVGPP
GLSGPSGEPGREGNAGSDGPPGRDGSTGVKGERGNTGPAGAPGAPGAPGAPGPVGPLGKQ
GDRGEGGAQGPAGPAGPAGARGMAGPQGPRGDKGEAGETGERGQKGHRGFTGLQGLPGPP
GSAGDQGAAGPAGPSGAKGPPGPVGPAGKDGSNGQPGPLGPPGPRGRSGETGPAGPPGNP
GPPGPPGPPGPGIDMSAFAGLSQPEKSPDPLRYMRADEASSSLRQHDVEVDSTLKSLNNQ
IENLRSPDGSQKNPARTCRDLKLCHPEWKSGDYWVDPNIGSTADAIKVFCNMETGETCVY
PSIANVPQKNWWTSKSNDRKHVWFGETMNGGFHFSYAEDGTNAASIQLTFLRLLSTEASQ
SLTYHCKNSVAVNDGATGNLKKALLLQGSNDVEIRAEGNSRFTYSVMEDDCKKHTGQWGK
TVFEYKTQKTSRLPIVDIAPMDIGGADQEFGVDVGTVCFL
NT seq 4263 nt   +upstreamnt  +downstreamnt
atgttcagctttgtggattcacggactgttctgctacttgtagcatcccaaattgtttta
ctatccattgtcagatgtcaggaagaggatgaccacgtggtgattggtgctaagggccag
aagggggaacccggcgagattgcagatgttgtaggagcaaatggaccagcaggccctatg
ggcccctcaggcgagcagggacctcgtggatcagccggagctaagggtgataagggaaat
gttggccccagaggcagagatggcgagcctggcaccccagggaaccccggaccccctggc
ccacccggacctaatggacctgcaggccttggcgggaactttgctgctcagatggctggt
ggattcgacgagaaagctggaggtgcacagatgggagtgatgcaaggacctatgggccct
atgggtccccgtggtccccctggcccttctggagcccctggcccacaaggtttccaaggt
aaccccggagagactggagagtcaggcccagctggcccactgggaccacacggaccaccc
ggaccttctggcaaaccaggaagtgatggtgaggctggcaaacctggaaaggctggtgag
cgtggacctgcaggacctcagggagctcgtggattccccggaactcctggtcttcctgga
atcaaaggacacaggggtcaccctggtctggatggagctaagggagaaggcggtgctgct
ggagccaagggtgagggtggtgctcccggagagaacggcgcgtctggaccaatgggacca
cgtggtctgtctggcgagagaggccgtcccggaccttctggctctgctggtgcccgaggt
aatgatggcttgcctggccctgctggtcctcccgggcctgttgggcctgctggagcaccc
ggtttccctggatccccaggagccaagggagaagctggccccactggtgcacgtggaact
gagggcgcacagggaccccgtggagaggctggtacacccggatctcctggacccgctggt
gcctctggcaaccctggcactgatggtatccctggagctaaaggatctgctggcgcttct
ggaattgccggtgcacctggtttccccggaccccgtggcccccccggacctcagggagca
acaggacctcttggacccaagggacagtctggagaccctggtattcctggcttcaaagga
gaggctggtcccaagggagagcttggccctataggtccccatggcgcccctggccccgct
ggtgaggagggcaagagaggagcaagaggagagcccggtgctgctggaccacttggacct
cctggcgagagaggagctcccggtaaccgtggtttcccaggtcaggatggtcttgctggt
tctaagggagcccctggtgaccgtggtgttcccggcgtgggtgggcctaagggaggcact
ggtgaccctggccgcacaggagagcctggtcttcctggagccagaggtctcactggtcgc
cctggagatgctggtcctcaaggcaaagttggtcctggtggtgctgctggtgaggatggt
cgccccggcccacctggtcctcagggagcccgtggccagcctggtgtgatgggattcccc
ggaccaaagggagccaatggtgagcctggcaaggcaggagagaagggtcttgtgggtcgt
caaggtctgatcggtctggctggtaaagatggtgagactggtgctgctggacctctcggc
cctcctggacctgctggagagagaggagagcaaggagctgctggaccttcaggcttccag
ggtctgcccggacctgctggccccccaggagagggaggcaagcctggtgatgcgggtgtt
cctggagaggctggtgctgctggtgctactggacctagaggcgagcgtggtttccctggt
gagagaggcggtgctggatctcagggtctgcagggacctcgtggacttcctggaactccc
ggaagtgatggaccgaagggagccattgggccatctggtggtgctggagctcagggaccc
ccaggtctgcagggtatgccaggagagaggggagctggtggaatctccggcgccaagggc
gacagaggtgacaatggagagaaaggacctgagggcgcttctggaaaagacggttctaga
ggtttgactggtcccattggtcctcctggcccagctggtcccaatggcataaagggcgag
ggtggaccttctggcccaactggtgctgctggtgcccgtggtgctcctggtgaccgtggt
gagggtggtccccccgggcctgctggcttcgctgggccacctggtgcagatggtcagcct
ggagccaagggagagttaggcgaggctggacagaagggagatggtggtgcccatggacct
caaggaccctctggggcccctggacctgtgggtcctactggtgtttctggacctaaagga
gctcgtggtgcccagggggcttctggtgctactggtttccctggtgctgctggaagagtt
ggttctcccgggcctaacggtaaccctggtgctgctggccccgctggtcctgctggtaaa
gacggtcctaagggagttcgtggtgactctggaaccccaggaagacagggagacgctggg
ctgcgtggagctgctggagcccctggcgagaagggagatgctggaggggatggtctccct
ggtcccgatggtccttcaggtccccagggtctgggtgggtcacgtggtattgttggtctg
cctgggcagcgtggagagaggggcttccctggccttcctggtccttctggagagcccggt
aagcagggagctcctggtgctggtggtgaccgtggaccccctgggcctgtggggcctcct
ggactgtctggaccttctggcgagcccggaagagagggcaacgctggatctgatgggccc
cctggtagagatggatccaccggagtcaagggtgagcgtggtaacactggtcctgcaggt
gcacctggcgctcccggcgctcccggtgcccccggccctgtcggccccctgggcaagcag
ggagacagaggagagggaggtgctcaaggacctgccggacccgctggaccagctggcgct
agaggaatggctggaccccaaggaccccgtggagacaagggagaggctggcgagacagga
gagaggggacagaagggacaccgtggcttcaccggtctgcagggtcttcctggacctcca
ggctccgctggagaccagggagctgctggacctgccggacctagtggtgctaagggaccc
cctggcccagtcggccccgctggtaaggatggatctaacggtcagcctggacccctcgga
ccccctggacctcgtggtcgttctggagaaactggccctgctggtccacctggtaacccc
ggaccccctggtcctcctggtcctcccggccctggcatcgacatgtctgcctttgctggc
ctgtctcagcctgagaagtctccggatcccctgaggtacatgagagctgacgaggcgtcc
agctccctgaggcagcacgacgtggaggtggactccacactcaagtccctcaacaaccag
atcgagaacctgcgcagccctgatggtagccagaagaaccctgcccgcacctgcagagac
ctcaaactgtgccacccagagtggaagagcggtgactactgggtggatcctaacattggt
agcacagctgatgccatcaaggtcttctgcaacatggagactggcgagacctgtgtgtac
cccagcatagccaacgtgcctcaaaagaactggtggacaagcaagagcaacgaccgcaaa
catgtctggttcggagagaccatgaatggaggattccacttcagctacgctgaggacggt
accaacgccgccagtatccagctgaccttcctgaggctgctgtccacggaagcgtctcag
agcctcacctaccactgcaagaacagcgtggccgtgaatgacggagccacaggcaacctg
aagaaggctctgctgctccagggctccaacgacgtggagatcagagctgagggaaacagc
cgcttcacctacagcgttatggaggatgactgcaagaaacacacaggccagtggggaaag
actgtcttcgagtacaaaacacagaagacctcccgtctgcccatcgtggacattgctccc
atggacattggaggagcggaccaggagttcggtgtggatgtgggaacagtctgcttcttg
taa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112222169
Entry
112222169         CDS       T05605                                 

Definition
(RefSeq) collagen alpha-3(IX) chain-like
  KO
K08131  collagen type IX alpha
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112222169
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112222169
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:otw00535]
    112222169
Proteoglycans [BR:otw00535]
 Extracellular matrix (ECM) proteoglycans
  Collagen family
   112222169
SSDB
Motif
Pfam: Collagen
Other DBs
NCBI-GeneID: 112222169
NCBI-ProteinID: XP_024240598
LinkDB
Position
22
AA seq 678 aa
MAMFSALGLLLLCLLLTSSTAQRPGPRGAVGPPGPPGPDGKDGTDGKDGPAGLSGKAGPK
GKAGRAGGPGNPGLPGLPGVDGLTGADGPAGKDGPPGDVGDAGPSGPGGPPGRGRPGAPG
PPGANGLEGGIGPQGPAGPEGLPGLSGPPGPDGPPGLPGALPDGSGDLLCPAICPPGPSG
PPGMPGFKGHTGHKGDKGELGKDGEKGNAGPPGPPGIPGTVGLQGPRGLRGLQGPMGAVG
DRGLPGFRGKPGTAGIIGKTGDAGEKGPEGFRGPKGEIGKIGPKGVSGGAGPKGEPGIPG
RDGKDGTQGLDGEKGDAGRNGVPGEKGPNGLPGLQGKAGAKGAKGGVGDPGEMGEAGPSG
EPGIPGDIGIPGERGEAGPRGVAGGVGPVGNIGVQGSKGFQGIKGALGDPGLPGPTGIRG
GFGERGPVGASGPKGDMGMAGADGLPGENGEPGPFGPVGQKGESGKRGELGPKGVVGPQG
ELGARGVPGKPGLMGFQGEQGLPGIAGKIGVPGKLASEQHIRELCGSMIDDQIAQLAANL
RRPLSPGQVGRPGAAGLPGKVGETGSIGHPGSRGPPGYRGLPGDLGDPGPRGDLGEQGDK
GPIGKAIEGPIGDQGYQGIPGVLGIVKDGRDGSPGDPGEPGEAGRTGRTGHSGSPGICDT
TACQGANVHGKTSNPKNH
NT seq 2037 nt   +upstreamnt  +downstreamnt
atggctatgttttcagctctcgggctgctcttgctgtgcctgcttttgacatcatccaca
gcccagagacccggcccacgaggagcagtcggaccgccaggacccccgggacccgatgga
aaggatggcactgatggcaaagatggcccggctggactttcaggaaaagctggacccaag
gggaaagcagggagagcaggaggaccagggaacccaggcctgcctggcctccctggggtg
gacggattgacaggtgctgatgggcctgctgggaaagacggtcctccgggggatgtgggc
gacgctggaccttctgggccaggtggacctcctggcagagggagaccaggagctccaggg
ccacctggagccaatgggcttgagggtggaatcgggccacagggaccagcgggccctgag
ggtcttccaggattatccgggcctcccggccctgatggaccaccaggtcttcctggggct
ctccctgatggcagtggagatctgttgtgtcctgccatctgtcctcctggcccctctggc
cctccaggaatgcctggattcaagggtcacacaggtcacaaaggagataagggagagctc
gggaaagatggagagaagggtaatgctggcccacctggtcctccagggattcccggcact
gtcggcctgcagggtcctcgtggtttgaggggacttcagggcccaatgggggcagtagga
gacaggggtttaccaggtttccgaggcaaacctggtactgctggcatcatcggcaagaca
ggtgatgctggagagaaaggaccagagggatttagagggccaaagggagagattggcaaa
attggcccaaagggagtttctggcggagcaggacccaaaggggagcccggcatcccaggc
agagacgggaaagatggcacccagggactggatggcgagaagggagacgctggacggaat
ggggtacccggtgagaaaggacccaacggccttcctgggttacaaggaaaggctggcgca
aagggcgccaaaggaggagttggtgacccaggagagatgggagaggcagggccatctgga
gagccaggtattcctggtgacattggtattccaggagagaggggcgaggcgggacccaga
ggagtggctgggggcgtcggaccagtgggcaacatcggggttcagggcagcaaaggcttc
cagggaataaagggggctcttggtgaccctggccttcccggaccaaccgggattcgcggc
ggatttggtgagaggggtccagttggagcatcaggccctaaaggagacatgggcatggca
ggagctgatggtttgcccggggagaatggagaacctggtccatttggtccagttggccaa
aaaggagagtctgggaagcgtggcgagctgggacctaaaggtgttgtgggaccacaggga
gagctcggagccagaggggttcctgggaaaccaggcctaatgggcttccagggtgaacag
ggtctgcctggaatcgctggcaagattggtgttcccggtaaactggcaagtgaacagcac
attagagaattgtgtggatctatgattgatgatcagattgcacagctggctgccaacctc
agaaggcccctgtcccctggccaagtgggtcgccccggtgctgccggacttccagggaaa
gtaggagagactgggtctatcggtcaccctggctcccgtggacctcctggctacagagga
ctgcctggagacctgggagaccccggtcccagaggtgatcttggtgaacagggtgacaag
ggacccatcggaaaggccatcgaagggcccattggagaccaaggataccaaggtatccca
ggagtgcttggaatcgtcaaagacgggcgtgacggatccccaggagatccaggtgagcct
ggagaggcaggtaggacaggaaggactgggcactcgggctccccaggaatctgtgacact
accgcctgccagggggcaaatgtccatgggaaaacctccaatcccaagaaccattaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112222547
Entry
112222547         CDS       T05605                                 

Definition
(RefSeq) collagen alpha-1(I) chain-like
  KO
K08131  collagen type IX alpha
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112222547
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112222547
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:otw00535]
    112222547
Proteoglycans [BR:otw00535]
 Extracellular matrix (ECM) proteoglycans
  Collagen family
   112222547
SSDB
Motif
Pfam: Collagen
Other DBs
NCBI-GeneID: 112222547
NCBI-ProteinID: XP_024241069
LinkDB
Position
23
AA seq 664 aa
MGAPRVKVFHLPTKVLVISPLLVFLLCILPSHAQDEYSGYHSGEEHTYEGSLVDNYEHSG
YPQPEEYPPEPTHSYEEQQPSSGYDPYAPAPTSVSMITEDSYPYTTTTQVPYEQEPYEES
LQAPGGGEASLGEEGPTDCNCEPGEPGFAGFAGPKGARGLQGKDGFPGAQGREGYKGFKG
VLGRGGDTGPEGDSGPDGEGGASGFSGAQGLPGLPGDPGETGVLGLKGDIGMEGPRGGVG
VTGETGPIGEAGPGGPDGTGGIKGSTGAEGKQGPEGTDGEKGQIGAPGFSGDHGEMGYNG
YPGEPGGRGETGHKGDQGPGGMPGSDGEPGEDGPLGVPGVIGFPGEFGQKGTSGDRGVRG
PPGRVGAGGPQGARGDAGIPGKPGPKGLQAQPGAKGETGPDGEKGGVGRTGVKGEKEDKG
SFGARGDKGQQGERGIIGPDGIVGLNGPPGIPGSRGEPGPGGDLGVKGGSGPKGVPGAPG
PGLTDEQVLQLCKGVVTAQISQYAASIRVKCSQGCPINNRTLIGPPGTRGPTGESGKPGK
AGKAGVKGGRGIQGDTGVDGQKGTVGERGTKGSKGKGGEPGKGLPGHDGHQGLRGLPGHP
AEPKNGLAGHRGPRGFTGALGQPGMAGNAGVPGFCEARDCSIHAPVMRKEQGLVKGPRDL
NPKI
NT seq 1995 nt   +upstreamnt  +downstreamnt
atgggagcccccagggtgaaggtcttccatcttccaacaaaggttttggttatctctccg
ctgctcgtgttcctattgtgcatcctcccctcccacgctcaggacgagtactctggttac
cactcaggtgaggaacacacctatgagggctcattggtcgacaactatgagcattcagga
tacccacagccagaggaatacccaccggagcccactcacagctatgaggagcagcaaccc
tcatctggatatgacccctatgcaccagcccccaccagtgtgagcatgatcacagaggac
tcctacccctacaccaccaccacacaggtaccatacgagcaggagccctacgaagagtcg
ctccaggcccctggtggtggggaggcttctctgggggaggaggggccaacagactgtaac
tgtgagcctggagagccagggttcgctggatttgcagggcccaagggagccagaggactg
caaggtaaagatggcttccctggggctcagggacgggaggggtacaaaggattcaaagga
gttctaggaagaggaggagacacagggcctgagggtgactccgggcctgatggggagggc
ggtgcctctggtttctctggagcccagggcttgcctggtcttcctggagatccaggtgag
acaggggtgctaggactgaagggtgacatcggtatggaggggccacgcggaggagtgggg
gtaacgggtgagactggtccaattggtgaggcagggcctggtgggcctgatggaactgga
ggtatcaagggatcaactggagcagaagggaaacagggtcctgagggaacagacggggaa
aagggtcagattggagcacctggattctcaggagaccatggggagatgggctataatggg
tatcctggagagccgggaggcagaggagagaccggtcacaagggtgaccaaggcccaggg
ggcatgccaggcagtgatggggagcctggagaggatggtcctcttggagttcctggggtg
atcggctttcctggagagtttggacaaaagggcacgagcggggatcgtggtgtgagggga
cctcctgggagagtaggagctggggggcctcaaggagcgagaggagatgcaggaattcca
gggaaaccaggacctaaaggcctgcaggcccagcctggagccaaaggggagacaggacct
gatggtgagaagggtggggttggaagaactggtgtgaagggagagaaagaggacaaggga
agttttggagcacgtggtgacaaaggacagcaaggggagagaggtatcatcggccctgat
ggcattgttggactaaatggaccccctggcatcccaggctccagaggagagccaggtcca
ggcggtgacctgggcgtcaaaggtggctctggacctaaaggagtgccaggtgcccctggc
cctgggctgacagatgagcaggtattgcagctgtgtaaaggagtggtgacagcccagatc
tcccagtatgcagcttccatccgggtcaagtgttcccagggctgccccatcaacaaccgc
acacttattgggccgcccggaaccaggggaccaactggagaatcaggcaaacccggtaaa
gcgggcaaagctggagtcaaaggaggcaggggcatccaaggggacacaggagtagatggt
cagaaggggacagtgggtgaaagaggaacaaaaggctcgaaaggaaagggcggtgagcct
ggtaaaggtctgccaggacacgatgggcatcaaggcctcagagggctgccaggccaccca
gcagagccaaagaatggtttggcaggtcacagagggccccgtggtttcacaggtgctttg
ggccagcctggcatggcaggcaacgcaggagtgcccggcttctgtgaggcacgggactgc
agcattcacgcgcctgtgatgcgcaaggagcagggcctagtgaagggaccccgcgatcta
aaccccaagatttaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112222833
Entry
112222833         CDS       T05605                                 

Definition
(RefSeq) thrombospondin-3a-like
  KO
K04659  thrombospondin 2/3/4/5
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04145  Phagosome
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112222833
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    112222833
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112222833
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112222833
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112222833
   00536 Glycosaminoglycan binding proteins [BR:otw00536]
    112222833
   04990 Domain-containing proteins not elsewhere classified [BR:otw04990]
    112222833
Membrane trafficking [BR:otw04131]
 Endocytosis
  Phagocytosis
   Opsonins
    112222833
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   112222833
  Exosomal proteins of colorectal cancer cells
   112222833
  Exosomal proteins of bladder cancer cells
   112222833
Glycosaminoglycan binding proteins [BR:otw00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   112222833
Domain-containing proteins not elsewhere classified [BR:otw04990]
 Thrombospondin domain-containing proteins
  Thrombospondins
   112222833
SSDB
Motif
Pfam: TSP_C TSP_3 COMP EGF_CA EGF_MSP1_1 cEGF EGF_3
Other DBs
NCBI-GeneID: 112222833
NCBI-ProteinID: XP_024241421
LinkDB
Position
23
AA seq 955 aa
MGARRDMPTFLALSTFLFIATCEPMDKQDMQVIDMLTLDSKTSVSAVEKVTGAMSVLSDI
YIVSTFRLPPKMGGVLLGLYSKEENKKYLELAIMGKINKALVRYVREDGKIHTVNLQSTN
LADGRTHSIILRVGGLRRDNLHLELYVNCRLADSSQGLPPLVPLSAEKVEIRNGFKAYAR
LQGAVESLKMALGGSVAKAGTLADCPFQGDSSVYNTVGTTAEVNSILGDHTKALIGQLII
FNQILGELREDIREQVKEMSLIRNTILECQVCGFHDPRSPCSPNPCFKGVSCMETFDYPG
YRCGPCPEGMMGNGTHCQDIDECSIAQPCYSPGACINTVKGFSCELCPPGLWGPPLFGVG
LEYAKYHKQECVDIDECIEVANACVPHSMCTNTIGSFRCGGCKVGYLGNQTVGCVPRRSC
ATLSFNPCDANAHCIIERNGEVSCACNIGWAGNGNTCGTDTDIDGYPDRSLPCMDNDKHC
KQDNCVYTPNSGQEDADNDGIGDQCDEDADGDGIKNVEDNCRLEPNKDQQNSDTDSFGDA
CDNCPNVPNIDQKDTDSNGQGDACDNDIDGDGIPNVLDNCPKVPNPMQTDRDGDGVGDAC
DSCPEISNPMQTDIDNDLVGDVCDTDQDTDGDGHQDSRDNCPDHPNSSQLDSDNDGLGDD
CDDDDDNDRIPDIQDNCRLITNPNQKDSNSNGVGDVCENDFDNDSVWDLIDVCPESSEVT
LTDFRAYQTVILDPEGDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFNGVDFEGTFH
INTVTDDDYAGFIFGYQDSSSFYVVMWKQTEQTYWQSTPFRAMAQPGLQLKAVKSRTGPG
EYLRNALWHTGDTNEEVKLLWSDPRNVGWRDKTSYRWQLSHRPQVGYIRVKLYEGTEIVA
DSGVVIDTTMRGGRLGVFCFSQENIIWSNLRYRCNDTVPDDFNPYRKQVLLHIKV
NT seq 2868 nt   +upstreamnt  +downstreamnt
atgggtgcgaggcgcgatatgccaacttttctggctctatccacatttctattcattgca
acatgtgagccaatggataagcaagatatgcaagtcattgacatgctaaccctggactcc
aagaccagtgtgtctgcggtggagaaggtgacaggtgccatgagtgtgctcagtgacatc
tacatcgtgtccacattccgcctgcctcccaagatgggaggggtgctgctgggcctctac
agcaaagaggagaacaagaagtacctggagctggccatcatgggaaagatcaataaagct
ctggtgcgttacgtgagggaggatggcaaaattcacacagtgaacctccagagcacaaac
ctggctgatggtcgcacacactccattattctccgggttggaggcctgcgcagagacaac
ctacacctggagctctacgtcaattgtcgattggctgactccagccagggcctccctcca
ttggtccctctctctgcggagaaggtggagattcgtaatggcttcaaggcctacgcaagg
ctacagggcgctgtggagtccctcaaaatggcgctagggggcagtgtggccaaagcaggt
accctggcagactgtccattccagggggattcatcagtttacaatacagtcggtacgact
gcagaagtgaactccattctaggagaccacacaaaggctctgattggtcagctgatcatc
tttaaccagatcctaggagagctgcgagaggacatcagagagcaggtgaaggagatgtcc
ctgattaggaacaccattctggagtgccaagtgtgtggcttccacgaccctcgttccccc
tgctcccccaacccctgttttaagggtgtttcctgcatggagacctttgactacccaggg
taccgctgtggtccctgcccagagggcatgatgggcaacggaacccactgccaggacatt
gacgagtgttccatagcccagccctgctactctccaggtgcgtgtataaacacagtgaag
ggttttagctgtgagctctgcccccctggtctctggggcccacccctctttggggtcgga
ctggagtacgccaagtaccacaagcaggagtgtgtagacatcgatgagtgtattgaagtt
gccaacgcctgtgtgccccactccatgtgtaccaacaccatcggctcgttcaggtgtggt
ggctgtaaggtgggttacctggggaaccagacagtgggctgcgtgccccgtaggtcctgt
gccacactcagctttaacccttgtgatgctaacgcccactgcattatagagaggaacgga
gaggtgtcctgtgcgtgcaacattggctgggccggtaacgggaacacttgtggcacagac
acagacattgatggatacccagaccgctctctgccctgtatggacaatgacaagcactgt
aaacaggacaactgtgtttacacacccaactcaggccaggaggacgcagacaacgacggc
atcggagaccagtgtgacgaggatgcagatggggacggcatcaagaatgtggaggataac
tgtcgactagaacccaacaaagatcagcagaactcggacacagactctttcggtgacgcc
tgtgacaactgtcccaatgtccctaacattgaccagaaggatacggacagcaacgggcaa
ggagacgcctgtgacaatgacatagatggagatggtatccccaacgtgctggacaactgc
cccaaggtccccaaccccatgcagacagacagggacggagatggggtaggagacgcctgc
gacagctgccctgagatcagtaaccccatgcagacggacattgacaatgacttggtggga
gatgtgtgtgacactgaccaggacacggatggggacggtcaccaggactccagggacaac
tgccctgaccatcccaacagctcccagctggactcggacaacgatggccttggggacgac
tgtgacgatgacgatgacaatgacaggatcccagacattcaagacaactgcagacttatc
accaaccccaaccagaaagattctaacagtaacggggtgggcgacgtgtgtgagaacgac
tttgacaacgattcagtctgggatctgattgatgtgtgccctgagagttcagaggtcacc
ctgacagacttcagagcctatcagacagtcattctggatccagagggcgatgcccagatc
gatcccaattgggtggtgctcaatcagggcatggaaatagttcagaccatgaacagtgat
cctggtttagctgtgggctacacagcgttcaacggggtggactttgagggcaccttccac
atcaacacggtgacggacgacgactatgcaggcttcatcttcggctaccaggactcctct
tccttctacgtggtgatgtggaaacagacagagcagacctactggcagtcgacacccttc
agggccatggcccaacctggcctgcagctcaaagcagtgaagtcccgtacagggcctggt
gagtacctgcgtaacgccctgtggcacacaggggacaccaacgaggaggtgaagctgctg
tggtcggacccacggaatgtgggctggagagacaagacgtcttaccgctggcagctcagc
cacaggccccaggtgggctacatcagggtgaagttatatgaggggacggagattgtggct
gactctggcgtggtgattgacactaccatgagaggcggacgactgggggtcttctgtttc
tcccaagagaacatcatctggtccaacctgcgctaccgctgcaacgacactgttccagac
gacttcaacccatatcgcaaacaggtcctgctgcacatcaaagtgtga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112223616
Entry
112223616         CDS       T05605                                 

Definition
(RefSeq) chondroadherin-like
  KO
K06248  chondroadherin
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112223616
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112223616
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:otw00535]
    112223616
Proteoglycans [BR:otw00535]
 Extracellular matrix (ECM) proteoglycans
  Small leucine-rich proteoglycan (SLRP) family
   class IV
    112223616
SSDB
Motif
Pfam: LRR_8 LRR_4 LRR_5 LRR_9 LRRNT
Other DBs
NCBI-GeneID: 112223616
NCBI-ProteinID: XP_024242474
LinkDB
Position
24
AA seq 363 aa
MRCVSFLSVWPYLLVLGPVVWGAPSQCPALCHCHGDLQHVICDNVGLKNIPQVSEATRLL
NLQRNNLGSLPTGSFASSKGLISLHMQHCQLREIGGQAFKGLKKLIYLYLSNNEITSIKP
GAFEDLTELTYLYLDGNRISDLPKGIFSPMINLFILQLNDNKLRDIKPGTFAGAKDLRWL
HMSGNEMSSLQPGSLDEVENLAILHLDRNRLSTYPSLAMSKLRVVEELSLAKNPLRSIPD
NAFQSFGRYMEKLHLDGMGLEKFSDGAFNGMTAIKSLHLDNNKLKSLPKSLEFTSITNLT
LANNPWSCTCTLAPLRKWMDSSRQRPDALCAAPSSQRGKQIRDSSAFSDCTVKTKRAKKG
TRH
NT seq 1092 nt   +upstreamnt  +downstreamnt
atgcggtgtgtgagctttctctcggtgtggccctacctgctggtccttggcccggtggta
tggggcgctcccagccagtgcccggccctgtgtcactgccacggggacctgcagcacgtc
atctgtgacaacgtggggctaaagaatattccacaggtgtctgaggccacccgtctgctc
aatctgcagaggaacaacctgggcagcctgcccaccggctccttcgccagcagcaagggt
ctcatctcgttgcacatgcagcactgccagctccgcgagatcggcggacaggccttcaag
gggctcaagaagctcatctacctctacctgtccaacaacgagatcaccagcatcaagccg
ggtgccttcgaggacctcaccgagctcacctacctctacctggacggcaaccgcatcagc
gacttacccaagggcatcttctcgcccatgatcaacctgttcatcctgcagctcaacgat
aacaagctgcgcgacatcaagccaggcaccttcgccggagccaaggacctgcgctggctg
cacatgagtggcaatgagatgagctcgctgcagccgggctctctggacgaagtagagaac
ctggccatcctgcaccttgacaggaacaggctgtccacctaccccagtctggccatgagc
aagctgagagtggtggaggaactgagcctggccaagaaccccctgagaagcatccctgac
aacgccttccagagcttcggacgctacatggagaagctgcacctggacggcatggggctg
gagaagttttctgacggggcgttcaacggcatgacggccatcaagtctctgcacttggac
aacaacaagctcaagtccctgcccaagagcctggagttcaccagcatcaccaacctcacg
ctcgccaacaacccctggagctgcacctgcacgctagcccctctgcgcaagtggatggat
tctagccgccagcgccctgatgcgctctgtgccgctccgtcctcacagagaggaaagcag
atcagggacagctctgccttcagcgactgcacagttaagacaaagagagccaagaagggc
acgcgccattaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112224060
Entry
112224060         CDS       T05605                                 

Definition
(RefSeq) collagen alpha-3(VI) chain-like
  KO
K06238  collagen type VI alpha
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112224060
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112224060
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112224060
   00536 Glycosaminoglycan binding proteins [BR:otw00536]
    112224060
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   112224060
Glycosaminoglycan binding proteins [BR:otw00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   112224060
 Hyaluronan
  Extracellular matrix or blood plasma proteins
   112224060
SSDB
Motif
Pfam: VWA VWA_2 Collagen VWA_3 fn3 fn3_2 DUF5446
Other DBs
NCBI-GeneID: 112224060
NCBI-ProteinID: XP_024243118
LinkDB
Position
3
AA seq 3402 aa
MRKHRMLALCALLGVLFAGLLPKLDAQEEAQESADLVLLIDGSENVGAANFPRVRDLAMK
VIEGLDVGRDTIRVAVALYSADPEVQFFLNTYENKAAVLDAVKAIQFTGNNEANLGAALE
KVAESLLSPASGGRAEEGVPQALVVISAGPSNDDFSAGDRALKAASVITFGVVVGGTATA
ELETIATDKSFVLSSPDFRAVASMGDQLLPYVNGVAQGTIVVLNEFTEGTLEVGKRDIIF
LIDSTMGATTINSLREFIKRFVDTMPIGPDQVQVGVAQFSNAARLELDLNSYGSKEDLNA
ALGRLKPRPGQVVNIGVALDFVRTNMLKAEKGSRIQQGVPQLVLLMTSKKSSDSVGQAAE
ALQRMGVLTLAAGSKTADEQELKQIAIDESLVFMLKDFRILLRNPWVIVSLLSTLSGVVV
TEEPTEPVVEITTVQTQRVVRDIVFMVDGSSYIGGANLPYVRDFIVGVVNLLDVRPDRVR
IGLMQFAENPKIEFYLNTHKTKQDVLARVDQLRLMGGSGLNTGAAMDYALTNMFQASTGS
RKRQGVQQVLLLITGGPSQDEVKKIADKVAVAGVLTFTVSAGQADEAYLKTVAFVPNLAY
HESRFSSLPSVVEQIMTPLISVVGDTDISVTDIEITKEPAVAGGERDVAFLIDGSDNVRA
DFPYILDFIIKVIEPLDIGQDRVRISVVQHSERPAPNFYLNTYKDKAEVLRAVNDLRLAG
GRSLNTGMALKFMKDTILSPVHGSRAAQNVPQFLIVLTGGKSKDSVKESASALKTDGVVP
FGVGVKDADPKQIEAISHNPSFAFNVKEFSQLNMVQQRLNSYVSLPKEELKVILDQVDSQ
APRRDVXFLLDGSDGTRSGFPAMRDFVQRVVETLGVDENKDRVAVVQYSSDPAAQFYLNT
YTTKGEILNTVRGLRHMGDLSTLEQLSIDHDTSRKDVVFLVDGSDGTRNGFPAIRDFVQR
VVGKLNVGGDKDRVSVVQYGRDQEVHFYLNTYTTKEDILNTVRSLRHRGGRPLNTGAALQ
YVRDNVLTASSGSRSQEGVPQMLILLSGGRSSDNVDIPASALKDSGVLIFGIGTRNSSRE
VQXIATDPSFSQSVSEFTDLPSVQEQFFSTLITVQVEATPKTPTVIVDQSIARKDVVFLL
DGSDGTRNGFPAMRDFVQRVVEKLTVEENRDRVSVVQYSRESEAHFYLNTYTTKEDVVNT
VRGLRHKGGRPLNTGAALQYVRDNVFIASSGSRRLEGVPQILILLNGGRSFDNVDTPASA
LKELGVLVFGIGTRSSDSRELQXISYDPSYALSVSEFTDLPNVQQQLLSAMNTVIVQVTT
MTPTVKPXILVDSQAPRRDVVFLLDGSDGTRSGFPAMRDFVQRVVETLGVDENKDRVAVV
QYSRDPAAQFYLNTYTTKGEILNTVKGLRHKGGRPLNTGAALQYVRDNVLTASSGSRRTE
GVPQLLILLSGGRSFDNVDTPSRRTEGVPQLLILLSGGRSFDNVDTPASALKELGVLIFG
IGTRSSDSRELQRISHDPSYALSVSDFTDLPNIQQQLLSSVESVVIDVTPESTTDLVTTT
VVFTGGEKRDVVFLIDGTTAVRSEFPAIRDMIGRVVEKLDVGLDRVRVSVVQYSDGATVE
FLLNEHSTKDEVRQATRKLQSSGGNRRNTGRALEWISKNIYQKSAGSRIEEGVPQFLILV
TGGKSNDDISGPVNQLKTNLVAPLAIGTKNADPNELRQIALKPELAYSINNFGQLPTVEQ
QLIASVNTMTTTDISDSFVPSVLDIANLNMGRKDIIFLIDGSDTTGSNGIAHIRDFILNI
VQQLDVQLDQVRVAVVQYSDKVKTEFSLNSHNKKTAVLSAIKRLRQQGGRSSDLANAIEY
VTRNELKASAGVRLAQASQHLVVLTGRRSSTDVSVYGPLLKGSRVNCIGIGAGADYRELN
QIATSSADVLQVPAFPGLPVIKERFIARLNGTMPDEAPPDFVDPSLPKAKVADIVFLVDG
SINLGKDNFKEVMGFIQNLIDLFFTERDNLQIGLASYTTDVTDVFYLNTYKNKDDIIDAI
SRTEYKGGRRINTGTAIHHVQENHFIKNKGSRKDEGIAQILMIITGGRSASDSKTAALAL
KATGVRIYAVGVGDIEDELNNLASEASTVARASTFVELSELNEQILETLDDEVKGIKLCT
GVSQEPSKTCSLEVLVGFDVSSPNIFQAQRILESKMGAILQRITKMTGISCSSGQIPLIQ
VGILAMDAASEPVHLEFTDNADILFEAFRALRARGPYFLNAKTIAAYGSRFKSRAADAVK
VVIHLTDGLDGQYNEIKRQVEELKISGVNSFILVGLERVPRFEEAVLLEFGRGFRYTRPL
RVNVMDLDYELLEELDNIAERECCAVPCKCTGRRGDRGAVGLGGLKGGPGGAGGAGHPGD
EGGSGDRGPPGVNGTQGFQGCPGQRGIKGGRGYSGEKGEFGEIGLDGINGEEGKSGVAGP
PGDRGNPGRRGPKGTKGHAGDIGDTGIRGDPGTTGRDNNVAGPKGDPGDVGPVGEPGDDG
KMGGPGEPGRTGSDGRRGPPGQAGDPGKPGGNGVQGEPGIGGSRGQAGPIGAPGTRGEDG
NPGPRGLGGAQGPPGNNGRRGPLGRKGEPGESGPKGIVGPLGPRGEPGEDGRDGFGIAGP
KGRKGDEGFPGFPGPKGAAGDDGTNGGPGPMGNRGQRGVSGEIGTPGQKGEVGYPGPYGQ
KGPRGPGVVQCDLVKKIRDNCPCCYGQQECPLYPTELAFALDTSENVGRPAFNNMRDTVL
RLVGNITIAESNCPRGARVALTLYNNEVTTEIRFADGLKRRALVQRVEGLQALQTRKQRS
LETAMNFLAQNTFKRVRSGFLMRKVAIFFVNGPVKDQRAVSAAALRLYDSGIASVFLTNK
EDGQLTRALKMNSTGSALGQVIVLPNPGSAQYISAIQKVMNCHICLDSCAPDQMCDYAPP
QQSRDRRASTTDVDIDMAFVMDSSETTYPTVFTEMKRYVAHIVEQLEVSSDPVASIHHAR
VAVIQHAPYEFLRNSSGSPILVDVGLTDHRSAQDIRNFLLEKTPQLEGGRALAVAIEHTV
EQVFEKAPHQRDLKVLMLFVTGPVEQDEEQLVAVATEAKCKGFFLVILGVGEKLGAGDTR
VLTRMASEPSDVFFKRLTSTTHFYDMHIQNFGRLLPKYLSIENVFYMSPEVSKNCHWYQS
DQSFPKFPFPKSHHSQEKHQKHENHQAVHPRKHNDQDSDELHVANVTSSSLTLRWASPEP
KYMAYFKVVVTRLRDNTLVLRRNVTGTELTVGGLESAQTYHAVVTMHTAQGHVVATHKGI
ITTKAAAEHKVTAPMEVTGIKATTPLDKPEIAEPQQQVEQQPETENLPAIAPPRGQKAWD
WLDESRANSGRRSQRRVRIKGKRRKGSLGAPVNQGVIAAIKT
NT seq 10209 nt   +upstreamnt  +downstreamnt
atgaggaaacaccggatgttagcgctgtgcgctcttctgggcgtactttttgcaggactg
ctgcccaaacttgacgctcaagaggaagcacaagagtcagctgaccttgtactcttaatt
gacggatctgagaatgttggagcggccaacttcccccgtgtgcgcgatttggctatgaaa
gtcattgagggccttgatgtgggcagggacacaattcgggtggccgtggctctgtacagc
gcggaccccgaggttcagttctttctaaatacctatgagaacaaagccgctgtcctggat
gcagtgaaggccattcagttcacaggcaacaatgaggctaatcttggagccgccttggag
aaagtcgctgagagcctgttgagtccagcatcagggggcagggcagaggagggggtgccc
caagctctggtggttatcagtgctggaccgtccaatgacgatttcagtgcgggtgaccgg
gctcttaaggcagcaagcgttatcacgtttggcgtagtggtcggcggcacggccaccgcc
gagctggagactatcgccacagacaagagctttgttctgtcgtcccccgatttcagggca
gtggcaagcatgggtgaccagctgctaccatacgttaacggagtggcccagggtaccatt
gtcgttctgaatgaattcacagaaggaaccttggaagtgggaaaaagggacatcattttt
ctcattgacagcactatgggtgccacaacaatcaactctcttcgagagtttatcaaaagg
tttgttgacaccatgccaatcggaccggaccaagtgcaagtaggtgtggcccagttcagc
aacgctgccagacttgagttagacctgaactcatatggatccaaggaggacctgaatgcg
gctctgggaagactcaagccaagaccgggacaagtggtgaacatcggggtggccctggac
tttgtgaggaccaacatgctgaaggctgaaaaggggagtcgtattcagcagggtgtgccc
cagctggtgctgttgatgaccagtaaaaagtccagtgacagtgtggggcaggctgctgag
gcactgcagcgcatgggggttctgaccctggccgctggctctaagactgccgatgagcag
gagctgaagcagattgccattgatgagagtttggtgttcatgctgaaggacttccgcata
ttgcttcgcaacccatgggtgattgtctctctcctctccactctatctggggttgtggtg
actgaggaacccacagagccagtggttgaaattacaacagtgcagacccagcgagtagtc
agagacatcgtctttatggtggatggctctagctacattgggggtgccaatcttccatat
gtgcgggatttcattgtcggcgtggtaaacctgctggacgtgcggcccgacagggtgcgc
attgggcttatgcagtttgcagagaacccaaagatcgaattctacctgaacacacacaaa
acaaagcaagatgtgctggctagagttgatcagctcaggctaatgggaggatctggtttg
aacactggagcggctatggattatgcccttaccaacatgttccaggcctcgactgggtca
cgtaagaggcagggtgtccaacaggttcttctcctgatcactggaggcccatcccaggat
gaggttaaaaagattgcagacaaagtggctgtggcgggtgtactgaccttcacagtcagt
gccggccaggcagatgaggcctacttgaagacggtcgcttttgtcccaaacttggcttac
catgaaagcagattttctagcctaccaagtgttgttgaacagatcatgactcctttgatt
agtgtggttggcgacaccgacatctcagtaacagacatcgaaataaccaaggaacctgca
gttgctggaggcgagagggatgttgcattcctgattgacggctcggataatgtccgagca
gatttcccctacatcctggactttatcatcaaagtcattgagcctcttgatattggacaa
gatagagtacggatttcagttgtccaacatagtgagaggccagctcccaacttctacctg
aatacatataaggataaggctgaagtgttaagggctgttaatgatctaagactggccggt
ggaaggagtctaaacaccggaatggccttgaaattcatgaaggacactatcctgtccccg
gttcatggtagccgtgcggcccaaaatgtcccccagtttttgatagttttgaccggaggc
aagtcaaaggatagtgtgaaggaatctgctagcgctttaaagaccgatggagtggtaccg
tttggcgttggtgtcaaggatgcagaccctaagcaaatcgaggccatttctcacaaccca
tcctttgctttcaatgtgaaggaattcagccagctcaatatggtacaacaaaggctcaat
agctatgtgagccttcccaaggaagagctgaaggtcattctggaccaagttgacagtcag
gctcccaggagggatgtcrtgttcttgctggatggatctgatggcactaggagtggattc
ccagcaatgcgggactttgttcaaagagtagtggagacactcggtgtggatgagaacaaa
gatcgcgtggctgtggtccagtacagtagtgatccagccgcccaattctatctgaacaca
tacacaacaaaaggagagattctcaacactgtaagaggtctgagacacatgggagacctc
tcaacactggagcagctctccattgatcatgacacctccagaaaggatgtggtattcctt
gtggatggttctgatggaacaaggaatggattcccagcaatacgtgattttgttcagcga
gtagtggggaaactcaatgtgggaggagacaaagaccgcgtttctgttgtccagtacggt
agagatcaagaagttcatttctatctgaacacatacaccacaaaggaggacattcttaac
actgtgagaagtctgaggcacagaggaggtagaccccttaacactggggcagccctccaa
tacgtaagggacaacgtccttactgcctcctctggaagcagaagccaagagggcgtccct
cagatgctgatactgctgagtgggggaaggtccagtgataatgttgacataccagcttct
gccctgaaagacagtggggtcttgatctttggcattggaaccagraattccagcagagag
gttcaagrgattgccactgatcctagtttttcccagtctgtttctgaattcactgacctc
cccagcgtccaggagcagtttttctccacactcataactgtacaagtygaggccacaccc
aaaaccccaacagtcatagtggaccaaagcattgccagaaaggatgtagtattcctgctg
gatggttctgatggcactaggaatggctttccagcaatgcgtgactttgttcaaagagtg
gtagagaaactcactgtggaggagaacagagatcgagtctctgtggtccagtatagcaga
gaatcagaggcccacttctatctgaacacttacacaacaaaggaagacgttgtgaacacc
gtaagaggcctgaggcacaaaggagggagacccctcaacactggggcagctctccagtat
gtcagggacaatgtctttattgcctcctccggaagtaggcgccttgaaggtgttccacag
attctgatactgctgaatggtggaaggtcctttgacaatgtagatacaccagcrtctgct
ctcaaggagcttggtgtcttggtgtttggaattggaacaaggagctctgatagcagagaa
ttacaaaamatatcctatgaccccagttatgctctttccgtgtctgaatttactgacctt
cccaacgtccaacagcagcttctttctgctatgaacactgtcattgtacaggtcacaacc
atgacaccaacagtaaaaccaayaattctagttgacagtcaggctcccaggagggatgtc
gtgttcttgctggatggatctgatggcactaggagtggattcccagcaatgcgggacttt
gttcaaagagtagtggagacactcggtgtggatgagaacaaagatcgcgtggctgtggtc
cagtacagtagagatccagccgcccaattctatctgaacacatacacaacaaaaggagag
attctcaacactgtaaaaggtctgagacacaaaggtgggagacctctcaacactggagca
gctctccagtacgtgagagacaatgtcttgactgcctcctccggaagtcgacgcactgaa
ggtgttccacagttactgattctgctgagtggtggaaggtcctttgacaatgttgacact
ccaagtcgacgcactgaaggtgttccacagttactgattctgctgagtggtggaaggtcc
tttgacaatgttgacactccagcttctgctctgaaggagcttggggtcttgatctttgga
attggaacaaggagctctgatagcagagaattgcagaggatatcacatgatcccagttac
gctctgtctgtctctgacttcactgaccttcctaacatccagcagcaacttctgtcctcg
gtggagtcagttgttattgacgttacgccagaatcgacaacagatttagtcaccacaacc
gtagtattcactggcggagaaaagagggacgtggttttcctcattgacggcacaacagcg
gtgcgcagcgagttccccgccatccgtgacatgatcgggagggtcgtggaaaagctggac
gtgggtctggatcgggtgagggtgtcagtggtgcagtacagcgacggtgccacggtggag
ttcctcttgaacgagcactccaccaaagacgaggtccgccaggccacgaggaagcttcag
agcagcggtgggaaccgtcggaacactggccgtgcccttgaatggatctccaagaacatc
taccagaaatcagcaggtagccgcattgaggagggagttcctcagttcctcattctagtc
acagggggaaagtccaacgatgacatctctggaccggttaatcagctgaagaccaacctg
gttgcccctttagccatcggcacaaagaatgccgaccccaatgaactgaggcagatcgcc
ctaaagccagaacttgcctactccattaacaacttcgggcagcttccaacagtggagcag
cagcttattgcttcagtcaacaccatgaccaccactgacatctccgacagttttgttccc
tcagttttggatattgctaacctcaacatggggcggaaagatatcatttttctcatcgat
ggctcggacaccacaggctccaatggcatcgcccacatccgtgacttcatcctcaacatc
gttcagcaactggatgtgcaacttgaccaggtccgggtcgctgtcgtccaatattccgac
aaggtcaagacagagttctctctcaactcccacaacaaaaaaacagctgtgctctcagcc
atcaaaagactacgccagcagggtggaagatcatccgatcttgccaacgccatcgagtat
gtgaccaggaatgagctgaaagcctcggcaggtgtccggcttgcgcaggcctcccagcat
ctagtggtccttaccggcagaaggtcctccactgacgtgtccgtgtacggccctctgctt
aaaggctcccgggttaactgcatcggcatcggggctggtgcagactacagggagctcaac
cagattgccaccagctctgccgatgttctccaggtacccgctttccctggcttgcctgtc
attaaggagaggtttattgccaggctgaacggaacaatgcctgatgaggcaccaccagat
tttgtcgacccaagcctccctaaagccaaggttgctgatattgtattcttggtggacggc
tccatcaacctgggcaaggacaacttcaaggaggtgatggggttcatccagaacctcatc
gacctcttcttcactgagcgtgacaacctgcagattggcctggcgagctacaccaccgac
gtcaccgacgtgttctacctcaacacctacaagaacaaggacgacataatcgatgccatc
agccgcaccgagtacaagggaggccgcaggatcaatacaggtaccgccatccaccacgta
caagagaaccacttcatcaaaaataaaggcagcaggaaggatgagggaatcgcccagatc
ctgatgatcatcaccggcggaaggtcggccagcgacagcaagaccgcagctctggcgtta
aaggccaccggcgtgcgcatctacgctgtcggcgtgggtgacattgaggatgagttgaac
aacctggcgagtgaggcctccacagtggccagggcaagcacgtttgtggagctctctgag
ctcaacgagcaaatccttgagacattggatgacgaggtgaagggaatcaagctctgcact
ggcgtgagccaggagccctcaaaaacctgcagtctggaggtgttggtaggctttgatgtg
tcctcaccaaacatcttccaggcccagaggatcctggagtccaagatgggtgccatcctc
caaaggatcaccaagatgacgggcatcagttgctcgtcgggccagatcccattgatccag
gtgggcatcctggccatggatgccgcctcagaacccgtccacctggagttcacggacaac
gccgacattctgttcgaggcattccgagcactgcgcgcccgcggaccctacttcctcaac
gccaagaccattgccgcatatgggtccaggttcaaaagccgagcagcagatgcggtcaag
gttgtgatccatctgactgatggtctggatggccagtataatgaaattaagagacaggtt
gaagaacttaagatttcaggtgtgaacagctttatcctggtgggtctggagcgggtaccc
aggtttgaggaggccgtgctcctggagtttggccgcggcttcaggtacaccagacccctc
agagttaatgtcatggacttggactacgagcttctggaggaactggacaacattgctgag
agggagtgttgcgcggtgccatgcaaatgcaccggcagaagaggagacagaggagcagtc
ggacttggaggactgaagggtggtccaggcggagcaggtggagcaggacatcccggagat
gagggtggatccggagacagaggtcctcctggtgtcaacggaactcaaggtttccaggga
tgtcctggacagaggggcatcaagggtggtcgtgggtactctggagaaaagggtgaattt
ggagagattggcctggatggcatcaatggagaagagggcaagagtggagtcgctggaccc
ccaggagacagaggaaaccctgggagaaggggacccaaaggaactaaaggacatgcagga
gacattggggataccggaatccgaggagatcctggaaccacagggcgagataacaacgtg
gctggacctaaaggagacccaggcgatgtcggcccagtgggagagccaggggacgatggt
aagatgggaggccccggtgaaccaggcaggacgggttctgatggtagaagaggcccaccc
ggacaagctggagaccctggcaaacccggaggtaacggtgtgcagggagagccaggtatc
ggaggatccaggggccaagctggaccaattggtgcacctggtaccagaggtgaggacggg
aaccctggaccaaggggcctaggaggagcccagggaccccccggaaacaatggcaggaga
ggacctctcggtcgcaagggtgagccaggagagtccggacccaaaggcatcgtgggacct
ctgggacctcgtggtgagcctggcgaagatggtcgagatggatttggaatcgcaggcccc
aaaggaagaaagggtgatgagggcttcccaggattcccaggaccaaagggagcggcaggt
gatgacggaaccaatggcggaccaggacccatgggaaaccgtggccagaggggtgtttca
ggagaaattggtactccaggacagaagggagaggttggatacccgggaccttatggccag
aaaggaccgagaggacctggcgttgtgcaatgtgacttggtgaagaaaatcagagacaac
tgtccttgctgctatggtcagcaggagtgcccactctaccctaccgagctggccttcgca
ctagacacctccgaaaacgtgggtaggcctgccttcaacaacatgcgtgacaccgtgctc
cgcctggttggcaacatcaccattgctgagagcaactgcccccgcggcgcccgagtggcc
ctcaccctctacaacaatgaagtgaccaccgaaatccgctttgcagacgggctgaagcgg
cgtgcactggtgcagcgtgtggagggcctccaggcattacagacgcgcaaacagcgtagc
ctggagacggccatgaacttcctggcacagaacaccttcaagagggtgcgcagcggcttc
ctcatgaggaaggtggccatcttctttgttaatgggccagtgaaggatcagcgggcggta
agcgcagccgccctacgcctctatgactccggcatcgcctcagtgttcctgaccaataaa
gaggatggccagctcaccagagctctgaagatgaacagcactgggtcagcactgggtcag
gtgattgtgctgcccaatcccggaagtgcacagtacatctcagctatccaaaaggtcatg
aactgccacatctgcctggactcctgcgccccggaccaaatgtgtgactatgccccccct
cagcagtcaagagacaggagggcctccaccactgatgtggacattgacatggcctttgtc
atggatagctccgagaccacctaccccaccgtcttcactgagatgaaacgctacgttgca
cacatcgtagagcagctggaagtctcgtcagaccccgtggcatccatccaccacgcccgc
gtggctgtaatccagcatgctccctacgagttcctgcgcaacagcagcggctcacccatc
ctcgtggatgtgggcctgactgaccaccgctcggcccaggacatccgcaacttcctactt
gagaagacgccccaactggagggtgggcgggcgctggcagtggccatcgagcacacggtg
gagcaggtgtttgagaaagcaccccaccagcgagacctcaaggttctgatgttgtttgtg
acaggccctgtggagcaggatgaggagcagctggttgctgtggccaccgaggccaagtgt
aagggctttttcttggtcatcctgggtgtgggcgagaagctgggtgctggggacacccgc
gtgctgacgcgcatggccagcgagccatccgacgtcttcttcaagaggctgaccagcacc
acgcacttctacgacatgcacattcagaactttggccgactgctgcccaagtatctcagc
attgagaacgttttctacatgtcccctgaagtctccaaaaactgtcactggtaccagagt
gaccagtcattccccaagttccccttccccaagtcacaccacagccaagagaaacatcaa
aaacacgaaaaccaccaggcagtccatccaagaaagcacaacgaccaagactcagacgag
ttgcacgtagccaacgtcacttccagcagcctgaccctgcgctgggccagcccggaaccc
aagtacatggcctactttaaggtggtggtgacgcgcctgcgtgacaacacactggtgttg
aggagaaatgtgacgggcacggagctcactgttggcggcctggagagcgcccagacctac
cacgctgtggtgaccatgcacaccgcccagggccacgttgtggccacccacaaaggcatt
attaccaccaaagcagcagcagagcataaggtcactgcccccatggaggtgacaggtatc
aaggccactacaccactggacaaaccagagattgcagaacctcagcaacaagtggagcag
cagcccgagacggagaaccttccagctattgctccgcctcgagggcagaaggcatgggat
tggttggatgaaagccgtgcaaacagcgggcggcgctcacagcgacgagtgagaataaaa
ggaaagagaagaaaaggctccctaggtgcacctgtcaaccaaggagtcattgccgcaata
aaaacgtag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112224134
Entry
112224134         CDS       T05605                                 

Definition
(RefSeq) chondroadherin-like
  KO
K06248  chondroadherin
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112224134
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112224134
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:otw00535]
    112224134
Proteoglycans [BR:otw00535]
 Extracellular matrix (ECM) proteoglycans
  Small leucine-rich proteoglycan (SLRP) family
   class IV
    112224134
SSDB
Motif
Pfam: LRR_8 LRR_4 LRR_5 LRRNT LRR_9 LRRCT
Other DBs
NCBI-GeneID: 112224134
NCBI-ProteinID: XP_024243228
LinkDB
Position
25
AA seq 363 aa
MPCVSFLLVGTCLLVLGPAVWGAPSQCPAQCHCHGDLQHVICDNVGLKKIPQVSEATRLL
NLQRNNLGSLPTGSFASSKGLISLHMQHCQLHEIGGQAFKGLKKLIYLYLSNNEITSIKP
GAFEDLTELTYLYLDGNRISDLPKGIFSPMINLFILQLNDNKLRDIKPGTFAGAKDLRWL
HMSGNEMNSLQPGSLDDVENLAILHLDRNRLSTYPGLAMSKLRVVEELSLAKNPLRSIPD
NAFQSFGRYMEKLNLDGMGLEKFSDAAFNGVTAIKSLHLDNNKLKSLPNSLEFTTITNLT
LSNNPWSCTCMLAPLRKWMDSSRQRPDALCSSPSSQRGKQIRDSSAFSSCKVKTKRAKKG
TRH
NT seq 1092 nt   +upstreamnt  +downstreamnt
atgccgtgtgtgagcttcctgttggtggggacttgcctgctggtcctcggcccggctgtt
tggggcgcccccagccagtgcccggctcagtgtcactgccatggggacctgcagcatgtc
atctgtgacaacgtggggctgaagaagatcccgcaggtgtccgaggccacccgtctgctc
aacctgcaaaggaacaacctgggtagcctgcccactggctccttcgccagcagcaagggt
ctcatctcgttgcacatgcagcactgccagctccatgagattggcggccaggccttcaag
ggactcaagaagctaatctacctctacctgtccaacaacgagatcaccagcatcaagcca
ggtgccttcgaggacctcactgagctcacttacctctacctggatggcaaccgcatcagc
gacctgcccaagggaatcttctcacccatgatcaacctgttcatcctgcagctcaacgac
aacaagctgcgtgacatcaagccaggcaccttcgccggagccaaagacctgcgctggttg
cacatgagtggcaatgagatgaactcgctgcagccgggctctctggacgatgtggagaac
ctggccatcctgcacctggacaggaacaggctgtccacctatcctggcctggccatgagc
aagctgagagtggtggaggaactgagcctggccaagaaccccctgaggagcatccccgac
aacgccttccagagcttcggacgctacatggagaagctgaacctggatggcatggggctg
gaaaagttctctgacgctgcattcaatggagtgacggccatcaagtctctgcacctggac
aacaacaagctcaagtccctccccaacagcctggagttcaccactatcaccaacctcacg
ctctccaacaacccctggagctgcacctgcatgcttgcccctctgcgcaagtggatggac
tctagccgccagcgccctgatgcgctctgttcatctccatcctcacagagaggaaagcag
attagagacagttctgccttcagcagctgcaaagtcaagacaaagagagccaagaagggc
acgcgccattaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112224508
Entry
112224508         CDS       T05605                                 

Definition
(RefSeq) collagen alpha-1(I) chain-like isoform X1
  KO
K06236  collagen type I alpha
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112224508
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112224508
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:otw00536]
    112224508
Glycosaminoglycan binding proteins [BR:otw00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   112224508
SSDB
Motif
Pfam: Collagen COLFI VWC TILa
Other DBs
NCBI-GeneID: 112224508
NCBI-ProteinID: XP_024243872
LinkDB
Position
25
AA seq 1460 aa
MFSFVDIRLALLLSAAVLLARGQGEDDSGFGSCSLDGQQYNDKDVWKPEPCQICVCDSGT
VMCDEVICEDTTDCADPIIPDGECCPICPDDSESEDPQLPERPQPEGPQGGDGPKGDDGP
EGVPGNDGVDGQPGLPGPPGPPGPPGLGGGVFSPQMHHGYDQKSSGGQAQMGQMGPMGPR
GLAGPPGNTGPPGHHGPPGEPGEPGGSGPMGERGAMGPHGKNGDNGEPGRSGRPGERGSA
GPQGGRGTPGTPGLPGIKGHRGFNGMDGAKGDGGPAGPKGEGGSPGSSGNSGAMGARGLP
GERGRPGPAGSSGARGNDGNSGPAGSNGPTGPSGAPGFPGGAGAKGETGPQGGRGSDGPQ
GSRGEPGNPGPAGAAGPSGAPGGDGQAGGKGSTGAAGISGAPGFPGTRGPAGPPGSGGGP
GPKGNHGEHGAQGPKGEPGVKGEPGSAGPGGPPGPSGEEGKRGARGEPGGAGGVGPPGER
GMAGMRGFPGSDGAAGGKGGPGERGANGPMGAQGATGEAGRPGEPGMPGSKGMTGSPGSP
GPDGKVGPAGITGNDGRSGPPGSSGARGQPGVMGFPGPKGPGGDNGKPGERGEAGAVGGL
GAPGKDGDSGAPGPQGPAGSQGEKGEGGPAGPNGFQGLPGTQGATGEPGKAGEQGGPGEV
GGPGPSGSRGDRGFPGERGGIGSAGPAGPRGANGSPGNDGARGESGAAGAPGGMGAPGLQ
GMPGERGSGGNSGAKGERGDGGPKGADGGPGKDGMRGMTGPIGPPGPTGAHGEKGEGGLG
GPPGPTGGRGSPGERGEHGAPGPAGFAGPPGADGQPGNKGETGNNGPKGEAGAPGPGGPV
GAPGPQGPAGNSGTKGTRGAPGPPGASGMPGPGGRVGPPGGSGAPGSAGPPGPAGKEGQR
GGRGETGNAGRPGEAGAAGPPGPSGASGSKGNDGPMGAPGTPGPGGIAGQRGIVGGPGGR
GPSGTAGIPGTAGEPGKQGPGGPVGERGSPGPMGPPGLSGAPGEAGREGSTGHDGVSGRD
GPPGPKGDRGENGNAGSPGAPGPPGAPGPSGASGKSGSRGESGPAGPAGPNGPAGGRGGL
GPAGARGDKGEAGEGGERGHKGHRGLNGMPGLPGPSGSPGESGPAGLNGPSGPRGPHGSS
GSTGKDGMNGLPGPIGPPGPRGRNGEMGAAGAPGSPGLPGPPGPAGGGFHVAPIYNQEKG
PDPMRGGGGYHYRADEPDMMNNRDMDVDTTLKSLSQKVENIRSPEGSQKNPARMCRDIRM
CHPEWKSGQYWVDPNQGSPLDAVQVYCNMETGETCVYPSQDTVPMKNWYTSKNIREKKHV
WFSESMDNGFQFQYGSEGSNPEDVNIQLTFMRLMSNEASQNVTYHCKNSIAYMDEATGNL
KKALLLQGANEIEIRAEGNSRFTYSVSEDGCTSHTGTWGKTVIDYKTSKTSRLPIIDIAP
MDVGAPDQEFGVEVGPVCFV
NT seq 4383 nt   +upstreamnt  +downstreamnt
atgttcagctttgtggatattcggttagcgctgctgctcagcgcagcagtgctattggca
agaggtcaaggagaggacgatagcggattcggcagctgctcgttggacggccaacagtac
aacgataaggatgtatggaaaccagaaccctgccagatctgcgtctgcgacagcggaacc
gttatgtgcgacgaagtgatttgcgaggacacaaccgactgcgccgaccctatcatcccc
gacggcgaatgctgtcctatctgccccgatgactccgagagcgaggatccccagttacca
gaacgtcctcagccagagggaccacagggaggtgatggccccaagggtgacgatggtcct
gagggtgttccaggtaacgatggcgtggatggccagcctggcctgcccggccccccaggc
ccccctggacctcctggccttggcggcggagtcttctctcctcagatgcaccatggttat
gaccagaaatccagcggtggccaggcccaaatgggacagatgggccctatggggccccgt
ggtcttgctggcccaccaggcaacaccggtccccccggtcaccatggtccccctggcgag
cccggtgagcctggcggttctggtcccatgggtgaacgtggtgcaatgggcccccatggc
aagaacggagataatggtgagcctggcaggtctggtcgccccggtgagcgtggctccgct
ggccctcagggtggtcgtggaacccctggaactcctggcctccccggcatcaagggacac
agaggtttcaatggtatggatggcgccaagggagacggtggcccagctggccctaaggga
gagggtggttcccctggatccagtggcaactccggtgctatgggtgcacgtggtcttcct
ggtgagagaggccgccctggacctgctggctcttctggtgctcgtggtaacgatggtaac
tctggtcctgctggatctaatggacccactggcccatctggtgcccctggattccccgga
ggtgctggagctaaaggagagaccggtcctcaaggtggacgtggctcagacggaccccaa
ggatctcgtggagagcccggtaaccccggacccgctggtgctgctggaccctctggtgcc
cctggaggtgatggccaagcaggaggcaagggttccactggtgctgctggtatctctggt
gctcctggtttcccaggaactcgtggccccgctggaccccctggatctggtggtggaccc
ggccccaagggtaaccatggtgagcacggagcccaaggccccaagggagagcccggtgta
aagggagagcctggttccgctggtcccggtggaccccctggaccctctggtgaggaggga
aagagaggcgcccgtggtgagcccggtggagctggtggtgttggaccccctggagagcgt
ggtatggctggtatgcgtggtttccccggctctgatggagctgccggtggcaagggtggc
cctggtgagcgtggagccaatggaccaatgggagcccaaggtgccactggtgaggctggt
cgtcctggcgagcctggcatgcctggatccaagggtatgactggtagccctggtagcccc
ggacccgatgggaaagttggccctgctggtatcactggaaacgacggtcgctccggaccc
ccaggctcctcaggagccagaggtcagcctggagtcatgggattccctggacccaaagga
cctggtggtgacaatggcaagcccggtgagagaggtgaagctggagctgttggtggtctt
ggtgctcctggtaaagatggtgactctggtgctcctggaccccaagggcctgctggttct
caaggagagaaaggagagggcggccccgccgggcctaatggattccaaggtctgcctgga
actcagggagctactggtgagcctggcaaggctggtgagcagggtgggcccggtgaggtt
ggaggtcctggccccagtggatccagaggtgacagaggtttcccaggagagcgtggtggc
atcggatctgctggccccgctggaccccgtggagccaatggttctcccggtaacgatgga
gctaggggtgagagtggtgctgctggtgcccctggcggtatgggagccccaggtctgcag
ggaatgcccggagagcgcggctcaggcggcaactctggtgccaagggagaacgaggtgat
ggtggccccaagggagccgacggtggccctggaaaagacggcatgcgtggtatgactgga
cccatcggaccccctggacccactggtgctcatggagagaagggtgagggtggtctcgga
ggcccccctggccccactggaggtcgcggttcccctggtgagcgtggtgagcatggtgcc
cctggacctgctggattcgctggaccccctggtgctgatggtcagcctggcaacaaggga
gagaccggtaacaacggccccaagggtgaggctggtgctcccgggcccggtggacctgtt
ggtgctcccggacctcaggggcccgctggtaattctggtactaaaggaactcgtggtgca
cctggaccccctggtgcttctggtatgcctggtcctggtgggagagtcggtcctcctggt
ggaagtggagcccccggatccgcaggcccccccggccccgctggtaaagagggacagaga
ggtggacgtggtgaaactggtaatgctggtcgccctggtgaggctggagccgccggaccc
ccaggtccctcaggagcctctggatctaagggtaacgatggtccaatgggagccccagga
acccccggacccggaggtattgctggacagcgtggtattgtgggtggccccggaggaagg
ggacccagcggtactgcaggaataccaggaacagctggagagcccggtaagcagggacct
ggcggccccgtcggtgagcgtggctcccctggccccatgggaccccctggcttgtctggt
gcgcccggtgaagctggtcgtgagggttccactggtcacgatggtgtttctggtcgcgat
ggaccccccggccccaagggtgaccgtggtgagaatggtaatgctggttcccctggtgct
cccggacctcccggtgcccccggtccctctggtgcttctggcaagtctggtagccgtgga
gagtctggtcctgctggtcccgctggccctaacggtcctgctggtggtcgtggtggtctt
ggacctgctggtgctcgtggagacaagggagaggctggagagggtggagagagaggccac
aagggacacagaggtttaaacggcatgcccggtcttcctggaccctctggttcccctggc
gagtctgggcctgctggacttaacggaccttctggaccccgaggaccccatggttcttct
ggctccactggcaaagatggcatgaacggtctgcctggacccattggaccccccggaccc
cgtggtcgcaatggagagatgggagcagctggtgctcctggttctcctggtctgcccgga
cctccaggtcccgctggcggcggcttccatgtcgcaccgatctacaaccaggagaaggga
cctgaccccatgcgaggaggaggaggataccactaccgcgctgacgagcctgacatgatg
aacaaccgtgacatggatgtggacaccaccctgaagagcctcagccagaaggtggagaac
atccgcagccccgagggatcccagaagaaccccgcccgcatgtgccgtgacatcaggatg
tgccaccccgagtggaagagcggccagtactgggtggaccccaaccagggctctcctctg
gatgctgtccaggtctactgcaacatggaaaccggagagacctgtgtctatccatcccag
gataccgtccccatgaagaactggtacaccagcaagaacatcagggagaagaagcacgtc
tggttctcagagtctatggacaatggcttccagttccagtatggtagcgagggatccaac
ccagaagatgtcaacatccagctgaccttcatgcgcctgatgtccaacgaagcttcccag
aacgtcacgtaccactgcaagaacagcattgcctacatggacgaggccacaggcaacctg
aagaaggccctgctgctccagggagccaacgagatcgagatcagagccgagggcaacagc
cgcttcacatacagcgtcagcgaggacggctgcacgtcacatactggcacatggggcaag
acagtcatcgactacaagacatcaaaaacatctcgcctgcccatcattgacatcgctcct
atggacgttggtgcacctgatcaggagtttggcgtcgaagttggccccgtctgcttcgta
taa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112224605
Entry
112224605         CDS       T05605                                 

Gene name
thbs2
Definition
(RefSeq) thrombospondin-2 isoform X1
  KO
K04659  thrombospondin 2/3/4/5
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04145  Phagosome
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112224605 (thbs2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    112224605 (thbs2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112224605 (thbs2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112224605 (thbs2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112224605 (thbs2)
   00536 Glycosaminoglycan binding proteins [BR:otw00536]
    112224605 (thbs2)
   04990 Domain-containing proteins not elsewhere classified [BR:otw04990]
    112224605 (thbs2)
Membrane trafficking [BR:otw04131]
 Endocytosis
  Phagocytosis
   Opsonins
    112224605 (thbs2)
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   112224605 (thbs2)
  Exosomal proteins of colorectal cancer cells
   112224605 (thbs2)
  Exosomal proteins of bladder cancer cells
   112224605 (thbs2)
Glycosaminoglycan binding proteins [BR:otw00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   112224605 (thbs2)
Domain-containing proteins not elsewhere classified [BR:otw04990]
 Thrombospondin domain-containing proteins
  Thrombospondins
   112224605 (thbs2)
SSDB
Motif
Pfam: TSP_C TSP_3 TSP_1 TSP1_spondin VWC TSP1_ADAMTS EGF_3 TSP1_CCN EGF_CA Laminin_G_3 cEGF Laminin_G_2
Other DBs
NCBI-GeneID: 112224605
NCBI-ProteinID: XP_024244025
LinkDB
Position
25
AA seq 1207 aa
MVTAALTGGFALSPGDMILRRSLNLLPILLLCSSALPQDGEVTMDDDTTFDLFDISGITR
KTLGAKQFRGQDTDNPAYRFIRFDHLPSVSAPVLKQMLLQIQNNEGFVFVASMRQDRGSR
GTLIALEGANGQRQFEIVSNGRANTLDLVYWVDGSQNVVSFEDVDLSDSQWKNITLHVHG
ENANLFVGCSLIDSFILDEPFYEHLQAEDSRMFVAKGSIRENHFRGLLQNVRFMFDTSVD
DVLRNKGCEVTKADEANVVVSESTDMEDVSTSTAITTNFIGQKTEKLGADMCERSCEELS
TMFQELKGLRVVVGNLIDGLQKVTEENTVMKDALGKMKNSKEKHMCWQDGRLFEDKEDWV
VDSCTTCTCQDSKIVCHQITCPPVACASPSFIDGECCPVCLSKDSEDGWSPWSEWTECTV
TCGTGTQQRGRSCDATSNTCSGPSIQTRKCSLGKCDSRVRQNGGWSLWSPWSSCSVTCGE
GQITRIRHCNAPTPQLGGKDCEGQGRDTQRCEAKPCPIDGGWGPWSPWAICSATCGGGVK
GRTRVCNSPEPQYGGKKCPGETNDSDACNKQECPIDGCLSNPCFGGVDCNSAPDGSWECG
PCPLGFRGNGTHCEDVNECDMVSDICFKAGGASRCINTDPGFHCLSCPPRYKGTQPFGMG
VEAAKKNKQVCEPENPCKDKTHNCHRSSECIYISHFSEPMYKCECRIGYAGDGFICGEDS
DLDGWPNQNLVCGANATYHCKKDNCPNLPNSGQEDFDKDGQGDACDQDDDNDGIVDERDN
CPLMYNPRQFDFDKDDVGDRCDNCPYEHNPAQIDTDHNGEGDACAIDIDGDEILNEQDNC
PYLYNNDQKDTDMDGVGDQCDNCPLLHNPDQADTDNDLVGDQCDNNQDIDEDGHQNNLDN
CPYVANSNQADHDKDGKGDACDFDDDNDGIPDDRDNCRLTPNKDQLDSDGDGRGDACKDD
FDNDNIPDFLDVCPENNAVSVTNFRKFQMVHLDPKGTAQIDPNWVVRHQGKELVQTVNSD
PGIAVGFDEFNAVDFSGTFYVNTDRDDDYAGFVFGYQSSGRFYVVMWKQITQTYWEDKPS
KAFGISGVSLKVVNSTTGTGENLRNALWHTGNTKNQVRTLWHDPKNIGWKDYTAYRWHLI
HRPKTGFIRVVVYEGKQILADSGPVYDKTFAGGRLGLFVFSQELVFFSDLKYECRDKLEF
PTVLSIR
NT seq 3624 nt   +upstreamnt  +downstreamnt
atggtaactgccgctctaacagggggatttgcactttcaccaggagatatgatactcagg
agaagtctcaacttgctgcctattttattactttgctcctcagcgctacctcaagatggt
gaggtcacaatggatgacgacacaacgtttgacctgtttgatattagcggcatcacacgc
aagactctgggcgccaagcaattccgtggccaagacacggacaaccccgcttaccgcttc
atccgcttcgatcatttgccctctgtgagcgcgcccgtgctcaaacagatgcttctgcaa
atccagaacaacgagggcttcgtgttcgtggccagcatgcgccaggaccgcggctcgcgg
ggaaccctcatcgcattggaaggcgccaacggccaacggcagtttgaaatcgtctccaac
ggtcgtgccaacacgctggaccttgtctactgggtggacggctctcaaaatgttgtctcc
ttcgaggatgttgacctgtctgactcgcagtggaagaatatcacacttcatgttcatggc
gaaaatgcaaatctgtttgtgggctgcagtctcatcgacagcttcatcttggatgagcct
ttctacgagcacctgcaggcagaggatagccgaatgttcgtcgccaagggatccatccgc
gaaaaccatttcaggggcttactgcagaatgttcgcttcatgttcgacacatccgtggat
gatgttctgaggaacaaaggctgtgaagtcactaaggctgacgaggccaacgtggtggtg
agtgagagcacagatatggaggatgtgagtacctccacagccatcaccactaacttcatc
ggccaaaagacagagaagctgggagcagatatgtgtgaacgatcctgtgaggaactcagc
accatgttccaggagctcaaaggactgcgggttgtagtggggaacctcatagacggcctg
cagaaagtgacagaggagaacacagtaatgaaggatgctttggggaagatgaagaactcc
aaggaaaaacacatgtgttggcaggacggacggctgtttgaagataaggaggactgggtg
gtggacagctgcaccacgtgtacctgtcaggactcaaagatcgtgtgtcaccaaatcact
tgtcctcctgtggcctgtgctagcccctccttcatcgacggagagtgttgccctgtgtgt
ctgtctaaggacagtgaggacggctggtccccctggtcggagtggacagagtgtactgtc
acctgtgggacaggtactcaacagaggggacgctcatgtgatgccaccagtaacacgtgc
tccggaccatccatccagaccaggaaatgcagcctgggaaaatgtgacagccgagttcgt
cagaacggtgggtggagcctgtggtctccctggtcatcatgctcagtgacgtgtggcgag
ggccagatcaccaggatacgccactgcaacgcacccacaccacaactggggggcaaggac
tgtgagggccaggggagagatacacagcgctgtgaggccaagccctgtcccattgacggt
ggttggggaccatggtcgccatgggcgatctgctcagcaacctgtgggggtggagttaag
ggtcggacccgtgtctgtaacagccccgaaccccagtacggaggcaagaagtgccctggg
gagaccaacgacagtgatgcctgcaacaaacaagaatgccctatcgacggttgtctgtct
aacccatgcttcggaggagtggactgtaacagtgcccccgacggatcctgggagtgtggg
ccatgccctctcggtttccgcggcaacggaacccactgcgaagacgtcaacgagtgtgac
atggtgtctgacatatgctttaaagctggtggagcatcgcgttgcatcaacacagaccca
gggttccactgtctgtcctgcccaccccgctacaagggaacgcagcccttcggcatgggg
gtggaagctgccaagaagaacaaacaggtctgcgagccagagaacccctgcaaagacaag
acccacaactgtcaccggtcctcagagtgtatctacatcagccactttagtgaacccatg
tacaagtgtgagtgcaggatcggctacgctggtgatggtttcatctgtggagaggactca
gacctggatggatggcctaatcagaacttggtgtgtggggccaacgccacctatcactgc
aaaaaggataactgccccaacctgcctaactctggacaggaagattttgacaaagatggt
cagggagacgcgtgtgaccaggatgatgacaacgatggaatcgtggatgaaagagacaac
tgtcctctaatgtacaatcccagacagtttgactttgataaggatgatgtgggggatcgt
tgtgacaactgcccctatgaacacaaccctgcccagatcgacaccgaccacaatggggaa
ggtgacgcctgtgctatcgacattgatggagatgaaatcctaaacgagcaagacaactgc
ccgtacttgtacaacaatgaccagaaggacactgacatggatggagtcggtgaccagtgt
gacaactgtcctctgctacacaaccctgaccaggctgacacagacaatgaccttgtagga
gaccagtgtgacaacaaccaggatatcgatgaagacggtcaccagaataacctggacaac
tgtccttacgtcgccaactccaaccaggctgaccacgataaggacggcaagggggacgcc
tgtgacttcgacgatgacaatgacggtatccctgacgatagggacaactgtagattgaca
cccaataaggatcaactggactctgatggcgacggtagaggcgacgcttgcaaagacgac
tttgacaacgacaacatcccggacttccttgacgtgtgtcctgagaacaatgccgtcagc
gtcacaaacttccggaagtttcagatggtgcacctggaccccaagggaacagcgcagatc
gaccccaactgggtggttagacatcagggcaaggagctggtacagaccgtcaactctgac
cctggcatcgctgttggctttgatgagttcaacgcggtggacttcagtggtacgttctac
gtgaacacggaccgggatgacgactacgctggtttcgtgttcggctaccagtcgagcggc
cgcttctacgtggtgatgtggaagcagatcactcagacctactgggaagacaaaccctcc
aaggcctttggtatctctggtgtctctctcaaggtggtcaactcaactacgggcacaggg
gagaacctgagaaatgccctgtggcacacaggcaacactaaaaatcaggtgcgcactctg
tggcacgacccaaagaacattggctggaaggattacacagcctacaggtggcacctcatc
cacagacccaagactggattcatcagggttgtggtctatgaagggaaacagatcttggca
gactcgggaccagtgtacgacaagacgtttgctggaggacggttaggcctgtttgtcttc
tcccaggaactggtcttcttctctgatctcaaatatgagtgtagagataagctggagttt
ccaactgtgttgtccatcagataa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112224903
Entry
112224903         CDS       T05605                                 

Gene name
col6a2
Definition
(RefSeq) collagen alpha-2(VI) chain
  KO
K06238  collagen type VI alpha
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112224903 (col6a2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112224903 (col6a2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112224903 (col6a2)
   00536 Glycosaminoglycan binding proteins [BR:otw00536]
    112224903 (col6a2)
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   112224903 (col6a2)
Glycosaminoglycan binding proteins [BR:otw00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   112224903 (col6a2)
 Hyaluronan
  Extracellular matrix or blood plasma proteins
   112224903 (col6a2)
SSDB
Motif
Pfam: VWA Collagen VWA_2
Other DBs
NCBI-GeneID: 112224903
NCBI-ProteinID: XP_024244274
LinkDB
Position
26
AA seq 912 aa
MSLICTYTDCALDKMSEEMQRHDLRGHNSVRFAVVVTDGHVTGAPCGGIKVSAERARDQR
ISLFSVAASKVVDEAGMELIASSPAGVYRSNYMAVNVTDLNTCHSPPCDAPTGKIVTSSI
NQMINAMKYQAYLQCSKLQCLELPGPPGLKGNRGLKGTKGGVGLAGAKGTKGKQGDSGIE
GGIGPAGHKGVIGLKGEKGEFGSDGTKGASGGHGRNGTDGQKGIIGRIGTYGCKGDPGER
GPDGYPGSAGDMGLAGVNGEKGDPGHNGKPGPTGPLGEAGPPSYPGSPGIPGSPGRKGIP
GLNGEPGPKSQPGRPGDPGLKGLNGPGGPKGGKGEPGLQGKPGLHGDLGPKGSKGGPGLP
GPRGHQGDNGPDGQIGTAGEPGDPGQIGPHGDRGPQGDKGRDGFNYPGLRGETGAIGDNG
RPGPWGSRGNCGNKGEAGMKGPNGEPKWDSRSTGSEWEERIQRRPGAPGNPGPEGDPGLS
DCDVMSYLRETCGCCDCEKRCGALDIVFVIDSSESVGLTNFTLEKNFVINTINRLGSMAT
HPHSETGTRVGVVQYSHNGTFEAIRLNDSNIDSISAFKVAVKNLQWIAGGTWTPSALKFA
YDHLIRDSRRTRAKVSVVVITDGRFDPRDDDSLLTYLCDDPSVDVNAIGVGDMFGREGQH
ESLESIACQRHDRVTGMTRFADLVADNFIDRMESVLCPEPVIVCPDLPCVTEPEVAQCID
RPVDLVFLLDGSERLGHENFNQVRDFVQHLANHLTLAQDKNDRQGARMALLQYGGEAEHH
LAFHMTHDLPSILEGLASMDYHDMSSSMVGAAISHSVDHVLTRLNVRQTRHHAELNFVFI
TDGVTGRKGLEEGVDAMRNNQAVSTVIAMGTDVEQEVLEKLALKDQYAIFKGTDFYELNK
HSFLDRFHQWVC
NT seq 2739 nt   +upstreamnt  +downstreamnt
atgtcattgatctgtacctacactgactgtgccctggacaagatgtccgaggagatgcag
cgccacgacctccggggacacaactctgtccgcttcgctgtggtggtcactgacggccat
gtgactggcgccccctgtggggggatcaaggtgtctgcagaacgggctagagaccagcgc
atcagcctgttctcagtagctgcctccaaggtggtggacgaagcagggatggagctgatc
gctagctcgcctgcgggggtctaccgttccaactacatggctgtcaatgtcacagacctt
aacacctgtcacagtccaccatgtgacgcccccactgggaaaatagtcacatcatccatc
aaccaaatgatcaacgctatgaaatatcaagcctatttgcagtgctccaaactccagtgt
ctggagcttccaggcccccctggtctgaagggaaaccgaggactaaaaggaacgaaagga
ggagttggacttgctggcgctaaagggaccaagggcaaacagggggactctggtattgaa
ggtggaatcggtcccgcaggtcacaagggtgtgattggtctgaaaggtgaaaagggtgaa
tttggatcagatggaaccaagggagcgtcaggaggacacggcaggaatggaacggatggg
cagaagggtataattggtcgaatcggaacttatggttgtaaaggagatccaggagaaagg
ggcccagatggttatccaggaagtgctggtgatatgggactggccggtgtcaacggagag
aagggagaccctggtcataacggaaagccaggtcccactggccctcttggagaagctgga
ccaccgagttatccaggaagtcctgggattccaggctcaccaggaaggaagggaatacca
ggactcaacggtgaaccgggaccaaaaagccaacctgggcgaccaggagaccctggactt
aagggacttaacggaccaggcggacctaaaggaggcaagggtgaacctggtctacagggg
aagccaggtcttcatggggatctcggccccaaaggatccaagggaggtccagggctgccc
ggtccaagaggacatcaaggagataatgggccagatggacagatcggaactgctggagag
cctggtgatcctggacagattggaccccatggagatcgtggaccccagggtgacaaagga
agagatgggttcaactatccgggactaagaggagaaacgggagctataggggacaatgga
cgtccaggcccttggggaagtagagggaattgtggtaacaaaggagaagctgggatgaaa
ggtccaaacggtgaaccgaagtgggactccaggtcaacagggagtgaatgggaggagagg
atccagaggaggcctggagctcctggtaatcctggaccagagggagaccctggcctttct
gactgtgatgttatgagctacctcagagagacatgtggttgttgtgactgtgagaagaga
tgcggggcgctggacattgtgtttgtgattgacagctcagagtcagtgggtctgaccaac
ttcaccctggagaagaactttgtcatcaacaccatcaacaggctgggatccatggcaaca
cacccacattcagagacaggaaccagggttggtgttgtgcagtacagtcacaacgggaca
ttcgaggccattcgacttaatgactccaacatagactccatctctgccttcaaggtggct
gtgaagaacctccagtggatagccgggggcacctggactccctccgctctgaagtttgcc
tatgaccacctgatcagggacagccggcggaccagagccaaggtgtcggtcgtggtcatc
acggacggacgcttcgacccgcgggatgatgactctctgctgacctacctctgcgacgac
cccagcgtggatgtgaacgccatcggggtcggggatatgttcggccgggagggacagcac
gagagcctcgagtccatcgcatgccagaggcatgatcgcgtgacggggatgacacgtttc
gctgacctggtggcagataactttatagacaggatggagtcggtgctctgccccgagccc
gttattgtttgccctgacttgccctgcgtaacagaaccagaggtggcacagtgtattgac
agacctgttgatctggtgtttcttctggacggttctgagcgtctcggtcatgagaacttc
aaccaagtccgtgacttcgtccagcacttggcgaaccacttgacgctggcgcaggacaag
aacgatcgccagggagcccgcatggcgctgctacagtacggaggagaagctgagcatcac
ctggcctttcacatgacccacgaccttccgtccatcctagagggtctggccagcatggac
tatcatgacatgtcttcttctatggtgggggcggccatctcacactccgtagaccacgtt
ctgacgcggctcaacgtccgccagaccagacaccacgccgagctcaacttcgtcttcatc
actgacggcgtcaccgggaggaaggggctggaggagggggtcgacgccatgcgaaacaac
caggcagtctccacagtgatcgccatggggaccgatgtggaacaggaagtgttggagaag
ctggccttaaaggaccagtacgccatctttaaaggaacagacttctatgagctcaacaag
cacagcttcctagatcggttccatcagtgggtctgttaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112225026
Entry
112225026         CDS       T05605                                 

Definition
(RefSeq) collagen alpha-2(IV) chain-like
  KO
K06237  collagen type IV alpha
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112225026
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112225026
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112225026
   00536 Glycosaminoglycan binding proteins [BR:otw00536]
    112225026
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   112225026
Glycosaminoglycan binding proteins [BR:otw00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   112225026
SSDB
Motif
Pfam: Collagen C4
Other DBs
NCBI-GeneID: 112225026
NCBI-ProteinID: XP_024244357
LinkDB
Position
26
AA seq 1694 aa
MKFEVRMSGTMQTRHRIELKSLKFLFLCLSVAILASGVDAGGKKHNGPCGGRDCSGGCKC
FPEKGARGQPGPLGPQGPNGPPGGLGDPGVQGVQGEKGDRGRGGFIGPKGSVGMTGVPGF
SGSDGIPGHPGQAGTRGKPGADGCNGTHGDSGLSGKPGYDGQPGYNVRMNPVMSPAVAIL
IYIYIYIYNYSISKMTLHSDILSFSILPSHSQGPQGYPGRSGYRGLPGPQGPLGFPGLPG
PKGTMTKVLKGVKGEAGEAGQQGPPGNSTHPHTSPLTGPYGRKGEKGLKGETGVEADNKG
ETGIMGMPGQRGVPGRDGEQGLRGDLGEPGFRGRDGQKGAIGELGELIYYEGPSEGPNRV
GPPGQLGPQGEMGLQGEKGLPGRAGPPARKSDSQIQVEYLWGPFGEPGIKGETGPPGEPG
IPALSPGPPGIGGISGLRGPPGPPGSWADFYKGFAGSRGRPGSAGRKGLKGDHGLCECNI
VHSPPGLPGPAGSQGDPGMSGEFGQQGEPGEPGPQGVIGLPGFPGATGQPGPKGRKGELI
WAKEKGYAGDPGDPGATGDPGLQGFPGPRGINGFPGNRGLSGDAPEGLTGEKGYPGRSGL
PGLFGQMGEPGRVLGATKGVRGLQGDDGEPGYAGVEGRAGDPGVSGCSPRGDERLNDKGD
CDAVPGPPGMPGPPGPQGLVGFPGIPGQNGFTGPLGDDGAKGEIGEQGIGGSPGQPGFTG
PRGDLGQPGAKGKPGDQGLPGQQGRDGESGEKGPHGEIWGASTGQTGEVGLPGEQGPKGF
SGEPGNEGYPGMGGMPGMIGFKGDMGPSGLQGEQGRPGAAGKYGWKGVPGQVGVHGPTGS
IGQPGLSGGRGDQGDPGAPGPIGLKGTPGEFGGLGAEGNTGHLGDPGEPGPTGHSGLPGF
KGIKGSIGMSGFGGMPGESGLKGFSGQKGEDGIPGGFGQKGIMGDYGSKGERGLSGLPGE
KPLIPRQIINDMKGTKGEDGTPGQIGFTGPRGPKGFPGVPGMEGYHGVPGDPSDEKGFPG
NPGAQGLPGPKGMPGPTGSNGISGFPGMSGHRGEKGTPGAYGSSGDPGVKGVKGEEGPII
DMPGSTGLRGEDGFPGVPGQKGYIGNPGDRGGGGFHGIDGMKGGLGEPGIGGPLGSDGQG
GFQGNQGTKGWPGIPGESGTNGRPGFPGQRGFPGLKGILGLDGLKGEKGIPGLPGQDNLG
TPGVPGAKGTRGETGIPNSEVGTPGSLGLKGVQGQPGDQGQVGPPGFQGPQGPQGTSDKP
GPSGDPGFPGPKGLPGFPGPRGYPGEPSPYGEKGLAGHYGFPGFSGLKGKQGDQGPSGYK
GQSGVSGKKGVKGEQGMMGIPGRFGFQGDRGPSGPKGHTGLIGYPGAPGNQGPAPVPTRM
PGERGAPGPQGIRGPEGVRGETGPKGPPGAPGYLGPQGQKGMPGVGGRPGTPGYRGNDGG
RGHLGLQGMEGHRGNPGNTGLPGMPGRSVSVGYLLVKHSQSEQTPMCPVGMSKLWDGYSL
LYFEGQEKAHNQDLGLAGSCLPRFNTMPFLYCNPGDVCYYASRNDKSYWLSTTAPLPMMP
VEEEEIKPYISRCSVCEAPSVAIAVHSQDITIPQCPVGWRSLWIGYSFLMHTAAGDEGGG
QSLSSPGSCLEDFRTTPFIECNGAKGTCHYFANKHSFWLTSIEQSFQAEPASETLKAGQF
LSRISRCQVCMKNL
NT seq 5085 nt   +upstreamnt  +downstreamnt
atgaagtttgaagttcggatgagcgggacaatgcagacaagacaccggattgaactgaag
agcctgaagtttctgtttctatgtctttccgtggccatcctagcatcaggagttgacgca
ggtggtaagaagcacaatgggccatgtggaggaagagactgcagcggaggatgcaaatgt
ttccctgagaagggcgccaggggccaacctggtcctcttggcccgcagggacccaatggg
cctccagggggcctaggggatccaggagtccaaggagtccaaggagagaagggcgaccgg
ggcagaggaggcttcatcggccccaagggttctgtggggatgactggtgttcctgggttt
tctggatctgacggtattcctggccatccaggacaggcagggactcgtgggaaacctgga
gcagacgggtgcaacggaacacatggagattcagggttgtcagggaaaccaggctacgat
ggccaacccgggtataatgtacgtatgaacccagtgatgtcaccagcagttgcgatttta
atatatatatatatatatatatataactactccatatcaaaaatgacattgcactctgac
attctatctttctccatcctcccttctcactctcagggtcctcagggttacccaggtcgg
tcgggctacagaggactcccaggaccacagggcccattagggttccctggccttcctgga
ccaaagggcaccatgaccaaagtgttgaagggggtcaaaggagaagcgggtgaggctgga
cagcaaggtcccccagggaactccacccatcctcataccagcccacttaccggaccctat
ggcagaaagggtgaaaaagggttgaaaggtgaaactggagttgaggctgacaacaaagga
gagactgggattatggggatgcctgggcaaaggggtgtccctggtcgggatggagagcaa
ggactaaggggggaccttggagaaccaggatttaggggcagagatggccaaaagggtgcc
atcggagaacttggggagttgatctattatgaaggtccctcagaagggcctaacagagtt
ggtccccctggacagctgggaccccagggagagatgggtttgcagggggagaaaggtctg
ccgggccgggctggacctcctgctaggaagagtgatagtcaaatacaagtggagtacctg
tggggtccgttcggggaaccggggataaagggagagacgggcccacctggagagccaggt
atccctgctctcagccccggacccccaggtatcggcggaatatctgggttgaggggccca
cctggaccaccaggatcatgggcggacttctacaagggatttgctgggtcgagagggcgg
ccaggctctgcggggagaaaaggactgaaaggtgatcacgggttgtgtgagtgtaacatt
gtccactctcctccgggcctgcctggccctgctggcagccaaggcgaccctggaatgagt
ggcgagtttggtcagcagggcgagccaggcgagccaggaccccaaggtgtcatcggactg
cctgggttccctggtgccacaggacaaccgggtccaaagggcaggaagggcgagttaatt
tgggccaaagagaaaggatatgccggggacccaggagacccgggtgcgactggtgaccca
ggattgcaaggcttccctgggccaagagggatcaatggattccctgggaaccgtggtctt
tcaggggacgcacccgagggactcactggagaaaagggttatcctggccggtcgggtctc
cctgggttgtttggacagatgggagaaccgggacgggttctaggtgccactaaaggggtc
agagggttacaaggcgatgatggggagccgggttacgctggtgtcgaaggtcgagctgga
gatccaggagtgtctggctgtagtccgagaggagatgaacgactgaatgacaaaggcgat
tgtgatgccgtacccggaccacccggtatgccaggaccaccaggaccccaagggttagtg
ggtttcccaggcatcccaggtcaaaatggattcacaggtccacttggagatgacggggcc
aaaggagagataggagagcaaggcataggagggtctcccggacagccaggtttcactggc
ccccgtggagacctgggtcagcccggcgccaagggtaaacctggagatcaaggtctgcca
ggccaacagggccgggacggggagtccggggaaaagggaccacacggggagatctgggga
gcgtcgaccggacaaactggagaagtgggtcttcctggagagcagggacctaaaggtttt
agcggagagcctggaaacgagggctacccagggatgggtggcatgcctgggatgattggg
ttcaagggcgacatgggtccttcaggtctacagggggagcaaggaagaccgggagctgct
gggaagtacggctggaaaggtgtacccggacaggtgggagtccatggaccaacaggaagc
atcggacaaccaggtttgagcggaggcaggggtgatcagggcgaccctggcgccccgggg
ccaataggactgaaggggacaccaggggagtttggaggtctgggtgctgagggaaacacc
ggacacctgggtgaccctggagagccaggacctacaggacactctggcctgccagggttc
aaaggtatcaaaggttctattggcatgtcagggtttggaggtatgcctggtgagtcgggc
ctgaagggcttctctggacagaagggagaggatggcatacctggcggatttggacagaaa
ggaatcatgggcgactatggttcaaagggtgaacgtggtctgagtggcctgccaggcgag
aaacccctcatccctcgtcagatcatcaatgacatgaaggggaccaagggagaagatgga
accccaggacaaatcggatttactggacccagaggtcctaaaggttttcccggagttccg
ggtatggagggctaccatggcgttcccggagaccccagcgatgagaagggtttcccaggc
aacccaggggcgcagggacttccagggccaaaaggaatgccaggtccgactggatcaaac
ggaatcagcggctttcctgggatgtctggtcacaggggggagaaaggtaccccgggtgcc
tacggatcttcaggagatccaggagtgaagggtgtcaaaggtgaggagggtcccataatc
gacatgcctggatccacaggactgaggggggaggatggtttcccaggggttccaggtcag
aaaggctacattgggaatccgggagacaggggcggtggtggtttccatggtattgatggc
atgaaaggggggctgggagagcctggcataggaggacctctaggatctgatggtcaagga
gggtttcaaggcaaccagggtacgaagggatggcctgggatccccggagaatcaggcaca
aatggacggccaggcttcccaggacagagaggttttcctggactgaagggtatattggga
ctggatggactgaagggtgagaagggcatccctggacttccaggtcaggataacttggga
accccaggtgttcctggtgctaagggaacgaggggtgagaccggtatacccaactcagag
gtcgggaccccaggatcgctgggtttgaagggcgttcaaggacaaccaggtgaccagggc
caggtgggacccccagggtttcagggcccccaaggaccacagggcacctcagacaaacct
ggaccatcaggagaccctggcttccctggacccaaagggctgccaggtttccctgggccc
cgtggatatcctggtgagccctctccatacggagagaagggtttagctggccactatggc
ttccctggattctctggtctgaaaggaaagcagggggatcagggaccatcaggctacaaa
ggacagagtggagtgtctgggaagaaaggtgtgaagggagagcaagggatgatgggaatt
cctggtaggtttggtttccaaggagaccgaggtccttctggcccaaaaggacatactgga
ctcataggttacccgggagccccaggtaaccagggcccagccccagtccccaccaggatg
ccaggagaaaggggtgctccagggcctcagggcatccgaggaccagagggggtacgaggg
gagactggcccgaaaggaccccctggagctccaggctacctgggcccccaggggcagaag
gggatgccaggggtgggtggcagaccgggtacccctgggtaccgtggaaatgacggaggg
aggggccaccttggtcttcagggcatggaaggacaccgtggtaacccaggtaatacaggg
ttgcctggcatgcctggacgcagtgtgagtgtgggatatctgctggtgaagcacagccaa
tcagagcagacccccatgtgccccgtgggcatgtccaagctgtgggatggctacagtcta
ctgtacttcgagggccaggagaaggcccacaaccaggacctaggtctggcaggctcctgc
ctccctcgtttcaacaccatgcccttcctgtactgcaaccccggagacgtctgctactat
gccagccgcaatgacaagtcctattggctatccaccaccgcaccccttcccatgatgccc
gtggaagaggaagagatcaaaccctacatcagccgctgctctgtgtgcgaggcgccatcc
gtcgccatcgccgtgcacagccaggacatcaccatcccacaatgccctgtgggctggcgc
agcctgtggattggctactccttccttatgcacacagcagcaggtgacgagggcggtggt
cagtctctgtcgtcccctggttcctgtctggaggacttccgcaccactcccttcatcgag
tgtaacggggccaagggcacctgccattacttcgccaacaaacacagcttctggctcacc
tccatcgaacagtccttccaggcagagcctgcctccgagaccctgaaagcaggccagttt
ctctcacgcatcagccgctgtcaggtctgcatgaagaacctgtga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112225082
Entry
112225082         CDS       T05605                                 

Definition
(RefSeq) collagen alpha-3(VI) chain-like isoform X1
  KO
K06238  collagen type VI alpha
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112225082
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112225082
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112225082
   00536 Glycosaminoglycan binding proteins [BR:otw00536]
    112225082
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   112225082
Glycosaminoglycan binding proteins [BR:otw00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   112225082
 Hyaluronan
  Extracellular matrix or blood plasma proteins
   112225082
SSDB
Motif
Pfam: VWA VWA_2 Collagen Kunitz_BPTI VWA_3 fn3 DUF5446
Other DBs
NCBI-GeneID: 112225082
NCBI-ProteinID: XP_024244464
LinkDB
Position
26
AA seq 3216 aa
MRKHRLLPLCALLGVLFAGLLPKLDAQGQEDCAQGLAADIYFLVDSSWSMGQENFEHVRQ
FLYSVVKALHEGGGGRFQFALVQYSGSPKTEFQLNTYPSPLGALAHIRAMAYRGGGTRTG
LGLDFLIRAHLNAAAGSRAGVGVAQAVVILTDGRSQDDVAEPAQVLRLAGVSMFAVGVQD
AVDWELREMASVPQDIHIFSVDSFQALKGIIQDLVVGLCGAVTQAGGAPMAVEAKEVPRD
VTAQESADLVLLIDGSENVGAANFPRVRDLAMKVIEGLDVGRDTIRVAVALYSADLEIQF
FLNSYDTKAAVLDAVKALQFTGGDEANLGAALENVAGSLLIPASGGRAEEGVPQALVVIS
AGPSNDDFSAGDRALKAASIITFGVVVGGEATAELETIATDKSFVLSAPDFRAVASLGDQ
LLPYVNAVAQRTIVIQNEFTEALEVGKRDIIFLVDSTMGATLINSLREFIKRFVDTMPIG
PDQVQVGVTQFSNTARDEIELNAYGSKEDLSAALGRLKPRPGQVVNIGAALDFVRTNTLR
ADKGSRIKQGVPQLVLLLTSKKSSDSVGQAAEALQRMGVLTLAAGSKTADEQELKQIAFD
ESLVFMLKDFRALIRNPKLIVSPLSTLSGVVMIEGPTEPVVEITTVQTQRVVRDIVFMVD
GSSYIGGANLPYVRDFIASVVNQLDVRPDRVRIGLMQFAENPKIEFYLNTHNTKQDVLAS
LGELRLMGGSALNTGAAMDYALTNMFQASTGSRKRQGVQQVLLLITGGPSQDEVKRIADK
VAVAGVLTFTVSAGQADEDYLKTVAFVPNLAYHESRFADLPSVVEQIMTPLTTVVGDTDI
TETEITEEPAVVGGERDVAFLIDGSDNVRADFPYIRDFIIKVIEPLDIGQDRVRISVVQH
SERPAPNFYLNTYKDKAEVLRAVNDLRLSGGRSLNTGMALKFMKDTILSPVHGSRAAQNV
PQFLIVLTGGKSKDSVKESAGALKTDGVVPFGVGVKDADPKQIEAISHNPSFAFNVKEFS
QLSTVQQKLNSYVSLSKEKLKVVLEEAESQGPKKDIVFLVDGSDGVGREFPIIQEFISSI
VKNLNVGENKIRIGVVQYGDSPNADIYLNSHTTKEGVMNAVKGLRQRGGRERNLGQGVEF
VSSEVLNVRRGGRKEEGVPQFLIVVSGGRSTDDIRRPATSLKKSGVLPFSIGTRDVNSQE
LQVVSYVPNFAYTVDDLPGLYTVQDKLISTLTEMSDDDIARLRPVFPAPDVIVPTGGEKR
DVVFLIDGTTAVRSEFPAIRDMIGRVVEKLDVGLDRVRVSVVQYSDDAKTEFLLNEHSTK
DEVRQATRKIQSRGGNRLNTGRALDWVSKNIYQRSAGSRIEEGVPQFLILVTGGKSNDDV
SGPANQLKTNLVAPLAIGAKNADPNELRQISLKPEFAYSINNFGQLPTVEQQLIASVNTM
TTTDISSSFVPPVLDIANLNMGRKDIIFLIDGSDTTGSSGIAHIRDFILNIVQQLDVQPD
QVRVAVVQYSDKVKTDFSLNSHNNKPAVLSAIKRLRQQGGRSSDLAKAIEYVIRNELKSS
AGVRLAEASQHLVVLTGGRSPTDVSVYGPLLKGSRVNCIGIGAGGADSRQLNQIATSSAD
VLQVPTFPGLPTIKERFIARLNGTIPEEAPTETDEPTSGLPKAKAADIVFLVDGSINLGK
DNFKEVMEFILNLVDLFFTERDNLQIGLAHYATDVTDVFYLNTYKTKDDIISALSRTEYK
GGRRINTGAAIRHVQENHFIKDKGSRKDEGIPQILMIVTGGKSSDDGKTAALGLKATGVR
IYAVGVGDIEDELNNLASEASTVARASTFMELSELNEQILETLDDEVKGIKLCTGVSQEP
SKACSLEVLVGFDVSSQNIFQAQRILESKMGAILQRITKMTGISCSSGQIPSIQVGILAM
DSASEPVHLEFTDNADMLFEAFRALRNRGPYVLNAKTISAYGSRFKSRAADAVKVVIHLT
DGLDGQYNEMKRGVEELKISGVNSFILVGLERVPRFEEAVLLEFGRGFRYTRPLRVNVMD
LDYELLEELDNIAERECCAVPCKCTGTRGDRGAVGLGGSKGSPGGAGGAGHPGDEGGPGD
RGPPGVNGTQGFQGCPGQRGIKGGRGYSGEKGEYGEIGLDGINGEEGKSGVAGPPGDRGH
PGRRGPKGTKGHAGDIGDTGIRGDPGTTGQDNNVAGPKGDPGDVGPVGEPGEDGKKGGPG
EPGRTGSDGRRGPPGQAGNPGKPGGDGVQGEPGIGGSRGQAGPIGAPGTRGEDGNPGPRG
PGGAQGTPGDKGRRGALGRKGEPGEPGPKGIVGPLGPRGEPGEDGRDGFGIAGPKGRKGD
EGFPGFPGPKGAAGDGGNNGGPGPIGNRGQRGVSGEIGTPGQKGEVGYPGPYGQKGPRGP
GVVQCDLVKKIRDNCPCCYGQQECPLYPTELAFALDASDGVGRPAFNNMRDAVLRLVGNI
TISESNCPRGARVALTLYNNEVTTEIRFADALKRRSLVQRVEGLQALQTRKQRSLETAMN
FLAQNTFKRVRSGFLMRKVAIFFVNGPVKDQRAVSAAALRLYDSGIASVFLVNKEDGQLT
RALKMNNTGSALGQVIVLPNPGSAQYNSAIQKVMSCHICLDSCAPDQMCDYVPPQQSRDR
RSSTTDVDIDMAFVMDSSETTYPTVFTEIKRYVAHIVEQLEVSSDPMASIHHARVAVIQQ
APYEFLRNSSGSPIRVDVGLTDHRSAQDIRNFLLDKTPQLEGGRALAAAIEHTVEQVFER
APHQRDLKVLTLFVTGPVEEDEERLVAVATDAKCKGYFLVILGVGEKLSAGDARVMMRMA
SEPSDVFFKRLTSTSHFYDKHIQNFGRLLPKYLSIENAFYMSPEVSKNCHWYQSDQPFPK
FPFPKSHHSQEKHQKHHENHQAVHPKHKDQEELHVANTTSSGLTLRWASPDPKLIAYFEV
VVTRLRDHTLVLRRNVTGTELTVGGLESAQTYHAVVTTRTAQGHVAATHKGIITTKAAAE
HKIAAPMEVTGIIATTPLDKPEIANELTDPCSLDFDPGLACKNHQAKWFFDRKNGICTQF
WYGGCEGNGNRFETEAQCLKRCMRSEPEQQVEQLQTEILSAPAALTGVEICQLPKEEGAC
AKFVLKWHYDALGKSCTRFWYGGCGGNQNRFETQEECEKTCGKAALPRGQKAWDWLDESL
ANPERHSQRRVRMKGKRRKGSLGAPVNQGVIAAIRT
NT seq 9651 nt   +upstreamnt  +downstreamnt
atgagaaaacaccggctgttaccgctgtgcgctcttctgggtgtcctgttcgcaggactt
ctgcccaaacttgatgcccagggtcaggaagattgcgcacaaggcctggctgccgatata
tactttcttgtggattcgtcctggagcatgggacaagagaactttgagcacgtccgacag
tttctgtacagcgtggttaaagcactgcacgagggtggcggtggcagatttcagttcgcc
ctcgtccagtacagcggctcgcccaaaactgagttccaattgaacacatacccatctccg
ctgggggccctggcccatatccgggccatggcgtaccgggggggtggcacccggacgggt
ctgggcttggactttctcatccgggcccacctgaacgcagcggctggtagccgcgctggc
gtgggtgtggcccaggcggtggtgatcctgacagacgggcgctcccaggatgacgtggct
gagccggcgcaggtgctgcggctagcaggggtgagcatgtttgcggtgggggtgcaggac
gccgtggactgggagctcagggagatggctagtgtgccacaggacatacacatattcagc
gtagactctttccaggccctgaagggtattatccaggacttagtggtgggcttgtgcggc
gcagtcactcaggccgggggcgccccgatggctgtcgaagccaaagaagtgcctcgagac
gtgacagcacaagagtcagctgaccttgtactcttaattgacggatctgagaacgttgga
gcggccaacttcccccgcgtgcgcgatttggctatgaaagtcattgagggcctcgatgtg
ggcagggacacaattcgggtggctgtggctctgtacagtgcggacctagagattcagttc
tttctaaatagctatgacaccaaagccgctgtcctggacgctgtgaaggcccttcagttc
acaggcggcgatgaggctaaccttggagccgccttggagaatgtcgctgggagcctgttg
attccggcatcagggggcagggcagaggagggggtgccccaagctctggtggtgatcagt
gccgggccgtccaatgacgatttcagtgcgggtgacagggctcttaaggcagcaagcatt
atcacgtttggcgtggtggtcggcggcgaggctacagccgagctggagactatcgccaca
gacaagagctttgttctgtcggcccccgatttcagggcagtggcaagcttgggtgaccag
ttgctaccatatgttaatgcagtggcccagcgcaccattgtcattcagaatgaattcaca
gaagccttggaagtgggaaaaagggatatcatttttctcgttgacagcactatgggtgcc
acattgatcaactctcttcgtgagtttatcaaaaggtttgttgacaccatgccgatcgga
ccggatcaagtgcaagtgggtgtgacccagttcagcaacactgccagggatgagattgag
ctgaacgcatatggatccaaggaagacctgagtgcagccctgggcagactcaagccaaga
ccaggacaagtggtgaacatcggggcggccctggactttgtgaggaccaatacgctgagg
gctgacaaggggagtcgtattaagcagggcgtgccccagctggttctgttgttgaccagt
aagaagtccagcgacagcgtggggcaggctgctgaggcactgcagcgcatgggggttctg
accctggctgccggctctaagacggccgatgagcaggagctgaagcagattgcctttgat
gagagcttggtgttcatgctgaaggacttccgcgcattgatccgcaaccccaagttgatt
gtctctcccctctccactctatcgggggttgtgatgattgagggaccgacagagccagtg
gttgaaattacaacagtgcagacccagcgagtagtcagagacatcgtctttatggtggat
ggctccagctacattgggggtgccaaccttccgtacgtgcgggatttcattgccagtgtg
gtaaaccagctggacgtgcggcccgacagggtgcgcatcggtctcatgcaattcgcagag
aacccaaagattgaattctatctgaacacgcacaacacaaagcaagatgtgctggctagc
ctgggtgagctcaggctaatgggagggtctgctttgaacacgggagcggcaatggattac
gcacttaccaacatgttccaggcctcgactgggtcacgtaagaggcaaggtgtccaacag
gtgcttctcctgatcactggaggcccatcccaggatgaggttaaaaggatagcagacaaa
gtggccgtggcgggtgtactgaccttcacagtcagtgctggccaggcagatgaggactac
ttgaagacggtcgcttttgttccaaacttggcttaccatgaaagcagatttgctgacctg
ccaagtgttgttgaacagatcatgactcctttgactactgtggttggagatacagacatc
acagaaacagaaataaccgaggaacctgcagtcgttggaggcgagagggatgttgcgttc
ctgattgacggctctgataatgtccgagcagatttcccctacatccgggactttatcatc
aaagtcattgagcctcttgatattggacaagatagagtgcggatttcagttgtccagcat
agtgagaggccagctcccaatttctacctgaatacatataaggataaggctgaagtttta
agggctgttaatgatctaagactgtctggtggacggagtctgaacaccggaatggctttg
aaattcatgaaggacaccatcctgtccccagttcatggtagtcgggcggctcaaaatgta
ccccagtttttgattgttttgaccggaggcaagtctaaggatagcgtgaaggagtctgct
ggtgctttaaagaccgatggagtggtaccatttggcgttggtgtcaaggatgcagaccct
aagcaaatcgaggctatttctcacaacccatcctttgctttcaacgtgaaggaattcagc
cagctcagtacggtccaacaaaagctcaatagctatgtgagcctttccaaggaaaagctg
aaggtcgtcttggaggaagctgagtctcagggtcccaagaaggatatcgtcttccttgtt
gatggctcagatggcgtcggaagggagttccccatcatccaggagttcatcagctcaatc
gtgaagaacctcaacgtgggcgagaacaagatcaggattggtgtggtgcagtatggcgac
tcccccaatgcagatatctacctaaactcccacacaaccaaggagggtgttatgaatgct
gtcaagggactgaggcagcgaggcggcagggaacgtaacctgggtcagggagtggagttt
gtcagcagtgaagtgctgaatgttcgacgtggcggcaggaaggaggagggtgttccacag
ttcctgattgtcgtttctggtggaaggtccacagatgatatccgtcgacctgcgacctca
ctgaagaagtcaggcgttttgcctttcagcatcgggaccagagatgtaaactctcaggag
cttcaggttgtttcctatgttcccaactttgcatacactgttgatgacctccctggcctg
tacacagtccaggacaaactgatctccacgctcacagagatgtccgatgacgacattgcc
aggctacgtcctgttttcccagctccggatgtcatagtacccactggcggagaaaagagg
gatgtggttttcctcattgacggcacaacagctgtgcgcagcgagttccccgccatccgt
gacatgatcgggagggtcgtggaaaagctggacgtgggtctggatcgggtgagggtgtca
gtggtgcagtacagcgacgatgccaaaacggagttcctcttgaacgagcactccaccaaa
gatgaggtccgccaagccacgaggaagattcagagcaggggtggaaaccgtctaaacact
ggccgtgccctcgattgggtttccaagaacatctatcaaagatcagccggtagccgcatc
gaggagggtgtgcctcagttcctcattctagtcacggggggaaagtccaacgacgacgtc
tctggaccagccaaccagctgaagaccaacctggttgcccctcttgccatcggggcaaag
aatgccgaccccaacgaactgaggcagatctccctgaagccagaatttgcctactccatt
aacaactttgggcagcttccaacagtggagcagcagcttattgcttcagtcaacaccatg
accaccactgacatctccagtagttttgttcctcctgttttggatattgctaacctcaac
atggggaggaaggacatcatcttcctcatagacggctcggacaccacagggtccagtggc
atcgcccacatccgtgacttcatcctcaacatcgttcagcagctggatgtgcaacctgac
caggttcgggtcgctgtcgtccaatactctgacaaggtcaagacggatttctctctcaat
tcccacaacaacaagccagctgtgctctctgccatcaaaagactacgccagcagggtggc
agatcgtcggatctagccaaagccatcgagtatgtgatcaggaacgagctgaaatcctca
gcgggtgtccggcttgcggaggcctcccagcatctagtggtcctcaccggcggaaggtcc
cccactgacgtgtctgtgtatggccctctgctcaaaggctctcgggtcaactgcattggc
attggggctggcggagcagactccaggcagctcaaccagattgccaccagctctgccgat
gttcttcaggtacctactttccccggcttgcctaccattaaggagaggttcattgccagg
ctcaatgggacaatccccgaggaggcccctacagaaactgatgaaccaacttcaggactc
ccgaaagccaaggctgctgacatcgtgttcttggtggatggctccatcaaccttggcaag
gacaacttcaaggaagtgatggagtttatcctgaaccttgtagacctcttcttcaccgag
cgtgacaacctgcagattggcctggcccactatgccactgacgtcaccgacgtcttctac
ctcaacacctacaagaccaaggatgacatcatcagcgcccttagtcgcacagagtacaag
ggtggccgcaggatcaacacgggcgctgccattcgccacgtgcaggagaaccacttcatc
aaagataaaggcagcaggaaggatgagggcatcccccagatcctgatgatcgtcactggc
ggaaagtcatccgacgatggcaagactgccgctctggggttgaaggccaccggtgtccgt
atctacgccgttggcgtgggcgacattgaggacgagttgaacaacctggcaagcgaggcc
tccacggtggccagggcgagcacgttcatggagctctctgagctcaacgagcagatcttg
gaaacattagacgacgaggtgaagggaatcaagctgtgcactggcgtgagccaggaaccc
tcaaaagcctgcagtctggaggtgttggtgggcttcgacgtgtcctcgcagaacatcttc
caggcccagaggatcctggagtccaagatgggtgccatcctccagagaatcaccaagatg
acgggcatcagttgctcatcgggacagatcccctcgatccaggtgggcatcctggccatg
gatagcgcctcggaacctgtccacctggagttcacggacaacgccgacatgctgtttgag
gcattccgggccctgcgcaatcgcggcccctatgtcctcaatgccaagaccatttccgca
tacggttcgaggttcaaaagccgagccgcagacgcagtcaaggttgtgatccatctgact
gacggtctggatggccagtataacgaaatgaagagaggagttgaggaacttaagatttca
ggtgtgaacagcttcatcctggtgggtctggagcgggtacccaggtttgaggaggctgtg
ctgctggagtttggccgaggcttcaggtacaccagacccctccgagtcaatgtcatggac
ctggactacgagcttctggaggaactggacaacattgctgagagggagtgctgtgcagtg
ccatgtaaatgcaccggcacaaggggagaccgaggagcagtcggacttggaggatccaag
ggcagcccaggtggagcaggcggagcaggacatcccggagatgagggaggacccggagac
agaggtcctcctggtgtcaatggaacgcaaggtttccagggctgtcctggacagaggggc
atcaagggtggtcgtggatactctggagaaaagggggaatatggagagatcggcctggat
ggcataaacggagaagagggcaagagtggagtcgctggacccccaggagacagagggcac
cctgggagaaggggacccaaaggaactaaaggacatgcaggagacatcggggatacagga
atcagaggagatcctggaaccacaggtcaagataacaatgtggctggacctaaaggagac
ccaggcgatgtcggcccagtgggagagccaggggaggatggtaagaagggaggccccggt
gaaccaggcaggacgggttctgatggtagaagaggcccacctggacaagctggaaaccct
ggcaaacccggaggcgatggtgtgcagggagagcctggtattggaggatccagaggccaa
gctggaccaatcggtgcacctggaaccagaggtgaggacgggaaccctggaccaaggggt
ccaggaggagcccagggaacccccggagacaagggcaggagaggagctctgggtcgcaag
ggtgagccaggagagcccggaccaaaaggcatcgtgggacctctgggacctcgtggtgag
cctggcgaagatggtcgagatggatttggtatcgcagggcccaaaggaagaaagggtgat
gagggcttcccaggattcccaggaccaaagggggcggcaggtgatggaggaaacaatggc
ggaccaggacccataggaaaccgtggccagaggggtgtttcaggtgaaatcggtactccg
ggtcaaaagggagaggttggataccccgggccttatggccagaaaggaccgagaggacct
ggcgttgtgcaatgtgaccttgtgaagaaaatcagagacaactgtccttgctgctatggt
caacaggagtgccctctctaccccactgagctagccttcgccctggatgcctcagacggc
gtgggtcggcctgccttcaacaacatgcgtgacgccgtgctccgcctggtcggcaacatc
accatctccgagagcaattgcccacgcggtgcccgcgtggccctcaccctctacaacaac
gaggtgaccaccgagatccgctttgccgatgcgctgaagcgccgctccctggtgcagcgc
gtggaaggcttgcaggcattacagacgcgcaaacagcgcagcctggagacggccatgaac
ttcctggcgcagaacaccttcaagagggtgcgcagcggcttcctcatgaggaaggtggcc
atattctttgtcaacgggccagtgaaggatcagcgggcagtcagcgccgcggccctccgt
ctctatgactccggcatcgcctcggtgtttctggtcaacaaagaggatggccagcttacc
agagccctgaagatgaacaacactgggtcagcactgggtcaggtgatcgtactgcctaat
cccggaagtgcacagtacaactcggctatccaaaaggtcatgagctgccacatctgcctg
gactcctgtgctccagaccaaatgtgtgactacgtcccccctcagcagtcgagagacagg
aggtcctccaccaccgacgtggacattgacatggccttcgtcatggacagctccgagacc
acctaccccactgtcttcaccgagattaaacgctatgttgctcacattgtagagcaactt
gaagtctcgtcagaccctatggcatccatccaccacgcccgtgtggctgtgatccagcag
gcaccctacgagttcctgcgcaacagcagcggctctccgatccgcgtggacgtgggtctg
accgaccatcgctcggcccaagacatccgcaacttcctcctggacaaaacgccccaactg
gagggtgggcgggcgctggcggcagccatcgagcacacggtggagcaggtgtttgaaagg
gcgccccaccagcgtgacctcaaggtgctgacattgtttgtgacaggcccagtggaggag
gatgaggagcggctggttgccgtggccaccgatgccaagtgcaagggctatttcttggtc
atcctgggcgtcggcgagaaacttagtgctggggatgcccgcgtgatgatgcgcatggcc
agtgagccctctgacgtcttcttcaagaggctgaccagcacctcacacttctacgacaag
cacattcagaactttggccgactgctgcccaagtatctcagcattgagaacgctttctac
atgtcccctgaagtctccaaaaactgtcattggtaccagagtgaccagccattccccaag
ttccccttccccaaatcacaccacagccaagagaaacatcaaaaacaccacgaaaatcac
caggcagtccatccaaagcacaaagaccaagaggagttgcacgtagccaacaccacttcc
agtggcctgaccctgcgctgggccagcccggaccccaagctcatagcctacttcgaggtg
gtggtgacgcgcctgcgcgaccacacactggtgctgaggaggaatgtgacaggcacggag
ctcactgtaggcggcctggagagcgcccagacctaccacgccgtggtgaccacacgcacc
gcccagggccatgttgcggccacacacaaaggcattattaccaccaaagcagcagcagag
cataagatcgctgctcccatggaggtgactggtatcatagccactacaccactggacaaa
ccagagattgctaacgagctcacagacccatgctctcttgactttgaccctggattggcg
tgcaaaaaccatcaggctaagtggttctttgacagaaagaatgggatctgtacccagttc
tggtatggtggttgtgaaggcaatggcaataggttcgagactgaagcccagtgcttgaaa
cgctgcatgaggtcagaacctgagcaacaagtggaacagcttcagactgagatcctttca
gctcccgcggccttgacaggagtggaaatctgtcagctccccaaagaggaaggcgcatgc
gcaaagtttgttctcaagtggcactacgatgcactcggcaagagctgcacacgcttctgg
tacggaggctgtggcggcaaccagaatcgcttcgaaactcaagaggagtgtgagaagacc
tgtggaaaagcagctctgcctcgagggcaaaaggcatgggattggttggatgaaagcctc
gcaaaccccgagcggcactcacagcgacgagtgagaatgaaaggaaagagaagaaaaggc
tcactaggtgcacctgtcaaccaaggagtcattgccgcaatacgaacatag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112225415
Entry
112225415         CDS       T05605                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: collagen alpha-1(IV) chain-like
  KO
K06237  collagen type IV alpha
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112225415
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112225415
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112225415
   00536 Glycosaminoglycan binding proteins [BR:otw00536]
    112225415
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   112225415
Glycosaminoglycan binding proteins [BR:otw00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   112225415
SSDB
Motif
Pfam: Collagen C4 FeoB_associated
Other DBs
NCBI-GeneID: 112225415
NCBI-ProteinID: XP_024245144
LinkDB
Position
26
AA seq 1644 aa
MMVHSGTLVLLVAVSYTIFRTEAKGCSGSSCGGKCDCNGVKGEKGERGFPGLQGNMGFPG
MQGNEGPAGPMGPKGEYGESGTPGMKGTRGSNGLSGFPGNPGLPGIPGQDGPPGSSGIPG
CNGTKGDRGTDGQPGFPGLQGPPGIPGLMGMKGDPGGVLGIIPLKGDKGFPGTPGLPGPN
GPSGPEGPPGNQGSDGPRGFPGIPGPPGEKGDRLSFQSEKGDKGAQGLRGPPGPPGLPSQ
EAGGNTVTHFLPGPPGQRGETGDRGDKGSCIPHLNGVKGEQGPPGPRGKPGKDGDNGFKG
ERGFPGGPGYHGTPGEKGEKGPPAYVDSAPGSPGPPGLPGLQGERGFPGLQGDLGPPGSL
IEGPPGEKGQPGEIGQKGDRGADGDSLTGKPGQDGSVGPPGPPGPPGDEPCDPALEKGPP
GPPGPPGLQGELGQKGDQGDTCVQCEAFGPPGLPGPQGPKGLQGYPGAAGTKGDTGLPGP
TGPDGSPGNYGTPGLIGAPGAHGEPGDIYVASGLKGDKGGSGFVGTRGLPGVDGLPGKAG
LPGLPGPKGEPAQDGIKGDRGLDGEHGITGPPGERGPPGVPGFGGQGEPGEKGTSGQGGR
PGIPGQPGVKGEPGKGVSSPGPQGTPGPRGESGIRGLQGDRGPNGDPGIPGFPGQKGDTG
APGMGFSGPPGPKGYSGAPGATGLPGEPGRPGQDGFSGISGTPGPKGEPGRGLPGPKGAQ
GPAGVTGFPGEKGNLGLPGIPGQEGHTGPPGAQGIKGDHGPPGQHGGTGPPGPPGVGEPG
APGPMGPPGESGLFGHDGVKGDKGLPGSPGLDMPGPQGEKGDSGLPGLSGSKGFPGRPGP
AGRDGFPGGAGPKGEMGVMGTPGTPGYQGPSGNPGSPGLRGDPGISGPRGEFGENGPKGE
RGEPGLQGPAGNMSDVDMEHMKGEKGDLGDPGDPGYTGEKGYPGQPGVPGMPGKDGEPGT
PGQPGDKGETGFPGEPGSIGYPGNKGGIGEMGYPGSLGTKGDKGIVGTPGHPGFRGTEGV
KGDKGQTGLPGVGVPGPSGEKGQLGLPGFPGNAGEKGQKGGMGVPGMPGTPGTKGDTGHI
GYQGQPGQPGEKGIGGLPGSPGEPGQTGRPGEPGLQGPPGTTGEKGASGVDGIPGSSGER
GDTGLPGRGFSGTPGSSGDKGDKGSPGFPGSPGIPGIPGTRGDKGIPGFEGSHGQPGERG
LPGTAMEGPKGDQGVSGKPGEPGTSGAPGPAGVPGSVGGKGDKGDQGEPGVHGEQGFKGD
QGYPGLSGQAGLPGVDGLKGEMGLQGVPGFPGTKGEFGVVGFKGELGDRGFPGDKGNDGP
PGPPGPHIFIKGDSGFPGNQGPQGPVGPSGIPGLKGQQGVTGIQGIKGDEGNPGFNGLPG
AKGEPGLLGPSGPRGYPGPPGPDGVPGQVGPPGPSSMEHGFLVTRHSQSVEVPHCPEGTS
VIYDGYSLLYVQGNERSHGQDLGTAGSCLRKFSPMPFLFCNINNVCNFASRNDYSYWLTS
PEPMPMNMAPITGQSIKPFISRCSVCEAPAMVIAVHSQNIMIPSCPNGWDSLWIGYSFVM
HTSAGAEGSGQALASPGSCLEEFRGAPFIECHGRGTCNYYANSYSFWLATIEDEEMFTKP
VPTTQKAGNLRSNISRCQVCMKRT
NT seq 4935 nt   +upstreamnt  +downstreamnt
atgatggtccatagtggtacgctggttctgttggtggctgtatcctacactatatttcgg
acagaggctaaggggtgttctgggtcatcgtgcggaggaaaatgtgactgcaatggagta
aaaggagaaaagggtgagcgggggtttcctggtcttcaaggcaacatggggttcccgggc
atgcagggcaacgaggggcccgccgggccgatgggccctaagggagaatatggcgagtct
ggaactcctggaatgaaaggaacacgtggatctaatggtttgtcaggcttcccaggaaat
ccagggctaccgggtatccccggacaagacggcccccctggatcgtcaggtatcccaggg
tgcaacggaacaaagggagatcgagggacagatggacagcctgggttccctggtctacag
ggtcctcctggtatccctgggctaatgggaatgaaaggagacccaggtggtgttttagga
atcatcccactgaaaggagataaaggattccctggaacacctggtttaccgggacctaat
ggcccctcaggacccgaaggccccccaggaaaccagggatcagacggacccagaggtttc
cctggcatacctggccccccgggagaaaagggtgaccggctgtcattccagagtgagaag
ggagacaagggtgcacaagggctccgtggtccccctggcccccctggactcccgtcacag
gaagcgggaggaaataccgttactcatttcctccctggaccaccgggtcagagaggcgag
acaggagacagaggagacaaaggttcttgtattccccatctaaacggggtcaagggtgaa
caaggcccaccaggaccaaggggaaaacctggcaaagatggcgacaatggatttaaggga
gagagaggctttcctggcggccctggataccatggaacaccgggtgagaaaggagagaaa
ggacctccagcatatgttgatagtgctcctggctctcccggcccccctggtctcccgggc
ttacaaggagaaagaggtttccctggtcttcaaggagaccttggtccaccaggcagtctg
attgaaggacctcccggagagaagggccaaccaggagagattggtcagaagggagacagg
ggtgcagatggggactctctcacaggaaagcctggacaagatggatccgtcgggccccct
ggtcctcccggacctcctggtgatgagccatgtgatccagcccttgagaagggaccaccc
ggaccccccggcccaccgggactacagggggagttgggacagaaaggtgatcagggagac
acgtgtgtgcagtgtgaagccttcgggccccctggactccctggtccacaggggcctaaa
ggactgcaaggatatcctggagcagcaggcactaaaggagacacgggcctgcctggacct
actgggcctgatggaagccccggtaattacggtactcctggcttgatcggggctccagga
gcccatggtgagcctggcgatatctacgtggcttcagggctgaagggtgacaaaggaggg
tctggcttcgtgggcacacgaggactgccaggtgtggatggactgccagggaaagctgga
ctaccaggcctgcccggacccaaaggagaacctgcccaagatggcatcaagggggaccgt
ggtctggatggggaacatgggatcactggacccccaggagagaggggtcctcctggtgta
ccagggtttggcggacagggggagcctggagagaagggtacatctggccaaggaggccga
cctggaatccctggacaaccaggagtgaaaggtgaaccaggaaaaggtgtgagttcacct
ggaccccagggcacccctggacctcgaggagaatctggcatacgtggactacaaggtgac
cgaggacctaatggagacccaggaattccaggattcccaggacagaaaggtgacacaggt
gcacctggcatgggattctcaggaccacctggacctaaaggatattctggagctccagga
gccactgggttgccaggagagcctggaagaccaggacaggatggtttctctggaatatca
ggcacacctggtccaaagggtgagccaggtaggggtctacctggacctaaaggtgctcag
ggtcctgccggagtgacaggtttccctggagagaaaggcaaccttggtctacctggtatt
cccggacaagagggacacacaggaccacctggagctcagggcatcaaaggtgaccacggc
ccccctggtcagcatggtggcacaggaccccctggaccccctggagtaggagaacctggt
gcccctggacccatgggaccccctggagagtcaggcctcttcggtcatgatggtgtgaag
ggtgataagggtttgcctggctctcctggtctggacatgcccggccctcagggagagaag
ggagactcaggattacctggactttctggttccaaagggtttccaggacgaccaggcccc
gccggcagagatggattccctgggggggcaggccccaagggagagatgggagtcatggga
acacctggaacaccaggatatcagggtccttctgggaaccctggaagtccaggactgaga
ggtgaccctggtatctctgggccaaggggggagttcggtgagaatggacccaaaggagag
aggggagagccaggtctccagggccctgctggcaacatgagtgacgttgacatggagcac
atgaagggcgagaaaggagacctcggggatccaggtgaccctggatacacgggagagaag
ggttatccaggacagcctggagtacctggtatgccaggaaaggatggagagcccggtaca
cctggtcagccaggtgataaaggggagacaggttttcctggagagcccggcagtattgga
tatcctggaaataaaggaggcattggtgaaatgggatatccaggttctctaggtacgaag
ggtgataaaggcattgtgggcacaccgggtcatccagggttcaggggtacagagggggtg
aagggagacaagggacaaaccggtctgccaggtgttggagtaccaggaccctctggagag
aagggtcagttgggtctgcctgggttccctggtaatgcaggagagaagggtcagaaggga
ggaatgggagtgcccgggatgccaggaacaccaggaaccaagggagacactggacacatt
ggttaccaaggtcagccgggtcagccaggagagaagggtattggtgggcttcccgggtca
ccaggagagccaggtcaaacaggtcgaccaggtgagcctggtctgcagggtccaccaggt
acaaccggagagaaaggagcgtcaggagtggacggcatacctggatcatcaggagagaga
ggagacacaggtttacccggcaggggcttctcagggacaccagggtcgtctggggataaa
ggtgacaaaggctctccaggtttcccaggctctccaggtatcccgggtatcccagggacc
aggggagacaagggtattccaggctttgagggttcgcatggccagccaggagaacggggt
ctcccaggaaccgccatggaggggcccaaaggagaccaaggagtgtcaggaaagcctgga
gaaccaggtaccagtggtgctccaggtcctgctggtgttccaggcagcgtgggggggaag
ggagacaaaggggaccagggtgaaccaggagtacatggggagcagggtttcaaaggagat
caaggataccctggactttctggtcaagctggccttccaggtgttgatggactgaaggga
gagatgggactgcagggagtgcctggtttcccagggacaaagggtgaattcggagtggtt
ggattcaaaggagagctgggggacagaggattcccaggagacaaaggtaatgatggtccc
cctggtcctcctggcccccacatcttcatcaagggagacagcggcttccctggtaatcag
ggccctcaggggcctgtggggccctcgggtatccctgggctgaaaggacagcaaggtgtg
acaggtattcagggtattaaaggtgatgaggggaacccagggtttaatggtctccccggc
gccaagggagaaccaggcttgcttggtccctcaggacccagagggtaccctggtccccca
ggacctgatggtgttccgggtcaggtgggtcctcctggcccctcctccatggaacatggt
ttcctggtaaccaggcacagccaatcggtggaggttccacattgtcctgagggaacgtca
gtgatctatgatggatattccctactctacgtccagggcaacgagcgctcccacggccag
gacctgggtacggctggtagctgtctaaggaagttcagtcccatgcccttcctcttctgt
aacatcaacaacgtctgtaactttgcctcccgtaacgactactcctattggctcacctcc
cctgagcccatgccaatgaacatggcccctatcactggccagagcatcaagcccttcatt
agcaggtgttcagtgtgtgaggctcctgccatggtgatagcagtacacagtcagaacatc
atgatcccatcatgccccaatggctgggactcactctggattggctactccttcgtcatg
cacactagtgcaggtgctgagggctctggacaggcactggcatctcctggctcctgtcta
gaggagttccgtggcgctccattcatcgagtgtcacggccgtggaacctgcaactactac
gccaactcctacagcttctggctggccaccatcgaggacgaggagatgtttacgaaacct
gtgcccaccacacaaaaggcaggaaatctccggagtaacattagccgttgccaggtgtgc
atgaagaggacatag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112225680
Entry
112225680         CDS       T05605                                 

Gene name
fn1
Definition
(RefSeq) LOW QUALITY PROTEIN: fibronectin
  KO
K05717  fibronectin 1
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112225680 (fn1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112225680 (fn1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112225680 (fn1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112225680 (fn1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112225680 (fn1)
   00536 Glycosaminoglycan binding proteins [BR:otw00536]
    112225680 (fn1)
   04990 Domain-containing proteins not elsewhere classified [BR:otw04990]
    112225680 (fn1)
Membrane trafficking [BR:otw04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    112225680 (fn1)
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   112225680 (fn1)
Glycosaminoglycan binding proteins [BR:otw00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   112225680 (fn1)
Domain-containing proteins not elsewhere classified [BR:otw04990]
 Fibronectin (FN) domain-containing proteins
  Fibronectin type I domain-containing proteins
   112225680 (fn1)
SSDB
Motif
Pfam: fn3 fn1 Pur_ac_phosph_N fn2 DUF2369 TILa CBM9_2
Other DBs
NCBI-GeneID: 112225680
NCBI-ProteinID: XP_024245585
LinkDB
Position
26
AA seq 2499 aa
MSSSPIIRVLVVLCIGTAVNCMPNRKSRRQAHQGETRIPSVSTVSQDGCIDNGQMYNIKD
QWERSYLGTMLVCTCHGVAGIKCNTKPEAEETCYDKINARSYLVGENYERPKEXMIWDCT
CMVWGENQXTIEVSGLNRCHEGGESYKIGDTWKRPHDTESYMLECVCLGNGKGEWTCKPV
AERCYDNTAGTSYVVGETWEKPYQGWMIVDCTCLGEGSGRITCTSRNRCNDQDTLTSYRI
GDTWSKTDARGHMLQCLCTGNGRGEWKCERHASLHTTGLGTGSRVITNIQPAVYQPHPLP
QPGLEPHPGLAQEGACQMDAGVAYALGMRWIKTQGSKQMLCTCLGNGVSCEEWEGPAPVY
GGNSNGQPCVFPFTFMGKTHHSCTSEGRPDGQLWCCISSDCETEQKFSFCTKKNVMVTTR
GGNSNGALCQFPFLYNGRNYTDCTADGRRDGMKWCGTTTNYDGEQRFGFCPMAAHEEVCT
TSKGVMYRVGDQWDKRHDVLGHMMRCTCVGNGRGEWSCIAYSQLKDQCIVDGLTHEVNQT
FTKLHEEGYMMNCTCFGQGRGRWKCDAIDQCQEPETRVFYQIGQSWDKLIHSVMYKCYCY
GNGIGELSCEPQQSFPGGNRPVQVIISESGNQPNSHPIQWNAPSSAHITQYILKWRVKNT
RTPWREVNIPGHLNSYTIAGLKPGITYEGQLISVLRFGRREVTRFDFTTTYGSLATSEGE
TTQPPPVVDISESVTEITSSSFVISWMSASDTVSGFRIEYELSEEGQERGQPMILDLPRT
ATSVNINELLPGRKYTVNVYEVTPTGEPNLILTTSQTTAPDAPSDHEVDEVGETSIIVSW
EKPLAPITGYRVIYTPSVEGSNNGAATELTLPDTATSVTLSDLRPGLLYNISIYAVEDSL
ESEPVFVQVNTAGEPLPEEVPPPTDLQFFEVSDVKITVTWTGPPTDVSGYRVTVAPVGPD
GAPQRELQLPVTRSAYAEVTHLAPGTPYLFSIYTIKGGEESQPLVAEQATKPDSPADVHF
TNVTEDSALIMWMPPRARITGYRLFLTLEGSNPKQLRLPARLSQYTLLNLRPDTEYTAIL
HSEQDNTLSEGASRSFSTTQLMGNAPRFSTDVTDTSIIISWTPVPRVGYKLTVRPSQGGE
APRDVTSNSGSIYISGLTPGVEYTYSVQPIINGYEQGNPITRRIVTPLSPPTDLKLESHP
DRGELTVQWNEASTPDITGYRVTCTPTNGQRGNSLEEFVKAGETSCTLENLSPGVEYNVS
VFTVKDHMESVPVSDTVTQDVPQLTDLNFVDVTDTTIGLKWNPLNYTAVTGYRITVMAAG
ESVPIFEDMVESTTGYYTVYGLEPGIDYDISVITVTESGESEPTTLTQQTAVPAPTNLDF
PEVGPDSMRVTWTAPVVPNPADISSFVIRYHPIDDEDDITESSVGRNADTVVLKNLISNT
EYLVSVVCVYETRESSPLVGTHKTTLDSPSGLRFSEVLTNSFTVHWQAPNAIITGYRIRY
QMASGGRAKDERLPPSRNHFTLTGLTPETEYIVNIYAVSGQQDSKPLTGKQKTISDAPTD
LEVVSSSPTSVTVRWDAPSVTVRYYRITHGESGGHSTPKEFTVPGSQSTATIQNLRPGTD
YTITVYAVTGRGDSPASSTPIYVTHKTDIDSPLERKVTDVRDSTSPVRWSPAQGPVQGYR
ITGVPRNGQGPSFSETVAQVGHTEMTFSGLQPTVEYILSVYALGQDGESPPLVETAVTAV
GRPTDLTFSNVDSTSMTISWDSPDGRVTSYRVLYASPEEGERELRPAPRGDDESATIHGL
RPGSEYTVKVIAMHDRTPSPPLVGVQATAIPSPTNLEFSQITTSSFTIKWRTMPNARLTG
YRVVVNPKNKSGPTKEMNVAPDTTQVHVPGLMVSTMYEVHIYALKNSLTSRPVQGEVTTL
DNISPPRRVRISDAKDSSITLTWRSKTETISGFLVEATPTTGGRTPIQRTIAPDSRTYTI
QGLQPGSTYKINIYTLNGNARSAPFTLTATTAKPVVSPPTNIRFTSLTPSSISFTWEGSR
SAGVTGYYVTYEEAGGIPRELTPRPTASRSQAIITGLKPGTEYVIKIVTLQNALRSTPLV
GKARTQLASQLPVSHRPSPDILDVPEDNPNLNPNHVQLVGTNGQDTLGQQGQHIYTEYQS
LGPNPNGRDNQGPAIHHREPLVYIPIPGPDGQRVPLVRVSEGPLSGLPFGFPENETGFGV
PQEAQTRTTISWQGVPQSSEYMVSCSPITNLEEKMFQMRLPGTSTSATLIGLTSGASYNV
IVEAMRGQGREKVLEEIVTAGNAVPGDHLPSNRDVCYDTFTATYHDVGVEWERMSETGFK
LWCRCLGLGSGHFRCDSSKWCHDSGNNYRIGEKWDRHAENGHMMSCTCLGNGKGEFKCEP
HESTCYDEGKMYQVGNQWQKEYLGAICTCTCYGGQQGWRCENCRRPGAQTEVDVDLLQPQ
IHQDAFDRYRENALKKLNIQCPIECLRPELLADVQQPSE
NT seq 7500 nt   +upstreamnt  +downstreamnt
atgtccagtagccctattatcagggttctggtggtgctttgcatcgggaccgctgtgaac
tgtatgccgaacaggaaaagcaggcggcaggctcatcagggagaaaccagaataccttcg
gtatcaaccgtctctcaagacggctgcattgataatggacagatgtataacattaaggac
caatgggagcgttcctatctgggcacgatgttggtctgcacttgtcacggagttgcgggg
attaagtgtaacacaaaacccgaagctgaggagacctgctatgataagatcaacgccagg
tcttacctggttggtgagaactatgagagacccaaagagnngatgatctgggattgtaca
tgcatggtctggggggaaaatcagtgaaccattgaagtgagtgggctgaaccgttgtcat
gaggggggtgagtcctataagattggggacacgtggaagagacctcatgacactgagagc
tatatgctagagtgtgtctgtctgggcaacggcaagggagagtggacctgtaaacctgtt
gcggagcgttgctatgacaacacggcagggacatcctacgtggtgggtgaaacctgggag
aaaccgtaccagggctggatgatcgtagactgcacctgtctaggagaggggagtggcagg
atcacctgtacctctagaaatcggtgtaacgaccaggacacactgacgtcctatcgtatt
ggagacacctggagcaagacggacgccagaggtcacatgctgcagtgtctgtgtacgggg
aatgggcgtggcgaatggaagtgtgagagacacgcctccctccacactaccggactgggc
acggggtcccgtgtgatcactaacatccagccggctgtgtaccagccccacccccttccc
cagcccggcctggagcctcaccccggtctagcccaggaaggggcctgccagatggacgcg
ggggtggcctacgccctggggatgagatggatcaagacccagggaagcaaacagatgctg
tgtacctgcctgggcaacggggtcagttgtgaggagtgggagggcccagccccagtgtac
ggtgggaactccaatggtcagccctgtgtgttccccttcaccttcatggggaagacacac
cactcctgtacctcagagggacgccccgacgggcagctgtggtgctgcatttcttctgac
tgcgagacagaacagaaattctccttctgtaccaagaagaatgtgatggtgacaaccaga
ggaggaaactctaacggtgctctgtgtcagttccccttcctctacaatgggagaaactac
accgactgtaccgcggacgggcgcagggacggcatgaagtggtgtggaaccaccaccaac
tatgacggtgaacagaggtttggcttctgccccatggctgctcatgaggaggtgtgtacg
accagcaagggtgtgatgtaccgtgtgggagaccagtgggataaacgccacgacgtcctg
ggacacatgatgcgctgtacctgcgttgggaacggtcgtggagagtggagctgtatcgct
tactcccagctcaaagatcagtgtattgtggacgggttgacccatgaggtgaatcagacc
ttcactaaacttcatgaagagggctacatgatgaactgtacctgtttcggacagggccgt
gggcgctggaagtgtgacgccattgaccagtgccaggagccagagaccagggtgttctat
cagattggccaatcatgggacaagctgatccacagcgtcatgtacaagtgttattgctat
ggcaacggtatcggcgagctcagctgtgagccccaacagtctttcccaggtggtaaccgt
ccagtccaggtgatcatctcagagtctggtaaccagcccaactcccaccccatccagtgg
aacgccccgtcctccgcacacatcacacagtacatactcaagtggagagtgaaaaacacc
cgtaccccttggcgggaggtgaatatcccaggtcatctcaactcctacaccatcgctggc
ctgaagccaggcatcacctacgagggtcagctgatcagtgtgctacgcttcggacgccgc
gaggtcacacgcttcgacttcaccaccacatacggttccttggcgacctccgagggagag
accacccagcctcctccggtggtggacatcagtgagtctgttacagagatcacctccagc
agcttcgtcatctcctggatgtctgcctctgacaccgtgtctggcttcaggatcgagtac
gagctcagtgaggagggacaagagaggggacagcccatgattctcgacctcccccgcact
gctacctctgtgaacatcaatgagctgcttcctggaaggaaatacactgtgaatgtgtac
gaggttacacctactggagagcccaacctcatcctcaccacctctcagaccactgctcct
gacgctccctctgaccacgaggtggatgaggttggagagacctctatcatagtcagctgg
gagaaacccctggctcctatcacaggttaccgtgtgatctataccccgtctgtggagggg
agcaacaacggagctgcaacagagctcaccctgccggacaccgcgacctctgtgactttg
agtgaccttcgaccaggcctgctctacaacattagtatctacgcagtcgaggatagtctg
gagagtgagcctgtcttcgtacaggtcaacacagccggagaacccttaccagaggaagtc
ccacctcctacagacctgcagttctttgaggtgtctgacgtgaagatcaccgtcacctgg
actgggccgcctactgacgtgtctgggtacagagtgactgtggcccccgtcggtcccgac
ggggcccctcaaagagagctccagctccccgtcacacgcagcgcctatgcagaggtcacc
cacctggcccctgggactccgtatctcttcagcatctacaccatcaagggaggagaggag
agccagccattggtcgcagagcaggctaccaagcctgattcccccgctgatgtccatttc
accaacgtgactgaggacagtgctctgatcatgtggatgccccctcgggcccgcatcacc
ggataccgtttgttcctgaccctggagggatccaaccctaaacagctccgcctgcccgcc
cgcctgtctcagtacaccctgctcaacctccgcccagacacggagtacacagccattctg
cattctgaacaggacaatacactcagtgagggtgcctccaggagcttctccaccactcag
ttaatggggaacgcccctcgcttcagtactgatgtcacagacacctccatcatcatctcc
tggacacccgtaccccgagtgggatacaagttgactgtgaggcccagtcagggaggtgag
gcccccagagatgtgacctctaattcgggcagcatttatatctcaggcctgacccctggg
gttgagtacacctacagcgtccagccaatcatcaacggatatgagcagggcaacccaatc
acacgccgcatagtcacacctctgtctcctcctactgacctcaaactggagtcccaccct
gacagaggagagctgactgtccagtggaacgaagccagcaccccagacatcaccggctac
agagtgacatgcacgccaaccaatgggcagcgaggaaacagcctggaggagtttgtgaag
gcgggtgagacttcatgcacgctggagaacctcagccctggcgtggagtacaacgtcagc
gtcttcaccgttaaagaccacatggagagcgttcctgtctccgacaccgttactcaagac
gtgccccagctaacagacctcaacttcgtcgacgtcaccgacacgactatcggcctgaag
tggaacccactaaactacacggcggtcaccggctaccgtatcacggtaatggcagccggg
gagagcgtgcccatattcgaggacatggtggagtccaccaccgggtactacaccgtgtac
ggactggagcccggcatcgactatgacatctcagtcatcaccgtgacagagagtggagag
agcgagcctaccacactcacgcaacaaactgccgttcctgcccctactaacctggatttc
cccgaggtgggtcctgacagtatgcgggtgacctggacagctcctgtggttcctaacccc
gctgacatcagcagcttcgttattcgctaccaccctatcgatgacgaggatgacatcaca
gaaagcagcgtcggaaggaacgccgacaccgtggttcttaagaatctgatttccaacaca
gagtacctggtcagtgtggtgtgtgtctatgaaacgagggagagctcccctctggtcggc
acccacaaaacaactctggactcccccagcggtctgcggttctcagaagtcctgaccaac
tccttcacggtgcactggcaggcccccaacgccatcatcactggctaccggattcgttac
cagatggccagcggcggacgggccaaggacgagaggctgccgccatccaggaaccacttc
accctgaccgggctgacccccgagacggaatacatcgtcaacatctatgctgtcagcggc
cagcaggacagcaagccgctcaccggcaaacagaaaaccatctctgacgctcctactgac
ctggaggtcgtgtcctcctctcccaccagcgtcacagtccgctgggacgccccctctgtt
accgtgaggtactacaggatcacccatggagagtcaggtggccacagcacccctaaagag
ttcactgtgcctggttcccagtctactgccaccatccagaacctgaggcctggtactgac
tacaccatcacagtctacgctgtgaccggcagaggggacagcccagcctccagcacaccc
atttatgtcacccacaagacagatattgactctcctttggagaggaaggtgaccgacgtt
agggacagcacatcaccggtgaggtggtccccggcccaggggcccgtccaggggtacagg
atcactggggtccccagaaacggacagggtccctccttctctgagactgtggcccaggta
ggtcatactgagatgacgttctctggcctgcagcccacggtagagtacatcctcagtgtg
tatgctctgggacaggacggagagagccctcccctggttgagacggctgtcactgcggtg
ggtcgtcccacagacctgaccttctctaacgttgactctacctccatgaccatttcctgg
gactcgcccgacggccgggtgacgtcgtaccgcgtcctgtacgccagccccgaagagggc
gagagggagctgcgccccgcaccccgtggagacgatgaatcggcaacgatccacggcctg
cgacccggaagtgaatatactgtgaaggtcatcgccatgcacgaccgtacacctagtcct
ccactggtgggcgttcaggccacagccatcccttcccccaccaaccttgaattctcccag
atcaccacctcctccttcaccatcaaatggcgcaccatgcccaatgcccgtctaactggg
taccgggtggtcgtaaaccccaagaacaagagtggtcccaccaaggagatgaatgttgct
cctgacaccacacaggtccacgtgccgggactcatggtttctactatgtatgaggtgcac
atttacgccctgaagaactctctgacgagccgcccagttcaaggagaggtcacaactctg
gacaacatcagtcctccgcgtcgcgtgcgtatctctgatgcaaaggactcctccatcacc
ctgacctggagatccaagaccgagaccatctctggcttcctggttgaggccacgcccacc
accggaggccgcacccccatccagaggaccatcgcccctgattcccgcacctacaccatc
caaggtcttcagcctggctctacctacaagatcaacatatacactctgaacggcaacgcc
cgcagtgctcccttcaccctcactgccaccacagctaagcctgtggtgtctccccccacc
aacatccggttcacctcgctgacccctagcagcatctcctttacctgggaggggtcccgt
agtgccggggtcaccgggtattacgtcacctacgaggaggcggggggcatcccccgggaa
ctcaccccgcggcccaccgcttcccgcagccaagccatcatcactggtctgaaaccagga
actgaatacgtcatcaagattgtcaccctgcagaatgctctgagaagcactcctctagtg
ggcaaggctagaactcaactggcatcccagctccctgtgtcccaccggcccagccccgac
atcctggatgtgcccgaggacaaccccaacttgaaccccaaccacgtccagctggtgggg
actaacggccaggacacgctgggccagcagggccagcacatctacacagagtaccagagc
ctgggccccaaccccaacggcagggacaaccagggtccagctatccaccaccgtgaaccc
ctagtctacatccccatcccaggccccgatggccagagagtgcccctggtccgggtgagc
gagggtccattatcgggtcttccgtttgggttccctgagaatgagaccgggtttggggtg
ccgcaggaggcccagacacgcacaaccatctcatggcagggtgttccccagagctcagag
tacatggtatcctgtagccccatcaccaacctcgaagagaagatgttccagatgagatta
ccaggcacttctaccagtgccactctgatcggtttgacatcaggagcctcctataacgtc
attgtggaggccatgagagggcagggccgagagaaggtcctggaggagatagtcaccgct
ggcaacgctgttccaggagaccacctcccctccaacagagacgtgtgttatgacacgttc
acagccacctaccatgacgtgggtgtagagtgggagcgtatgtcagagacaggctttaag
ctatggtgcaggtgtctggggctgggcagtggccatttcagatgtgattcatccaagtgg
tgtcatgacagcgggaacaactaccgcataggagagaagtgggatcgccacgctgagaac
ggtcacatgatgagctgtacttgtttgggcaacgggaagggagagttcaagtgcgagcca
catgagtccacgtgttatgacgaggggaagatgtaccaggtgggcaaccagtggcagaag
gaatacctgggagctatctgtacctgcacctgttacggaggacagcagggctggcgctgt
gagaactgcagaagaccgggagctcagactgaggtagatgtggatctgctacagcctcaa
atacaccaagacgcattcgaccgctatagggagaacgccctgaagaaactgaacatccag
tgtcctatagagtgtctgagaccagagctcctagcagatgtacagcaaccctccgagtaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112225909
Entry
112225909         CDS       T05605                                 

Definition
(RefSeq) collagen alpha-1(I) chain-like
  KO
K06236  collagen type I alpha
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112225909
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112225909
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:otw00536]
    112225909
Glycosaminoglycan binding proteins [BR:otw00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   112225909
SSDB
Motif
Pfam: Collagen COLFI VWC TILa
Other DBs
NCBI-GeneID: 112225909
NCBI-ProteinID: XP_024245808
LinkDB
Position
27
AA seq 1449 aa
MFSFVDIRLALLLSATVLLARGQGEDDRTAGSCTLDGQFYNDRDVWKPEPCQICVCDSGT
VMCDEVICEDTSDCPNPVIPHDECCPICPDDGFQEPKVEGPQGDRGAKGEPGPAGFPGND
GIPGQPGLPGPPGPPGPPGLGGNFSPQMSGGFDEKSGGGMSMPGPMGPMGPRGPPGPPGS
SGPQGFTGPPGEPGEAGSSGPMGPRGPAGPPGKNGDDGESGKPGRPGERGASGPQGARGF
PGTPGLPGIKGHRGFSGLDGAKGESGPAGPKGEGGASGENGAAGAMGPRGLPGERGRAGP
NGAAGARGNDGAAGAAGPPGPTGPAGAPGFPGGPGAKGEVGAQGARGGEGPQGSRGEAGN
PGPAGAAGPAGNNGADGTPGTKGAPGSSGIAGAPGFPGPRGPPGPQGAGGAPGPKGNTGE
VGANGAKGEAGAKGESGPAGVQGPAGPAGEEGKRGGRGEPGGAGARGAPGERGAPGSRGF
PGSDGASGPKGGPGERGGAGVAGAKGNTGEPGRNGEPGMPGSKGMTGSPGSPGPDGKTGP
SGAGGQDGRPGPPGPVGARGQPGVMGFPGPKGAAGEGGKPGERGVMGPGGAVGAPGKDGD
VGAPGAPGVAGPSGERGEQGAGGPPGFQGLPGPQGAIGETGKPGEQGLPGEGGAPGAAGS
RGDRGFPGERGAPGPSGPAGARGSPGSAGNDGGKGEAGAAGAPGGQGPPGLQGMPGERGA
GGLPGLKGDRGDQGAKGADGAGGKDGVRGMTGPIGPNGPAGSPGDKGETGAPGPGGPSGA
RGAPGERGESGAPGPAGFAGPPGGDGQPGAKGEAGDNGAKGDGGAQGPAGPTGAPGPQGP
AGNTGAKGARGAAGPPGATGFPGAAGRVGPPGPSGNNGPPGPPGPGGKEGQKGNRGETGP
AGRPGELGAAGPPGAQGEKGQPGGDGPNGPSGTPGPQGIGGQRGIVGLPGQRGERGFPGL
AGQLGEPGKQGPGGPSGERGPPGPMGPPGLAGAPGESGREGTPGNEGSSGRDGAAGPKGE
RGESGAAGASGAPGPPGAPGPVGPAGKSGDRGESGPAGPAGIAGPAGPRGSSGPAGARGD
KGEAGEAGERGMKGHRGFTGMQGPSGPSGPSGESGPAGASGPAGPRGPSGSAGAAGKDGM
SGLPGPIGPPGPRGRSGEMGPSGPPGPPGPPGPPGPPGGGFDMGFIAQPAQEKAPDPFRH
FRADDANVMRDRDLEVDTTLKSLSQQIENIRSPEGTKKNPARTCRDLKMCHPDWKSGEYW
IDPDQGCTQDAIKVYCNMETGETCVYPTEAEIPKKSWYTSKNIKEKKHVWFGEAMTDGFQ
FEYGSEGSSAQDVNIQLTFLRLMATEASQNITYHCKNSIAYMDQQSGNLKKSLLLQGSNE
IEIRAEGNSRFTYSVTEDGCTSHTGAWGKTVIDYKTTKTSRLPIIDIAPMDVGAPNQEFG
IEVGPVCFL
NT seq 4350 nt   +upstreamnt  +downstreamnt
atgttcagctttgtggatattcggttagcgctgttgctcagcgcaacagtgcttttggca
agaggacaaggcgaggacgatcgcaccgccggcagctgtacgttggacggtcaattctac
aacgacagagatgtctggaaacccgagccatgccagatctgcgtgtgcgacagcggcacc
gtcatgtgcgacgaagttatctgcgaggacacatccgactgccccaatccagtgatcccc
cacgacgaatgctgccccatctgccccgacgacggcttccaggagccaaaggttgaggga
ccccagggtgatcgtggagccaagggagagccaggacctgctggtttccccggcaacgat
ggtattcccggccagcccggccttcctggacccccaggcccccctggaccccctggtctt
ggcggaaacttctcccctcagatgtctggtggttttgatgagaagagcggcggtggtatg
tccatgcccggccccatgggccccatgggtccccgtggtcccccaggacctcctggctca
agtggacctcagggtttcactggcccccctggtgagcctggtgaggctggttcttctggt
cccatgggcccccgtggtcctgctggtccccctggcaagaacggagatgatggtgagtct
ggcaagcctggtcgccctggtgagcgtggagcttccggcccacagggagctcgtggattc
cctggaacccccggccttcccggcatcaagggacacagaggattcagcggtcttgacgga
gctaagggagagtctggccctgctggacccaagggagagggtggtgcatccggggagaac
ggagccgctggagccatgggaccccgtggtctgcctggtgagagaggccgtgctggtccc
aacggagctgctggtgctcgtggtaacgatggtgctgctggtgctgctggtcctcctggc
cccactggccccgctggtgcccctggtttccccggtggccctggagccaagggagaggtt
ggtgcccagggagctcgtggtggcgagggaccccagggatcccgtggagaggctggtaac
cccggacccgctggcgctgctggccccgctggaaacaacggtgctgacggaacccccggt
accaagggtgcccctggttcttctggtattgctggtgctcctggcttccctggaccccgt
ggaccccccggaccccagggtgctggtggagctcccggacccaagggtaacactggtgag
gttggtgctaatggagccaaaggagaggctggtgctaagggagagtctggccccgctgga
gtccagggacccgccggccctgctggtgaggaaggcaagcgaggaggccgtggtgagccc
ggtggtgctggtgcccgtggagcccccggcgagcgcggtgcccctggtagccgtggtttc
cctggttctgatggagcttctggccccaagggtggccctggtgagcgtggtggtgccgga
gttgctggagctaagggtaacactggtgagcctggccgcaatggcgagcctggtatgcct
ggatccaagggtatgactggtagccctggcagccccggtcccgatggcaagactggcccc
tctggtgccggtggtcaagatggtcgccccggacctcccggccccgttggagccagaggc
cagcccggagtcatgggattccccggacctaagggagccgcaggtgagggtggcaagcct
ggtgagagaggagtcatgggacccggtggtgctgttggtgctcccggcaaggatggtgat
gttggtgctcctggtgctcccggtgttgccggaccttctggagaacgaggcgaacaggga
gccggtggcccccctggattccagggacttccaggaccccaaggcgctattggtgagact
ggaaagcccggagagcagggtcttcccggtgagggtggtgcccctggtgccgctggatcc
agaggtgacagaggtttccccggtgagcgtggtgcccctggcccatctggacccgctggt
gcccgtggctctccaggatctgctggtaacgatggtggtaagggagaggctggtgccgca
ggtgcccccggtggccaaggaccccctggcctgcagggaatgcccggagagcgtggtgct
ggtggtctgccaggcctgaagggagacagaggtgaccaaggagccaagggtgctgatggc
gccggtggtaaggatggcgtccgtggtatgactggccccattggacccaacggccctgct
ggatctcctggtgacaagggagagactggcgctcctggacctggtggaccttctggtgcc
cgtggtgcacctggtgagcgcggtgagtctggcgcccctggacccgctggattcgctggg
cctcctggtggtgacggtcagcctggtgctaagggagaggctggagataacggtgccaag
ggtgacggtggtgctcagggacccgctggacctacaggagcccctggacctcagggtccc
gctggaaacaccggagctaagggcgcccgtggtgctgctggtccccctggtgccactggt
ttccccggtgctgctggtagagttggacctcctggcccatctggcaacaacggacccccc
ggacccccaggccctggtggaaaggaaggacagaagggtaaccgtggtgagactggcccc
gccggtcgtcctggtgagctcggcgctgccggaccccctggtgcccagggagagaaggga
cagcctggtggagatggtcccaatggaccctctggaactcccggacctcagggtattggt
ggacagcgtggtattgttggtctgcccggacagaggggcgagcgcggtttccccggcctc
gccggacaactgggagagcctggcaagcagggacctggtggcccctctggtgagcgtgga
ccccccggacccatgggaccccctggactggctggagcacccggtgagtctggtcgcgag
ggaactcctggtaacgagggatcttctggtcgcgatggtgctgctggacccaagggagag
cgtggtgagtctggtgccgctggtgcttccggtgcccccggaccccctggtgcccctgga
cccgttggccctgctggaaagtctggtgaccgtggagagtctggtcctgctggccccgct
ggtattgctggccctgctggtccccgtggctcatcaggacccgctggagctcgtggagac
aagggagaggctggcgaggctggagagagaggcatgaagggacatagaggattcactggc
atgcagggaccctctggcccctctggaccatctggagagtcaggacctgctggagcctct
ggccccgctggacctagaggaccttctggatctgctggtgccgccggtaaggatggtatg
agcggtctgcccggccccatcggacctcccggaccccgtggtcgctctggagagatggga
ccctctggaccccctggccctcccggtccccctggcccccccggacctcccggcggtgga
ttcgacatgggcttcattgctcagcccgctcaggagaaggcccccgatcccttccgtcac
ttccgcgccgacgacgccaacgtgatgcgcgaccgcgacctggaggttgacaccactctc
aagagcctgagccagcagattgagaacatccgctctcccgagggcaccaagaagaacccc
gcccgcacctgcagagacctgaagatgtgccaccccgactggaagagcggcgagtactgg
atcgaccccgaccagggctgcacccaggatgccatcaaggtttactgcaacatggagacc
ggcgagacctgcgtctaccccaccgaggcagaaatccccaagaagagctggtacaccagc
aagaacatcaaggagaagaagcacgtctggttcggcgaggcaatgaccgatggcttccag
ttcgagtatggcagcgagggttccagcgctcaggatgttaacatccagctgaccttcctg
cgccttatggccactgaggccagccagaacatcacataccactgcaagaacagcatcgcc
tacatggaccagcagtccggcaacctcaagaagtccctgctgctccagggctccaacgag
atcgagatcagagccgagggcaacagccgcttcacatacagcgtcaccgaggacggctgc
acgtcgcacaccggtgcatggggcaagacagtcatcgactacaagacaacgaaaacatcc
cgtctgcctattattgacatcgctcctatggacgttggtgcacccaatcaggaatttggc
attgaagttggcccagtctgcttcttgtaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112226402
Entry
112226402         CDS       T05605                                 

Definition
(RefSeq) collagen alpha-1(IV) chain-like
  KO
K06237  collagen type IV alpha
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112226402
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112226402
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112226402
   00536 Glycosaminoglycan binding proteins [BR:otw00536]
    112226402
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   112226402
Glycosaminoglycan binding proteins [BR:otw00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   112226402
SSDB
Motif
Pfam: Collagen
Other DBs
NCBI-GeneID: 112226402
NCBI-ProteinID: XP_024246558
LinkDB
Position
28
AA seq 888 aa
MGINGPPGPPGVLSSTGQPGQLGYPGLPGPKGLKGEPGRYYTIEPIPGQPGERGRPGAKG
FRGPPGRPGCGGIYCVPGEPGVRGDDGDTGYPGLTGYKGEKGYNGECECTYENGHRGIPG
PPGPRGPLGYDGLPGHSGEKGDHGYNGDPGSQGSHGNPGRPGYNGVKGQKGESYVTNYKG
AKGDPGFNGPNGPHGATGRPGSDGFPGAVGDPGPPGDGYGGLVGDKGYPGLHGPEGPPGR
PGPSGPGAPGRHGPQGPPGDVGLPGPPGQTGQPGPLGEVLPCGPSNPGLPGLKGLLGPPG
NPGPPGPLGFPGPTGPLGPQGMRGDDGTDGGTGPPGHQGCVGDNGDPGQPGINLDGPPGL
RGPPGSPGWPGPPGDTFNTGPGPVGPPGLPGLLGPKGDPGLPGIPGPPGGSGPYGGVGYK
GSKGDTGDPGLNGPPGPTECREKGAVGPPGASGPPGVRGPSGFRGDKGHKGAMGPPGRGV
KGPAGIPGPTGPPGPIGVKGFSGSPGVPGFPGVTGTKGPRGYPGRDGSAVPGTPGRPGNP
GSRGRQGERGFTGRDGQDGDQGYKGAKGHRGPPGSPGPVGVITVKGQKGSEGPPGEDGFT
GARGSKGSRGSPGKPGGNGQDGPPGYEKGLPGQPGRPGFPGPPGPRGPKGLSGIIGFPGP
VGDKGDPGHTGPPGNPGLPGMTGLQGDPGDSIGQPGLPGPPGPPGECGTLGDHNTTSAYS
MAPYSPNGALHSAWLESEYLVLYIWTHFQLSFPGPPGLHGLNGLQGQKGEKGARGPDVLG
PRGPSGYPGVKGHTGSQGPPGTSYPGSKGLRGPPGYQGPKGVTGEPGGSGGECSECHRGP
NGEPGYEGIHGPPVFECFQDHPVNRVLLVLQSHLQETQAPRATRAQWP
NT seq 2667 nt   +upstreamnt  +downstreamnt
atgggcattaatggacctcccggaccaccaggggtattaagctccacaggtcaaccaggg
cagctaggttaccccgggctccctggtcctaagggtttaaagggggagccaggaaggtac
tacactatagagccaataccaggacaaccaggtgaaagagggcgtcccggagccaagggg
ttcagaggccccccgggtcgtccaggatgtggaggcatttattgtgttcctggtgagccg
ggtgtacgaggagacgatggcgataccggatatccaggattaacgggatacaaaggagaa
aaaggctacaacggtgagtgtgagtgtacgtacgagaatggtcacagagggatcccaggt
cctccgggcccccgcggacccctagggtatgacgggctgccagggcacagcggagagaaa
ggtgaccatggatataatggggaccctggctcacaaggatcccacggcaacccaggcagg
cctggttacaatggagtgaagggacagaagggagagtcctatgtgaccaactataaaggt
gcgaagggtgacccgggcttcaatggccccaacggaccgcatggcgccaccggtcgacca
ggatccgatggcttccctggcgctgtgggagaccccggacccccgggtgacggttacggt
ggcttggtaggtgacaaaggctacccagggctccatggtcctgaaggccccccaggcaga
ccgggcccctcaggccctggtgctccaggccgtcatggcccccaagggcccccaggggat
gtgggcctcccaggtccccctggacaaactggacaacctggacctctaggcgaggttctg
ccctgtggcccttccaaccctggcctacctggcttaaagggtctacttgggcccccaggg
aatcctgggccaccaggaccacttggtttcccaggtcccacaggtccccttggacctcaa
ggcatgagaggagatgacgggacagatggaggaactggaccaccaggacaccaaggatgt
gttggagataatggtgaccctggtcaacctggaatcaacctggacggaccaccaggactc
cgtggaccaccaggctctccaggctggccgggacctccaggagacaccttcaacaccgga
cctggtcccgtgggtccacctggactacctggtttactgggacccaagggagatcctggt
ttgccaggcatccctgggcctccagggggatcaggcccgtacggaggtgtgggttacaag
gggtcaaaaggagacactggggacccaggactgaacggtcccccagggccaacagaatgt
agagagaaaggagctgttggcccaccgggagcctcaggaccaccaggagtcaggggccca
tcgggtttccgtggtgataaaggacataagggtgcgatgggtcctcctggacgtggagtg
aagggaccagcagggatccccgggcctactggtcccccgggacccattggtgtcaaaggt
ttcagtgggtcaccaggtgtcccgggcttccctggtgtaacagggaccaaagggcccagg
ggatatcctggtagagatgggtcggctgttcctggtacaccgggtcggcctggaaaccca
ggatcccgcgggaggcaaggggagaggggttttacaggacgtgacggtcaggatggagac
caggggtacaaaggagccaaaggtcacagaggtccccccggaagtcctggcccagtagga
gtcataaccgttaaaggacagaagggctctgaaggaccaccaggagaggatggcttcact
ggagccagaggttccaagggctcacgtgggtcaccaggtaaaccaggggggaatggacag
gatggtcctcctggatatgagaaagggctcccaggacaacctggcagacctggtttccct
ggaccccccggacctcgaggacctaaaggcttgagtggtataattggtttccctggacca
gtcggtgataagggggaccctgggcacacgggccctcctgggaatccaggccttccagga
atgacaggcttacagggtgacccaggagactctataggacaaccaggactacctggacca
ccgggtcctccaggagaatgcggaaccttaggtgatcacaatacaacgtctgcttacagc
atggctccttattccccaaacggagctctacactccgcttggctagagtcagagtatctg
gtgctctacatttggacacatttccaactgagtttcccgggacccccagggctgcatggt
ctgaacgggctccaaggccaaaaaggagagaagggagccagaggaccagatgtgttgggc
ccacgagggccatctgggtaccccggagtcaaaggccacacaggctcccagggacccccg
ggaacttcttaccccggatctaaaggcctaaggggccctccaggctaccaaggaccaaaa
ggagtcactggtgagcccggtggttcaggtggagagtgctcagaatgtcacagaggaccc
aacggagagccaggatacgaaggcattcatggacctccagtatttgagtgttttcaggac
cacccggtgaaccgggtcctgctggtactgcagagccatctccaggagacccaggccccc
agggccaccagggcccaatggccataa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112226431
Entry
112226431         CDS       T05605                                 

Definition
(RefSeq) collagen alpha-2(VI) chain-like
  KO
K06238  collagen type VI alpha
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112226431
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112226431
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112226431
   00536 Glycosaminoglycan binding proteins [BR:otw00536]
    112226431
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   112226431
Glycosaminoglycan binding proteins [BR:otw00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   112226431
 Hyaluronan
  Extracellular matrix or blood plasma proteins
   112226431
SSDB
Motif
Pfam: Collagen VWA VWA_2
Other DBs
NCBI-GeneID: 112226431
NCBI-ProteinID: XP_024246583
LinkDB
Position
28
AA seq 550 aa
MCFQERSELEGDEDPGDRGPDGHPGDAGNGGLPGTDGEKGDPGRPGSTGPLGPVGDAGPK
GERGSPGSPGFPGAKGTPGTIGGPGDKGELGRRGDFGSKGTPGPDGVKGDKGEAGPEGLR
GLPGEVGNKGTKGDNGLPGPRGPPGTSGAAGKNGTRGDPGDAGPRGDPGLAGPKGDVGRA
GFSYPGPRGPTVRLITPSDSGSVYSSSHPVALGLFTARHTQWLWVCLQLITPSGSGSGYS
SSHPVALGLFTARHTQWLWECDVMNYIRETCGCCDCEKRCGALDIVFVIDSSESVGLANF
TLEKNFVINTINRLGSMAKDPNSETGTRVGVVQYSHSGTFQAIRLNDSKIDSLSAFKNQR
WPVCPAPLWTLCYMLDGSEREGVRTTPAEPRSSENGAARRPHARPTAQSEPTGTPAGPCG
STAASQNKGGVFAHAQSDVIADSLAGRATWTPPLSGQRHHTAGSRLARRNAELSFVFITD
GITAGDSLEEGVSAMRRAEGIPTVIAMGTDTDQEVLRKVALGDMSAIFRGEDYATLGKPT
FLERFIRWVC
NT seq 1653 nt   +upstreamnt  +downstreamnt
atgtgttttcaggagagatcggagcttgagggcgacgaagatccaggagacaggggtcct
gatggtcaccctggagacgcgggcaatggtggacttcctggaacagacggagagaaggga
gatcccggtcgaccaggaagcacaggccccctcggcccggttggagacgctggacctaag
ggtgagagagggagtcccggttcgcctggcttccctggagccaaaggaacaccaggaact
attggaggcccaggagacaagggagaactggggagaagaggagactttgggtcaaagggg
accccgggaccagacggagttaaaggagacaagggcgaggcaggacctgaggggctgaga
ggactgccaggtgaagtaggaaacaaaggaaccaagggggacaacggactcccggggcca
cgcgggccccccggtacttcaggagcggcagggaagaacggtacccgtggcgaccccggt
gatgccggaccgagaggagaccccggcctggcaggaccaaagggagacgtgggaagagct
ggcttcagttacccaggaccaagaggaccaacggtacgcctcatcacacccagtgactct
gggtctgtttacagctcctcacacccagtggctctgggtctgtttacagctcgtcacacc
cagtggctctgggtctgtttacagctcatcacacccagtggctctgggtctggttacagc
tcatcacacccagtggctctgggtctgtttacagctcgtcacacccagtggctctgggaa
tgtgatgttatgaactacatcagagagacctgtggctgctgtgactgtgagaagcggtgt
ggggcgctggacatcgtgtttgtgattgacagctcagagtccgttggtctcgccaacttc
actctggagaagaactttgtgatcaacaccatcaacagactgggatctatggccaaggac
cccaactcagagacaggtaccagagtgggggtggtacagtacagtcacagtggaaccttc
caggccatcaggctcaatgactccaagatcgactccctgtctgccttcaagaaccagcgg
tggccagtgtgtccagcgcccctgtggaccttgtgttatatgctggacgggtcagagagg
gagggagtgagaaccacgcccgccgagccaaggagttctgagaacggggcggcgcgccgc
cctcacgcgcggccaacggcccaatcagaaccgacaggaacgcccgcggggccctgcggc
agtacggcggccagtcagaacaagggtggagttttcgctcacgcacaatctgacgtgatc
gctgattcgctggcagggagagctacgtggactccgcccctctctgggcagcgccatcat
accgctggaagccgcctggcacgtcgtaacgctgaactgtccttcgtctttatcaccgac
ggcatcacagcgggcgacagcctggaggagggtgtctcagccatgcggcgggccgagggc
attcccacggtgatcgccatggggaccgacacggaccaggaagtgctgaggaaggttgcc
ctgggagacatgtcagccatctttagaggagaggactacgccacgctggggaaacccaca
ttcctagaacgcttcatccgctgggtctgctaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112226951
Entry
112226951         CDS       T05605                                 

Definition
(RefSeq) tenascin-N-like
  KO
K06252  tenascin
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112226951
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112226951
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:otw00536]
    112226951
Glycosaminoglycan binding proteins [BR:otw00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   112226951
SSDB
Motif
Pfam: Fibrinogen_C fn3 EGF_2 EGF_Tenascin Pur_ac_phosph_N Interfer-bind DUF2369 hEGF
Other DBs
NCBI-GeneID: 112226951
NCBI-ProteinID: XP_024247411
LinkDB
Position
28
AA seq 944 aa
MTTRLHWLSRALCLIGILCTVTTTYVTEDSPAPAEKGVTFSHIYKIDLTKSPGCKLAFQT
MPHQQDQGLGLQELEGGPTLEGDKDIVFRHQINLKTSKCDCDESERFKSLLYRVNGLEEE
VEHLKSQCSQGFCGGKGGGARGVDTSCSGHGTYQHGTCSCQCNPGWEGPDCSISTCPDEC
NDHGRCVDGKCVCLAGYMGSDCSQLMCPGDCNDKGYCVDGKCVCFSHFTGEDCSEQKCSP
DCVHGTCVNGMCICDEGFFGDDCSTVFGPNGLRLVRVTDVSLLVEWQAVRAAEYYVLAWH
PEGNEAEQERVTVPNTETSYLITGLRPGVTYIVQVYAVIKEIQSEGDRIEATTVVSGIDG
IRVLGQTEDSIQVDWQNPAAPLDHFRLTHANPDGQEEEQIVPMSAEARTTNTIVGLQPGT
EYLITVQGIKGTIEGKASFVTGVTDLDAPANLLTREVTEDTTTVTWEKVQAEIDSYVIRY
SSAEGSSGEIPVGADSSSYRLTGLRPGVVYTVYIWAVKGSRVSRKSSTVAETDLDAPTNL
LTREVTEDTADVSWDRPLADIDGYMISYSSAEGSSGEIPLGADSSSYRLTGLRPGVIYTV
YIWAVKGSRVSRRSSTPAETEIDSPKNLKASDVKLDAATLTWTAPLARIDGYILTFRAED
GTLKTLEKKLREGESRFAMSGLEMGKNYIVTLLAYRGAKKSRVIETTFKTVGLLHPFPMD
CTQIKTNGNMASGIYTIYINSDRTKPMDVYCDMDTDGGGWVVLQRRNNGQMDFMKRWRPY
MAGFGNMTDEFWLGLDNIYELTNTPTQYELRVDLGVGSEKAYAVYDNFKIAPAKQKFKLT
IGKYRGTAGDAMNYHQGRPFSTVDNDNDIALGNCALTHRGAWWYKNCHLANLNGKFGDNR
HSMGVNWEPWKGHLMSLDFTEMKIRPVGAARKRRSLSSRTAPRK
NT seq 2835 nt   +upstreamnt  +downstreamnt
atgactactagacttcactggctctcaagagccctctgcctgataggcatactgtgcact
gtcactaccacatatgtgacagaagattctccagcccccgctgagaaaggagtcaccttc
agccacatctataagatagacctgaccaagagccctggctgtaaattggccttccagacc
atgcctcaccagcaggaccagggattaggtctgcaagagctggaggggggccctactctg
gagggggacaaggacatagtattcaggcaccaaatcaacctcaagacctcaaagtgtgac
tgtgatgagtcggagcgcttcaagtctttgctgtacagagtcaacgggctggaggaggag
gtggaacacctgaagagtcagtgctcccagggcttctgtgggggcaaaggtggtggagca
agaggtgtggacactagctgtagtggccacgggacctaccagcacggcacctgcagctgc
caatgtaaccctggctgggaaggcccagactgctccatctccacctgtcctgatgagtgc
aacgaccatgggcgctgtgtggatggcaagtgtgtgtgccttgctggctacatggggagt
gactgcagccagctgatgtgcccaggtgactgcaacgataagggatactgcgtggacggg
aagtgtgtgtgcttcagccacttcaccggcgaagactgcagcgaacagaaatgcagtcct
gactgcgtccacggtacctgcgtgaatggaatgtgtatctgtgacgagggcttcttcggg
gatgactgctctacagtgtttggccctaacggcctgcgtctggtcagggtgactgatgtc
tcgctgctggtagagtggcaggcggtgagagcagcagagtactacgtcttggcctggcac
cctgagggcaacgaggcagagcaggagcgggtcaccgttcccaacacagagacctcctac
ctgatcactggtcttaggccgggggtcacctacatagtgcaggtgtacgctgtcatcaag
gagatccagagcgagggggacaggatagaggcgaccacagtggtgtctggtattgatggt
atccgggtattgggccagactgaggactctatccaggtggactggcagaaccctgcagca
cctctggaccacttcagactaacccatgctaaccctgacgggcaggaggaggagcagatc
gtacctatgagcgcagaggccaggaccaccaacaccatcgtaggactgcaacctggcact
gagtacctcatcacagtgcaaggcatcaaaggcaccatcgaggggaaagcctccttcgtc
accggggtcacagatctggatgctcctgctaacctgttgaccagagaagtgacagaggac
acaacgacagtaacatgggaaaaagtccaagctgaaattgacagctatgtgatccgctac
agctctgctgagggctccagtggggagatccctgtgggggcagacagcagctcctacagg
ctgactgggctgaggcctggagtcgtctacacagtctacatctgggctgtcaagggctcc
cgggtcagcaggaagagctccactgtagctgagacagatctggatgctcctactaacctc
ttgaccagagaagtgaccgaggacacagccgatgtgtcgtgggacagacctctagcggac
atcgacggctacatgatcagctacagctctgctgagggctccagtggggagatccctttg
ggggcagacagcagctcctacaggctgactgggctgaggcctggagtcatctacacagtc
tacatctgggctgtcaagggctcccgggtcagcagaagaagctccacaccagctgagaca
gaaattgattcgcctaagaacctaaaagcgtcagatgttaagctggacgctgcgaccctg
acctggactgctcccttagccagaatcgatggctacatcctcacattcagagctgaggat
ggcacattgaagactttggagaagaagctgagggaaggagagagcaggtttgccatgtca
ggcctggagatgggaaagaactatattgttaccctcctcgcttacagaggagcaaagaag
agcagagtgatagagaccacattcaaaacagtgggtttgttgcacccgttccccatggac
tgtactcagattaagacgaatggtaacatggcaagtggaatctacacgatttatatcaac
agtgatcgcaccaagcccatggacgtgtactgtgacatggacactgatggcggtggatgg
gtggtgttacaaagacgcaacaatggacagatggacttcatgaagcgctggagaccgtac
atggccggctttgggaacatgactgatgagttctggctcggtctggacaatatctatgag
ctgaccaatactcctacccagtatgagttgcgagtggacctgggtgtgggttcagagaag
gcctatgccgtctatgacaacttcaagatagccccggcaaagcagaagttcaagctgacc
atcggcaaatacagaggaacagcaggtgatgccatgaactaccatcaaggtcgccctttc
tctactgttgacaatgacaatgacattgctcttggtaactgcgccctgactcatcgtggc
gcttggtggtacaagaactgtcaccttgccaacctgaacggcaaattcggagacaacaga
cacagcatgggtgtgaactgggagccatggaaaggccacctcatgtctcttgatttcact
gagatgaagatccggccagtgggcgccgccaggaagaggaggtcgcttagcagcagaaca
gctcccagaaaatag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112226953
Entry
112226953         CDS       T05605                                 

Definition
(RefSeq) tenascin-R-like isoform X1
  KO
K06252  tenascin
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112226953
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112226953
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:otw00536]
    112226953
Glycosaminoglycan binding proteins [BR:otw00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   112226953
SSDB
Motif
Pfam: fn3 Fibrinogen_C EGF_Tenascin EGF_2 Interfer-bind Pur_ac_phosph_N DUF4998
Other DBs
NCBI-GeneID: 112226953
NCBI-ProteinID: XP_024247414
LinkDB
Position
28
AA seq 1369 aa
MSPVRGWLLGQVLLLLGTQAALSPSGEEGKLVRTIRVRRQAPSDGPTSQSNNQTIKEQPM
VFNHVYNINVPLESLCSVDLDSAVPLPSQATRAAVSSGGGEGATEFTEQTVDADSQVTFT
HRINIPKQACACPTANIVQQLAIRIEMLEREVLLLRAQCSSGNCGCGESSAMGHLDYIPQ
CSGHGSFKMDLCGCVCEDGWTGKNCSEPRCPDNCSGQGVCMEGECVCDRDFGGDNCSEPR
CPADCSGRGLCMDGECICEENFTGEDCTLGRCLNDCSDQGLCTNGTCQCRPGYVGEDCSL
AYCANNCSQKGICKEGFCVCQDGFVGEDCSAVAPALNLRMRGVTEHTIDLEWEGSVLMTD
YLVTYVATSPGGVQLEIRIPGNTTTCSIPDLEPGIEYNINVYAVLNNVISAPTNTQVSTY
LSNPDGLLFKSITETSVEVQWQPFYYSFDGWEISFIPKDNDGGMTAQLPSTITSFHQTGL
RPGEEYTVNLVALRDQGRSQPVSATVTTLIDGPTQLIVRDVSDSVAFVEWTNPKAKMDQI
VLRYGLVGEDSPKTTFRLQPTLSQYSLQMLRPGSRYEVSISGVRKGNESGTISTEFSTVL
VFLSEIDAPKNLRVLSKFSTTLELEWDNSEAEVEGYQVVYSTLAGDQYEKVIVPLNDGPT
SKTTLTNLLPGTEYGIGISAMLGTNQSFPATMNARTGLDVPMDLTVTASTDNTITLLWGV
VQGPIDHYMVTYTSSSGLTTEVTIPKDVTTTTLNDLEPGTEYTITVAAQRGRQQSTAATI
DGFTGFRPIMALYLSDVTWDSVTVAWSAPAPPADLYILTYSSEDGTDTSKVTLDGSKTRS
SIKGLLPSTEYTVSLITIHGEVKSEAVTATLTTGMDPPKEMTVSYATEDSVIISWLRPFA
PFDYYKMSYQSARGTVDSVVIDNDVTNYTLSSLHPATEYEINLNVVRGSQESKSITTSVF
TAMDMPMELTALNITPQGALLRWNPPLSSVDNYVFTLTCYQVTANTFLVEGVKQEHQLSK
LKPSTTYSVALYATKGPLTSGTVIANFETPMDAPLNLTASEVNHRSALISWQPPIADIDN
YMLTYKSVDGNRKELILMPRTLGLRLEGLAETTEYTVRLQAARGLETSGIVSTAFTTGNR
LFATPQNCAQHLLNGESLNGVYTIYINRDANQGVQVYCDMTTDEGGWIVFQRRQNGLTDF
SRKWSDYRVGFGNLEDEFWLGLDNIQKLSAQGRYELRIDMKDGQESVYASYDKFAIGDVR
NLYKLRIGEYNGTAGDSLSYHQGRPFSTKDRDNDIAVTNCALSYKGAWWYKNCHRANLNG
KYGESRHSQGINWYHWKGHEFSVPFVEMKMRPFNYRSISGKRRRSTPPE
NT seq 4110 nt   +upstreamnt  +downstreamnt
atgagccctgtacgaggctggctgctgggccaggttctactccttctagggacccaggct
gcactatccccgtccggcgaggaggggaagctggtccggaccatcagggtcagacgacag
gcaccttcagatggccccaccagccaatctaacaaccagaccatcaaggagcagccaatg
gtcttcaaccatgtgtacaacatcaacgtgcccctagagtctctgtgctcagtggatctg
gactcagcagtgcctctacctagccaggccaccagagcggctgtgtccagtgggggtggg
gagggcgccacagagttcacagagcagacagtggacgcagacagccaggtcaccttcacc
caccgcatcaacatccccaaacaggcctgcgcctgtcctacagccaacatcgtgcagcag
ctggccatccgcatcgaaatgctggagagagaggtgttgctgctgagagcccagtgcagc
tctggcaactgtggctgtggggagagttcagccatgggacacctggactatattccacag
tgcagtggccatggcagcttcaaaatggacctgtgtggctgtgtgtgtgaggacggctgg
acaggcaagaactgctctgagccgcgttgcccagacaactgctccggacagggagtgtgt
atggagggtgagtgtgtctgtgaccgtgacttcgggggggacaactgctcagagccccgc
tgcccggcggactgctccggtcgagggctgtgcatggatggggagtgtatctgtgaggag
aacttcactggagaggactgtacactgggtcgctgcctcaatgactgttctgaccagggc
ctgtgcaccaacggaacctgccagtgtcgcccgggatacgtaggagaagactgctccttg
gcctactgcgccaacaactgtagtcagaagggcatttgtaaagaaggcttctgtgtctgc
caagatggcttcgttggagaagactgctctgcagtggctccggctctgaacctgcgcatg
cggggagtgacggagcataccattgacctggagtgggaggggtcagtgttgatgacggac
tacctggtcacctacgtggccaccagcccaggtggggtccagctggagatcaggatccct
gggaacaccaccacctgcagtatcccagacctggagcctggcatcgagtacaacatcaac
gtctacgctgtgctcaacaacgtcatcagtgcccctaccaacactcaggtgtcaacctat
ctctcaaatccagacggtttactcttcaaatccatcacagagacgtcagtggaggtgcag
tggcaacctttctactactcctttgatggctgggaaataagcttcattcccaaggacaat
gatggagggatgacagcccagctacccagcaccatcacttcgttccaccagacaggcctg
aggccaggggaggagtacaccgtcaacctggtagctctgagggaccaaggccgcagccag
cctgtatccgccaccgtcaccacattgattgatgggccgacacagctgatagtgcgtgat
gtctcggactcggtggccttcgtggagtggaccaatcccaaggccaagatggaccagata
gtgctgcgttatggcctggtaggagaggatagtcccaagaccactttccgtctgcagccc
accctcagccagtactccctgcagatgctgaggccaggctcgcgctatgaggtgtccatc
agtggagttcgcaagggcaatgagagtggaacaatctccacagaattcagcaccgttctg
gtgttcctctcagagatcgacgcgcccaagaacttgcgagtgctgtccaagttctccacc
accctggagctggagtgggacaacagcgaggcggaggtagaggggtaccaggtggtctac
agcaccctagcaggggaccaatacgaaaaagtcattgtcccactcaacgatggacccacc
agcaagaccacactcacaaacttgttgccaggtacagagtatggcattggcatatcggct
atgcttggcaccaaccagagttttcctgccacaatgaatgccagaactggtctagatgtc
cccatggacctaactgtgacagcgtccacagacaacaccatcaccctgctgtggggggtg
gtacaggggcctatcgaccactacatggtcacctacacctcctcatctggcctgaccacg
gaggtgaccatccccaaggacgtgaccaccaccacgctcaatgacctggagccaggcaca
gaatacaccatcactgtagctgcccagaggggaaggcagcagagcactgcagccaccatc
gatggcttcacaggcttccgccccatcatggcactctacttgtctgatgtcacatgggac
tcggtgacggtggcatggagtgcccctgccccacccgcagacctctacatcctcacctat
agctctgaggacggcactgacacgtccaaggttaccctggatggatccaagacccggtcc
tctatcaagggactcctgccctccacagagtacaccgtcagccttatcaccatacatgga
gaggtgaagtctgaggctgtcacagccacgctcaccacaggaatggatccacctaaagag
atgactgtgtcatatgccactgaagactccgtcatcatatcatggttgagaccatttgct
cccttcgactactacaagatgtcctatcaatcagcaagagggacagtggacagcgtggta
attgacaatgacgtcactaactacaccctgtccagcctccacccagcaacagagtatgag
atcaacctgaacgttgtgcgaggcagccaggagagcaagtccatcaccaccagtgtcttc
acagcgatggacatgccaatggaactaacagccctcaacattaccccacaaggagcttta
ctccggtggaaccctcctctgtccagcgttgacaactacgtgttcaccctcacctgctac
caggtgacagctaataccttcctggtggaaggtgtgaaacaggagcaccagcttagtaaa
ctcaagcccagcaccacttactctgtagccctctacgccaccaagggacccttgaccagt
ggaaccgtcatcgccaactttgaaacacccatggacgctcctctgaacctgacggctagc
gaggtgaaccaccgcagtgccctcatctcctggcaaccgcccatcgcagacatcgacaac
tacatgctcacatacaagtcagtggacggcaacagaaaggagctgatcctgatgccgagg
acacttggactccgtctggaggggctggcagaaaccacagaatacactgtgaggttgcag
gctgccaggggattagagaccagcggaatcgtctctacggccttcacaacaggaaatcgt
ctgtttgccaccccccagaactgtgcccagcatctgttgaacggggagtccctcaatggc
gtctacaccatctacatcaacagagatgccaatcagggagtgcaggtctactgtgatatg
accacagatgaaggaggctggatcgtgttccaacgtcgtcagaacggcctgacagacttc
tccaggaagtggagtgactacagggtcggctttggaaacctagaggatgaattctggctc
ggtttggacaacatacagaagctctcagctcaaggtcgctatgagctccggatcgacatg
aaggatggccaggagtctgtctacgccagctatgacaagttcgccattggagacgtcagg
aatctgtacaaactcaggataggagagtacaatggcacagctggggactcgctgagctat
caccaaggccgtcccttctccaccaaggacagagacaatgacatcgccgtgaccaactgc
gctctgtcctacaaaggagcctggtggtacaaaaattgccatcgggccaacctgaacggg
aaatacggggagtcgagacacagtcagggtatcaactggtaccactggaagggccatgag
ttctctgtcccctttgtggagatgaaaatgaggccgttcaactaccgcagcatcagtggc
aagcgaaggaggtccactcctccagaataa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112226965
Entry
112226965         CDS       T05605                                 

Definition
(RefSeq) laminin subunit gamma-1-like isoform X1
  KO
K05635  laminin, gamma 1
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112226965
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112226965
SSDB
Motif
Pfam: Laminin_EGF Laminin_N Laminin_B Alanine_zipper Death DNApol_Exo
Other DBs
NCBI-GeneID: 112226965
NCBI-ProteinID: XP_024247451
LinkDB
Position
28
AA seq 1477 aa
MFLFCSSGKAFDITYVRLKFHTSRPESFAIYKRTSEDGPWTPYQYYSGSCEKTYQKTNRG
FIRTGEDEQQALCTDEFSDISPLTGGNVAFSTLEGRPSAYNFDNSPVLQEWVTATDIKVT
LNRLNTFGDEVFNDPKVLKSYYYAISDFAVGGRCKCNGHASECVKKNGFGKPVCNCKHNT
EGDDCNVCKPFYNDRPWRRATANNPNECLPCNSNGKSAECYFDPELYRATGHGGHCRNCA
DYTDGPNCERCLDNYYRDTSGTRCLPCSCNPVGSLATQCDNTGRCNCKPGVMGDKCDRCQ
PGFHTLTEAGCRPCSCNPSGSTQECDVQTGRCQCKDNVEGFSCDRCKLGYFNMDLQNPQG
CTPCFCFQHSSVCDSAEGYSIDTTSSTFNRDDEQWTGQQRDSSSVSVRWSTGGEISLISD
DYFPMYFVAPERFLGNQLLSYGQNLTLNFRVDRRDTRLSAEDVVLEGAGLRVAVPLIAQG
NAYPGENMQTFVFRLHDSTDYPWRPTLTHSEFQKLLHNLTSIKIRGTYSERSAGYLDDVK
LITAKRGPGSPARWVEKCTCPQGYLGQHCESCAPRYRRSRPDLGPFSSCDSCNCNGHSDA
CHPDTGMCNCLHNTAGLSCERCKDGYYGDSTVGSSSDCKPCPCPGGSTCAVVPKTKEVVC
TNCPTGTTGKRCELCDDGFFGDPLGGNRQVRVCRACKCSDNIDPNAVGNCDRETGECLKC
IYNTDSFFCDRCKEGFYGNPLATNPNDKCKACSCSPYGTVDRQTSCLQVTGQCQCFPHVT
NRDCSACQPGFFNLRSGTGCEQCNCNSIGSTNGQCDIGSGQCECQPGVTGQRCERCEVNF
FGFGLSGCKPCDCDPEGSSTAQCKEDGRCACLPGFVGARCDMCEENYFYNRSTPGCQQCP
SCYSLVRDKVNQQRQKLHDLQTLIDNLGSMSETVSDKAFEDRLKEAEKSIMDLLDEAQTS
KDVDKGLLERLGKLNSTLTTQWNRLQNIRNTVDNTGTQADKARNRVRDAENLIGLAREEL
DKAKDAISKLDIKAPSISGDPNNITLLAEEARNLADKHKMDADQIEKIAKDANDTSTKAL
NLLTKTLDGEGKTNQDIDELNRKYNEAKDLAKNLEKQANKVHAEAEEAGDKALKIYANLT
SLPPFNTKSLEDEASKIKKEASDLDKLIDKTEKEYNDLRDDLRGKETEVRKLLEKGKTEQ
QTADQLLARVDAAKALAEEAAKKGRTTYQEAQDILGNLRDFDKRVNDNKTAAEDAMKRIP
EINATIIAANEKTKQAEGALGNAAADAKEAKSKAEEAEKIASAVQKGSAKTKADAEKAFE
DTMMLDGEVNGMMDQLSAAEAELAKKKAEADQDMMMASMASDNAKEAEDNARKAKSAVRT
VLNTINDLLKSLGNIDKVDLSKLGLIEGSLKQAKDKMANSDLDRKLAELNDVAKSQEEMI
TDYDRQIREIRSDIANLNDIKNTLPDGCFNTPSLERP
NT seq 4434 nt   +upstreamnt  +downstreamnt
atgtttcttttctgttcttcaggcaaggctttcgacatcacttacgtgcgactcaagttc
cacaccagccgcccagagagcttcgccatctacaagcgcacaagtgaggatggaccatgg
acgccttaccagtactacagtggctcctgtgagaagacctaccagaagaccaacaggggc
ttcatccgcaccggagaggacgaacaacaggcactgtgcacagacgagttcagtgacatc
tcacccctgactggaggaaacgtggccttctccacccttgaaggccggcccagtgcttac
aactttgacaacagcccagttcttcaggaatgggtgacagccacagatatcaaggtgacc
ctgaacaggctcaacacattcggagatgaagttttcaatgatcccaaggtcctgaaatct
tactactacgctatctcagactttgcagtgggaggaaggtgcaagtgcaatggccatgcg
agtgagtgtgtgaaaaagaacggtttcggcaagccggtttgcaactgcaagcacaacacg
gagggcgatgactgcaatgtgtgtaagccgttctacaacgaccgtccctggaggagagct
acagccaataaccctaacgagtgtctgccgtgcaactctaatggcaagagtgcagagtgc
tacttcgaccctgagctctaccgtgccaccggccacggaggacactgccgcaactgtgcc
gactacacagacgggcccaactgtgagcgctgcctggacaactactacagagacacatct
ggcacccgctgcctgccctgcagctgcaacccagtaggctctctggctactcagtgtgac
aacacagggcgctgcaactgtaaacccggtgtgatgggggacaagtgtgaccgctgccaa
cctggctttcacacgttgaccgaagcaggctgcagaccttgctcctgtaacccttccgga
agcacacaggagtgtgatgtccagacaggccgttgccagtgcaaggacaacgtggagggc
ttcagctgtgacaggtgtaagctgggctacttcaacatggacctgcagaaccctcagggt
tgcactccgtgcttctgcttccagcattcctctgtctgtgacagcgctgaaggctacagc
attgacacaacatcctccaccttcaaccgagatgatgagcagtggacaggccagcagcgt
gacagctccagtgtttcagtccggtggtccactggtggggagatctccctcatctccgat
gactacttcccaatgtactttgtggctccagagcgattcctgggcaatcagctgctgagc
tacggccagaacctcaccctgaacttccgggtggacaggagagacacacgtctctcggcc
gaggatgtggttctggagggggctggtctcagagtggctgtgcctctcattgctcaggga
aatgcctatcctggagagaacatgcagacgtttgtgttcaggctccacgacagcacagac
tatccctggaggcccaccctcactcactcagagttccagaagcttctgcacaatctgacg
tccatcaagatccgtggcacctacagcgagagaagtgctggttaccttgacgatgtgaag
ctgatcacggcgaagagaggtcccgggagcccggctcgctgggtagagaagtgtacctgc
cctcaaggctacttgggacagcactgtgagagctgcgccccgagatacaggaggagcaga
ccagacctggggcccttcagttcctgtgactcctgcaactgtaacggacacagtgacgcg
tgccaccccgacacagggatgtgtaactgcctacacaacacagctgggctcagttgtgag
agatgtaaagacggttactatggagactccactgtggggagttccagcgactgcaagccc
tgcccctgccccggaggatccacttgtgctgttgtgcccaagaccaaggaggttgtctgc
accaactgtcctactggaaccacaggcaagcgctgcgagctgtgtgatgacggtttcttc
ggagaccccctgggggggaaccggcaggtgagggtctgtcgggcctgtaagtgtagcgac
aacatcgaccccaacgctgtgggcaactgtgacagagagaccggggagtgcctcaagtgt
atctacaacacagacagcttcttctgtgaccgttgcaaagagggcttctatggaaacccg
ctggccaccaaccccaacgacaagtgcaaagcctgctcctgctctccatatggcacagtg
gacagacagaccagctgtctacaggtcacaggccagtgccagtgtttcccccacgtcacc
aacagggactgcagcgcctgtcagcctggcttcttcaacctgcggagcggaacaggctgt
gaacaatgcaactgcaattctattgggtccaccaacggtcagtgtgacatcggttccggt
cagtgtgaatgccagcccggcgtcaccggtcagcgctgtgaacgctgtgaggtcaacttc
ttcggcttcggattgtcaggctgcaaaccgtgcgactgtgacccagagggctcctcgaca
gcccagtgtaaagaagatggccgctgtgcgtgccttccaggctttgtgggagccaggtgt
gacatgtgtgaggagaactacttctacaaccgctctactcccggctgccagcagtgtccg
tcctgttactccctcgtcagagacaaggtgaaccagcagagacagaagctgcatgacctg
cagactttgattgacaacctgggctccatgtcagagactgtgagtgacaaggcgtttgag
gaccgactgaaggaggcagagaaatccatcatggacctactggacgaagctcagaccagc
aaagatgtggacaaaggcctgctggagcgcctggggaaactgaacagcacactgaccact
cagtggaatcgtttgcagaacatcaggaacactgtggacaacactggaacccaagccgac
aaggcccgcaaccgggtccgagacgccgagaacctgatcggcctcgcccgcgaggaactg
gataaggccaaggatgccatcagcaaactggacatcaaagcaccctccatcagtggagat
cctaacaacattacccttctggcagaggaggctcgcaatctggcagacaaacataaaatg
gacgcggatcaaattgagaagatcgcaaaagatgccaatgacacgtccaccaaggctctc
aacctgctgacaaagactctagatggcgagggcaagaccaaccaagacattgatgagctc
aacaggaagtacaatgaggcaaaggacctggccaagaacctggagaaacaggccaacaag
gtgcatgctgaggcagaggaggcaggcgacaaagccctgaagatctacgctaacctgaca
agcctgccacctttcaacaccaaatcactggaggacgaagcgagcaagatcaagaaggaa
gcgtctgaccttgacaagctgattgacaagaccgagaaagagtacaacgacttgagggat
gatctgcgagggaaggagactgaggtccgcaagctgctggagaagggcaagacggagcag
cagactgccgatcagttgctggctcgtgtcgatgctgccaaggcgctggctgaggaggcc
gccaagaaggggaggaccacctaccaggaggcccaagacattctgggaaatctgagagac
tttgacaagcgggtgaatgacaacaagacggcagctgaggacgccatgaagagaatccca
gagatcaacgctaccatcatcgcggccaatgagaagaccaagcaggctgagggggcacta
ggcaacgcagctgcagatgccaaggaggccaagagcaaggcagaggaggcagaaaagata
gccagcgctgtgcagaagggttctgctaagaccaaggcggatgcagagaaggcctttgag
gacactatgatgctggatggggaggtgaacggcatgatggaccagctgagtgcagccgag
gcagagctggccaagaagaaagctgaggccgaccaggacatgatgatggctagcatggca
tcggacaatgcgaaggaagcggaggacaacgcccgcaaagccaagagtgctgtcaggacc
gttctcaacaccatcaacgacctgctcaagtcactgggcaacattgacaaggtggacctg
agcaagttgggcttgattgaggggtcactgaagcaggccaaggacaaaatggcgaacagc
gacctggaccgcaagctggcggagctgaatgatgtggccaagagccaggaggagatgatc
accgactacgacaggcagatcagggagatccggtctgacatcgccaacctcaacgacatc
aagaacactttacctgacggctgcttcaacaccccatccctagagcgaccttaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112226966
Entry
112226966         CDS       T05605                                 

Definition
(RefSeq) laminin subunit gamma-2-like
  KO
K06246  laminin, gamma 2
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112226966
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112226966
SSDB
Motif
Pfam: Laminin_B Laminin_EGF TACC_C CAP_N Spc7 DUF1664
Other DBs
NCBI-GeneID: 112226966
NCBI-ProteinID: XP_024247454
LinkDB
Position
28
AA seq 1150 aa
MTIWIYLIPVRFSVTMMSSWIFLCGLSLCTWSSIQGTYRYGGSDICKCNGKSRYCLPDSG
GLHCVDCQDNTEGRHCEKCKEGFHHQRAGDSCVPCNCSSIGSVGAHCDSRGRCSCRAGTQ
GEKCDQCQNGTPISSNGCAANGGQLTDNSVTAQSLPCFCYGHSTECSTAKGYSVHTVTST
FDDGPEGWRAATVHGVTPSQVHFRWSPTHHDIEVISKDILPVYLHAPDSYLGNQELSYGQ
NLSFSLRLDRGIRHPSMADVVLEGSGLSVAASLGDLRTIVPSGQKITYTFRLDEQQGSEW
RPHLSSFQFQTLLHNLTDIKIRGTFGENGRGYLDDVRMESARRGAGSPAAWVQKCSCPVG
YEGQFCEKCAAGYKRSSPSKGPYSSCEPCSCRGGSCDSETGDCYSADETPGHQICPPGYY
NDPAQPQSCQKCPCPNGGACSVSPGSLEVKCDLCPPGTTGSHCHTCQDGFYGDPLGEDGI
QRPCRRCQCNGHMDPNTVRSCDPQTGQCLKCLKHTTGFFCESCLEGYHHSMPSEACKPCG
CNSQGSLYNKCSDQGQCSCREGFEGLKCQRSACPSCFNLVKTEMEGYSRKLREIETLFTG
MESGSLPVNNAQMEKAIRTAEDIVTDLQRNAQTLSESEKDLQARLSDISATQLSEGRDIQ
AISNTVDNIKLQDQKYQRQVSDVQTLISDVRSKLEEARFNIKQAEFPLGDAGVGTDTLSS
LVQRATDLAEKQQSKSETMEKTANGALAKSEKSLALMRSVMTGENKIKELISDLKTKYDE
NSAQVKAMESLATRLSSSAQDESRMATGTLEQIASLELGIPRPLKKDIDSVLAKLDGLRE
RVEKNLTAYQALQEDTQEDKAAVEDLLAQGKAAQQKYDQLLGRANHAKADTELALKDITD
NIDGVDNALEMLRGFDGQINKNKALADEAIKKLPGINATIHQAVGNNSETLFIIGSVTGD
YNDALGTVSSLEAVVSRLEGMSGSLPVPPAGLLKDATKLKEDVQGLQKQAVATVAKVAAE
KANAEIQKDRAAEASIGATGAYNNAKHTRDAVGETLLVINNLLSMIGKPGSVDEERLGEL
EQSITSARGQVNLQLQPRLQDLEGKEASQRTRLTGLNLDIDRILDDIRNLEDIHANIPKG
CFNSPPIERP
NT seq 3453 nt   +upstreamnt  +downstreamnt
atgacaatttggatctacttaattcccgttcgattttctgtgacaatgatgagcagttgg
atatttctgtgtggactttctctttgtacctggtcgtctatccaaggaacctacagatat
ggaggatcagacatctgtaaatgcaatggaaagtcacgttattgcttgcctgactctggg
ggcctccattgtgtggactgccaagacaacactgagggaaggcattgtgagaagtgcaag
gagggattccaccaccagagggcaggagacagttgtgtgccgtgtaactgcagctctata
ggttctgtaggcgcacactgtgacagtagaggacgctgcagctgtagagcgggaacacag
ggggagaaatgtgaccagtgtcagaatggaacacctatcagctcaaatggctgtgctgct
aatggtggccagcttactgacaactcagtgaccgctcaatctctaccttgcttttgctat
ggacactcgactgagtgctccacagccaagggatactccgttcacacagtcacctcaacc
ttcgacgatgggccagaggggtggcgagctgccactgttcacggtgtgactccatctcaa
gtccacttccgctggtcccccactcatcatgacattgaggtcatctccaaagacatcctg
cctgtttacctccatgcccctgactcttacctgggcaaccaggagctgagctacggtcag
aacctgtccttctccctgaggctggaccgagggattcgccatccgtccatggctgatgtg
gtgctggagggatctgggctgagcgtggcagcttccctgggagacctgaggaccatcgtt
cccagtggacagaagattacttacacattcagactggatgagcaacagggcagtgaatgg
aggccccacctttcatctttccagtttcaaacactcctccacaatctgactgacattaaa
atccgtgggacatttggagaaaatgggcgtggttaccttgacgacgtgcgcatggagtct
gcccgtcgaggtgccgggtccccagctgcatgggtacagaaatgtagctgcccagtggga
tatgagggccagttctgtgagaagtgtgctgcagggtataaaagaagttcgccaagcaaa
ggtccatacagctcctgtgagccctgcagctgtagaggaggaagctgtgactctgaaaca
ggagactgttactctgcagatgagacccctggtcaccagatctgcccgccagggtactat
aatgatcctgcccagccacagtcttgtcagaagtgtccctgtcccaatggaggtgcctgc
tctgtgagcccaggttccctggaggtcaagtgtgacctctgtccacctggcaccactggc
tcacattgccacacctgccaggatggtttctatggcgatcccttgggtgaagatggcatc
cagaggccttgtcggcgctgccagtgcaacggacacatggacccgaacactgtccgtagt
tgtgacccacagacagggcagtgcctgaaatgcctaaagcataccactggcttcttctgt
gagagctgtctggagggctatcaccacagcatgccatcagaggcatgcaaaccttgtggc
tgcaattctcagggctctctgtacaacaaatgcagtgaccagggccagtgttcttgcaga
gaaggctttgagggtctgaagtgccagcgttccgcgtgtccctcctgcttcaaccttgtc
aagacggagatggaggggtatagtcgtaaactacgggagatagaaactctgtttacgggc
atggagagtggcagtctaccagttaacaacgcccagatggagaaagccatcagaacagca
gaggacatagtcacagacctgcagagaaatgcacagacactctctgaatcggagaaagac
ttacaggcccggctctcagacatcagtgcaacccagctgagtgaaggcagagacatccag
gcgatctccaacaccgttgacaacatcaagctgcaggaccagaagtaccaacgacaggta
tctgatgtccagacactcatcagtgatgtgcggagcaaacttgaagaggcaagattcaac
atcaaacaagctgaattccccttaggtgatgcaggggtgggcacggacaccctctcttct
ctggttcagagagcaacagacctggctgaaaaacagcagagcaaatcggagacaatggag
aagacagctaacggtgcccttgcaaagtcagagaagtccctggcactcatgagatcggtc
atgacaggggaaaacaagatcaaggagcttatcagtgatcttaaaaccaagtatgatgag
aactccgcccaggtgaaggccatggagagcctggctactcgcctgagcagctctgcccaa
gatgagagcaggatggcaactggcactctggagcagatagcctccctggagctgggaatc
cctcgtcctctcaagaaggacattgacagtgtgttggctaaactggatggcctgagagaa
cgggtggagaagaacctaacagcgtaccaggcactgcaagaggacacccaggaggacaaa
gccgcagtagaggatcttctggcccaggggaaggcagctcagcagaaatatgaccagctt
cttggcagagcaaatcatgcgaaggctgacacagaactggccctgaaggatatcacagat
aatattgatggggtggataatgcactggagatgctaagagggtttgatggccagatcaac
aagaacaaggcattggccgacgaggccataaagaaactccctggcatcaacgccaccatt
catcaagctgttggcaacaactcagagaccctattcatcataggcagtgtgactggagac
tacaatgatgcactgggcactgtcagcagcctcgaagctgtggtctctcgactggaggga
atgtccggctctttaccagttcctcctgctggtctgttgaaggacgccaccaagctgaaa
gaggacgtgcagggtctgcagaagcaggcagtggccactgtggccaaagtggccgcagag
aaggctaacgctgagatacagaaagacagagcagcagaggcttcaattggagcaactggt
gcttacaacaatgccaagcacaccagagacgctgtgggagaaacactcctggtcatcaat
aaccttctgagcatgatcggtaaacctggcagtgtggacgaggagaggctaggggagttg
gagcagtccatcaccagcgctcgtggccaggtcaacctacagctccagcctcgactgcag
gacctagaagggaaggaggccagccagaggaccaggttgactggcctcaacctagatatc
gataggatcctggacgacatcaggaacttagaggacatacacgcgaacatccctaagggc
tgcttcaactccccacctattgagagaccttaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112227373
Entry
112227373         CDS       T05605                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: laminin subunit alpha-3-like
  KO
K06240  laminin, alpha 3/5
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112227373
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112227373
SSDB
Motif
Pfam: Laminin_EGF Laminin_N Laminin_G_2 Laminin_G_1 Laminin_B Laminin_I Laminin_II Laminin_G_3
Other DBs
NCBI-GeneID: 112227373
NCBI-ProteinID: XP_024248018
LinkDB
Position
28
AA seq 3493 aa
MARGVKRAHLVALLFTSMLLFWRDVYAQVSFNEITGFSLSPPYFNLAEGSRISATATCGE
DEAGRPRSDLYCKLVGGPTFGLHSQTIQGQYCDRCNSNEPNKAHPVSNAIDGTERWWQSP
PLSRGPMYNEVNVTLDLGQLFHVAYILIKFANAPRPDLWVLERSLDHGKTYAPWQYFAHS
KRECIERFGKEPNGRVVRDDDQICTTEYSKIVPLENGEIVVSLVNGRPGSKNFTYSPVLR
DFTKATNIRLHFLRTSTLLGHLITKAQRDPTVTRRYYYSIKDISVGGRCVCHGHAEVCGG
RNQGKPNRLQCECKHNTCGESCDRCCPGFNQKPWRAASTDSPNECQPCQCHSHATECYYD
PEVXQKRASLDTFGRYDGGGVCINCQHNTAGVNCELCADGFYRPHGSPPESHTGCIPCRC
DARTTAGCEMGTGRCHCRPEFTGNNCERCANSYFGYPQCIRYPIYQPTTKSPAGHIVEPT
ACPAGYFGAPSCQRCVCDRGGSVLELCDASGRCICRDGVEGERCDRCRPGHHSFPNCQEC
VCDGSGSVLEMCDSSGRCVCRGGVEGERCDRCRPGYHSFPNCQVCRCDGAGVTDRVCGPS
GQCRCRVNYFGSQCDQCAPGYYGYPDCASCQCLGEGSYDSMCNQVSGQCLCRPGVVGQQC
DRCAGSGLRFPQCSASITQCNPAGSEVSTADPQTGSCGCLPNVEGTLCDMCKPLYWNLAT
ENPSGCIECRCGVKGTLSGVGECQQKSGQCYCKPDVCSHTCDTCKEGYYLLQKRNYFGCQ
GCQCDVGGAIGRGCDEMSGQCQCRKNVVGRTCTEPAPNYYFPSLHHLRYEVEDGITPNAR
PVRFGYDPQTFPGFSWRGYAIMSPAQPEVILSLAVGFPGPFHIMVRYVTTTPRRPTQGRR
DRGRARARILVVDEPDFHTCCDSYCSSEVRVTVHVDEARRSLFRLVLRYANPSSQDSVTG
GVTATYVRGGQGSGQSKEVVFPSSSSPAYLMVPGDGFAEPFTLTPGKWIIRIQAEGLLLD
YLVLLPSDYYEAPFLQEKIAQPCTYTFTTDRDTNCLLYKHMAMNRFSSVLGSQGQFSSQW
RRRRRQALVRRPTPAHPEMASLTGRQAQLQLSLRVSPPGPYILVLEYASEVDTVQNVNLI
IAGQSESHIQARANIYSCHYSFLCRSVAVDGTNRAAVFQFTHKAELLLQTSTASMLLYKV
YAVPAEEFSMEYLDPKVLCVSVHGRFTEDSQYCVPSQYDRPSTALVLDAARDAHPSSPHA
VPQQRESEEWRRRRQSGAGGFPFHGAQSEGVLLKSPQTQIRFSARVPVPGRYVFVVHYCQ
AEHTTFPVEVRVDAGHTWAGTVNASFCPGVSCCREVVIAERRIALDLPQQDMAISLKVPP
GKTLTLDYILVVPDDSYTPDLLKEKPFDKSSDFTRQCGGPSFSIDPRTSSQFCRDSARSL
VAAYSDGALPCYCDKSGATVPTCNPVGGQCPCRPHVIGRQCTRCATGYYGFPYCRSCECG
QRLCHEVTGQCICPPQTVKPACDVCESQTFSYHPLVGCEGCDCSPNGVRSNAGRDCDRDT
GQCTCKPRIGGRQCDRCAAGFYRFPDCLPCSCNQGGVTPDICHPDTGQCLCKRNVQGARC
DACRDGSFHFDPSHPRGCVSCFCFGATDQCQSSGKRRGKFMDMRGWRLERADQEEVASVL
NPSSNTVVADVQELPSTTQLLHWVAPPSYLVDRVSSYGGYLTYQAKSFGIPSEGMSLMDR
RPDVLLSGQEMTLVHMSPHTPHPDRLHQSRVQLVEGNWRHSGTNRPVSREDLMEVLAGLV
GLRVRALYFTQSQRLSLGEVGLEEATDTGAGGPASTVEECACSPLYRGDSCQKCARGYYR
DGSGPYLGRCVPCVCNGLANECDDRTGRCLNCQYNTAGDRCERCKEGYYGDAAQRSCRVC
PCPFGVPANSFAVGCREVAGGFQCVCRPGYAGDSCERCAPGYHGDPLTTGGSCRPCDCGG
NGNSCDSRTGVCKNALEPEDTNTDEQCQECDDCAETLLNDLGRLDEELGRIKTQLDNASI
SASSQDRLRMLEKAITETKSLVSKFSSSVTARSPRLATGAGHSQCQRGYQRSERKALLLQ
LKESGSGDVVPSESLAKMLSDAERMVKEMERRNFNPQKDAADKERDEAQKLLDYIKANVT
KQYDQNEAAAKRVKGLLKDYEAKLKDLEEALKQAGDMVKKANSQNGLNSEALKDILKRME
DLNKERKKVQDQIAMAEDQLKATEDLLRMLKDSKTEYEQLAAQLDGARTDLTKKVNAISQ
AAAKEDIVERAERHAENLAKLAKELQDAVRDSSGRSDVRDAMDAIEAYKNITDAVNAAEK
AAKEAKDAADKALKDVKKEDLTKRAKNLKESGNDLLREAKDAEKDLKEASDDLTAQKKRL
NDAENKKKALEMDLLDAQAELNNIQRDDIGDMLDEAKRKAAAANDTASTTMDRLNAIREE
VDKFNVMPSDSNLGSIMDDVDKSVKNLLNSIPSLQDKISEVEELSSQLSPVTNVSDNINR
IKELIEQARDAANRIVVPMKFSGEGHVELRPPWDIEDLKAYTSLSLSLQRPELPSSRGDG
ARRRRQATTITDTGDMFILYLGNQDSSKNFIGMALRNNVLFCVYNLDGEEYEIKTDYITR
SPSEPSFFDKVDLRRIYQDAEVNLTKLFTSNQPDPPQISSKQGELTRNLLNLDPSDIVFY
VGGYPSNFSPPASLNYPNYKGCIELSTFNDRFISLYNFKNAVKVNLETPCKRYSQPVVFE
YFEGTGYAKVSTQGVKVPTLLLGQTISTRSENGLFLYIGNEENYYSVTFERGYVVIHSNL
LGEPVQSATKVFPVNSDQAEVLIIIESQGSQELKIRVAGKEVVKSNVQYTPGDFTDYYIG
GVPPALRERHNITAQPLKACMNNIKLNSKYPTFEEKVGISRGCPTDFLASRKSEFNVGSS
LSAALEGFSLARDVSVSLGFRSSEKNGLLLQNTESSVGAIELALVNGYVVLTFKDTAWKS
LKSSKQYQDGKWHYLTATRRVASQSIELRIDDEDVTGQITSSSFSSNPDSVFLGKDTFKG
CISNLYLRRPNFLYRAEDLSQFSSTGDVLLDKCSSDRPPQLMLDHNTSRKGGGMEMSEDS
LSVCAHSVLVKHAYHIGGTVSSLSYSLTPQVLQPRPHFSLDVRTKSAEGLLFYAATRGGS
SHMALYLSKGRIRLSVGKGKEIFNREKYNDGRWHSVIFSLEKKRFRLVVNGIRAQAGQLT
SDEATSMELICPLYLGSAPDSLNTELNWKLLPKQSVIGCVRNFKMNGTPMPEPTTNHGAG
PCFDGQTQSGAYFSGRGAYVIINDSFVVGSSFEVVFDIRPRTLTGVLLHVGDSSRPRRGP
NTGHHLSLYMHRGEVVASVNNGAGEFSVSVRPKQPLCDGMFHRVAVIKRNNVVEMHVDTE
GNHKIGPPSSSPTLTKDPLYVGGIPETSMHPSLPVTGSFEGCIQNMKINEDPISFERLSG
VFGPLNLRECPAG
NT seq 10482 nt   +upstreamnt  +downstreamnt
atggcgaggggggtgaagagagctcaccttgttgctttattatttacttcgatgctctta
ttttggcgggacgtttacgcgcaggtgtcttttaacgaaataaccgggtttagtttgagc
cccccgtacttcaacctcgcggaggggtcacggatatccgccaccgcaacttgcggtgaa
gatgaagcggggagaccgagatctgatttgtactgtaaacttgtcggaggacctaccttt
ggacttcatagtcaaacgatacagggacagtattgtgacagatgcaactccaacgagcca
aacaaggcccacccggtgagtaacgccatcgatggcactgagcgctggtggcagagcccg
cctctctccagggggcctatgtacaacgaggtgaacgtcactttggacctgggacagctc
ttccatgtggcctacatcctcatcaagtttgccaacgcccctcgacctgacctatgggtc
ctggagcgctccctggaccatgggaaaacgtatgctccatggcagtactttgctcattct
aaaagggagtgtattgagaggtttggcaaagaaccaaatggacgcgtagtccgagatgat
gaccagatctgcaccacagagtactctaagatcgttccattggagaacggggagattgtg
gtgtccctggtcaacggtcgcccgggctctaagaacttcacctattctccagtgctgaga
gatttcaccaaggccaccaacatccgcctgcacttcctcaggaccagcactctgttgggg
cacctaattaccaaggcccagagggaccccactgtcacacgcaggtattactacagcatc
aaagacatcagtgtcgggggacgttgcgtttgtcacggccacgcggaggtgtgtgggggg
cgtaaccaaggcaaacccaatcggctgcagtgcgagtgcaaacacaacacctgtggtgag
tcatgtgaccgctgctgtccagggttcaaccagaagccatggcgtgctgcttcgacagac
agtcccaacgagtgccaaccctgccagtgccattcacatgccactgagtgttattacgac
ccagaggtgnagcagaagagagcaagtttagacacattcggcaggtacgacggcggaggg
gtgtgcatcaactgccagcacaacacagcgggagtgaactgtgagctttgtgcagatgga
ttctacagaccccatggatcacctccagagtctcacactggatgcataccctgcaggtgt
gatgccaggactactgctggttgtgagatggggacaggacgttgccactgccggccagaa
ttcaccggaaacaactgtgaacgctgtgcaaacagctacttcggctacccgcagtgcatc
agatatccaatctaccagcccaccaccaaatctcctgcaggccatatagtagagcccact
gcctgccctgctggttatttcggagcacccagctgtcaacggtgtgtgtgtgaccgcggt
ggatcagtgctggagttgtgtgatgcgtcagggcgctgcatctgtcgtgatggtgtggag
ggtgagagatgtgaccgctgtcgaccagggcaccactctttccctaactgccaagagtgt
gtgtgcgacggcagtggttcggtgctggagatgtgtgactcatcagggcgctgcgtatgt
cgtggaggggtggagggcgagagatgtgaccgctgtcgaccaggttaccactcctttcct
aactgccaagtatgccgctgtgacggtgcaggggtgactgacagggtctgtgggcccagc
ggacagtgccgttgccgtgtcaactacttcggaagtcaatgtgaccagtgtgcccctggt
tactatggatacccagactgtgcctcctgccagtgtttaggggagggttcctacgactcc
atgtgtaaccaagtatcaggccagtgtctgtgtcgccctggggtggtgggacagcagtgt
gatcgctgtgccgggtcaggcctccgcttcccgcagtgttcagcctccatcacccagtgt
aacccagcagggtccgaggtcagcacagcagatccacaaacgggttcctgtggctgcctg
cccaacgtggagggaacactgtgtgacatgtgtaaacctctctactggaacctggcgaca
gagaaccccagcggctgtatagagtgtcgctgtggcgtcaaaggcaccctgagtggggta
ggagagtgtcaacagaaaagtggccagtgttactgcaagcccgacgtgtgcagccatacc
tgtgacacgtgcaaggagggctactacctgctgcagaagaggaactattttggctgtcaa
ggctgccagtgtgatgtgggaggagccataggcagagggtgtgatgagatgtctggacag
tgccagtgtcggaagaacgtagtgggccgcacctgcactgagccagcacctaactactac
ttccccagcctgcaccacctgaggtatgaggtggaggatggcatcacccccaacgccagg
cccgtacgcttcggctacgacccccagacgttcccaggattcagctggagaggttacgcc
atcatgtcccctgcgcagccagaggtgatcctatcgttagctgtgggtttccccggcccc
ttccacataatggttcgctacgtcaccactaccccccgcagacccacacaggggcggcgg
gatagggggcgagctcgagccaggatcttggtggtggacgagcctgattttcacacttgc
tgtgactcttactgctccagtgaagtgagagtaacagtgcatgtggacgaggcaaggcga
tccttgttccgacttgtcctgcggtacgctaaccccagcagccaggacagtgtgactggt
ggtgtaacggctacctatgtccgaggtggccaagggtcaggtcagagtaaggaagtggtg
tttccttctagctcctcccctgcctacctcatggtccctggggacggcttcgctgagccc
ttcacactgacccctgggaaatggatcatacgcatccaggcagagggccttctactggac
tacttggtgctgctgcccagtgattactacgaggctcccttcctccaggagaagatcgcc
cagccctgcacgtacacattcaccacagacagagacacaaactgtctgctgtataagcac
atggcaatgaacaggttcagctctgtgctgggctctcagggccagttctccagccagtgg
agacgcaggaggagacaggccctcgtccgccggccaactccagcccaccccgagatggcg
tcgctcaccgggagacaggcccagttacagctgagcctgcgcgtgtctccacccggtccc
tacatccttgtcctggagtatgccagcgaggtagacacggtccagaacgtcaacctcatc
atcgctggccaatcagagagtcatatccaggccagagccaacatctacagctgccattac
agcttcctttgtcgcagtgtggcggttgacggaaccaatcgcgctgcagtgttccagttt
acccacaaggccgagcttcttctacagacctccacagcctcaatgctgctgtataaagtg
tatgcagtgcccgcggaggagttctccatggagtacctggaccccaaggtgctctgcgtc
tctgtccacggacgcttcactgaggacagtcagtactgtgttcctagccagtacgacagg
ccctccacagcgctggttctggacgcagctcgggacgcacacccctcctccccacatgcc
gtcccccagcagagggagagtgaagagtggagacgaagacgacagtcaggggctgggggc
ttccctttccatggagcccagagtgaaggggtactactcaaatcaccccagacccagatc
cgtttcagtgccagggtgccagttcctggcaggtatgtgtttgtggtccactactgtcaa
gctgaacacaccaccttccctgtggaggtacgggtggatgccggacacacgtgggccggc
actgtgaatgcctctttctgcccgggggtctcctgctgcagggaggtggtcatcgctgag
aggcgcatcgctctggaccttcctcagcaagacatggccatctctctcaaggttccaccg
gggaagaccctcactctggattacatcttggtggttcctgacgatagctacacccctgat
ctcctgaaagagaagccgtttgataagtcctctgatttcaccaggcagtgtggaggacca
agcttttctatagaccccagaacgtcctcccagttctgcagagactcagcccgctccctg
gtagcagcctatagtgacggggccctgccctgctactgtgacaaatcaggggccacggtg
cccacctgtaaccctgtagggggccagtgtccctgtaggccccatgtgatcggtcggcag
tgtacacgatgtgccacaggatactatggcttcccctactgtagatcgtgtgagtgtggc
cagcggctgtgccacgaggtgacaggtcagtgtatctgcccgccccagacagtgaagcca
gcctgtgatgtgtgtgagagccagacgttcagctaccaccctctagtgggctgtgagggc
tgtgactgctcccccaacggagtcaggtccaacgcagggagagactgtgaccgtgacacg
ggacagtgcacgtgtaagcccaggatcggtgggcggcagtgtgaccggtgtgctgcaggg
ttctacaggttcccagactgtctcccatgtagctgtaaccagggaggggtcacacctgat
atatgtcacccagacacaggacagtgcctctgcaagaggaacgtgcagggggcccgctgt
gatgcctgtagagacgggtccttccactttgacccctcccaccccagaggctgcgtcagc
tgcttctgctttggagccaccgaccagtgccagagctctggcaagcgcagggggaagttt
atggacatgcgtggctggcgtctggagagggctgaccaggaggaggtggcatcagtcctc
aacccgtccagtaacactgtggtagcagacgtacaggagttgcctagcactacccagctc
ctccactgggtggcgccaccatcctacctggtagaccgggtgtcgtcctatgggggctac
ctcacctaccaggctaagtcctttgggattcccagtgaggggatgtcgctgatggaccgc
agacctgatgtcctgctcagtggccaggagatgaccctggtccacatgtccccacatacc
cctcatcctgacagactccaccagagcagagtccagctagtagaggggaattggcgtcac
tccggcaccaaccgtcctgtgtccagagaggatctgatggaagtcctggcagggctggtt
ggtctgagggtgcgggccctctacttcacccagagccagagactcagcctgggggaggtg
ggcctggaggaggccacagacacaggggccgggggccctgccagcaccgtggaggagtgt
gcctgttcccctctctacagaggagactcctgccagaaatgtgctcgtggttactataga
gacggcagtgggccctacctgggtcgctgtgttccctgcgtctgtaacggcctcgccaac
gagtgtgacgacaggactgggaggtgcctgaactgccagtacaacacagccggggacagg
tgtgagcgctgcaaagagggttactatggagacgctgcccagagatcatgccgggtgtgc
ccgtgcccctttggtgtgccagctaacagttttgcggtgggttgcagagaggtcgctgga
gggttccagtgtgtttgccgaccaggctacgcaggagacagttgtgaacgatgcgcccct
ggttaccacggtgatccattgacaaccggaggaagctgtcggccttgtgactgtggcggc
aacggaaacagctgtgactccaggactggtgtgtgcaagaatgcgttggagccggaggac
accaacacagacgagcagtgtcaagagtgtgacgactgcgccgagaccttactaaacgat
ctggggcgtctggatgaggagctgggcaggattaagactcagctggataatgccagtatc
tccgcctcctctcaggaccgactcaggatgctggagaaagccatcacagagaccaagagt
ctggtgagcaagttcagttccagtgtgacagccagaagcccaaggttagccactggagca
ggacactctcagtgtcaacgaggatatcagcgctctgaaagaaaagccctgctgttgcag
ctgaaagagtctggttccggtgatgtggtgcccagtgagagcctggctaagatgttatcc
gacgctgaacgcatggtgaaggagatggagaggagaaacttcaacccccagaaagacgca
gccgacaaagagagagacgaggcccagaaactgctggactacatcaaggctaatgtgacc
aagcagtatgatcagaatgaggcagcagccaagagggtgaagggtttgctgaaggactat
gaggctaaactgaaggacctggaggaggctctgaaacaggctggggacatggtgaagaaa
gccaactctcagaacggactcaactcagaggcactgaaagacatcctgaaacgtatggag
gacttgaataaggagcggaagaaggtccaggaccagatagccatggcagaagatcagctg
aaggccacagaggacctcctgagaatgctgaaggacagcaagactgagtatgaacagcta
gctgcccaactggacggtgccaggactgacctcaccaagaaggtcaacgccatctcccag
gccgcggccaaggaggacattgtggagcgagcagagagacacgctgagaacctggccaag
ctggccaaggaactacaggatgctgtgagggactcgagtggccgctctgacgtgcgtgat
gccatggacgccattgaggcctacaagaacatcacagatgcggtcaacgctgcagagaag
gcagccaaggaggccaaagatgcagctgacaaagccctgaaggatgtgaagaaagaggac
ctgacaaagcgagctaagaatctgaaagaaagcgggaacgacctactgagggaagccaag
gacgcagaaaaagatcttaaagaggcctctgatgacctcacagcccagaagaagcgcctg
aatgatgcagagaataagaagaaagcattggagatggacctgctggatgcccaggctgag
ctgaacaacatccagagagatgatataggagacatgctagatgaggcgaagaggaaggca
gcggctgccaatgacacggccagcaccaccatggacagactgaacgctatcagagaggaa
gtggacaagttcaacgtcatgccctctgactccaacctcggcagcatcatggacgatgtg
gacaagtcagtgaagaatctgttgaacagcatcccgtctctgcaggataagatctcggag
gtggaggagctcagctctcagctctcccccgtcaccaacgtctctgataacatcaatagg
atcaaggagctcattgagcaggcgagagacgcagccaataggattgtggtccctatgaag
ttcagtggggagggccacgtggagctgcgtcccccgtgggatattgaagacctgaaggca
tacacgtccctgtccctgtccctgcagagaccagagctccccagcagccgaggggacgga
gcacgcaggcggagacaggccaccacgatcacagacacgggtgacatgttcatactctac
ctcggcaaccaagactcgtctaaaaacttcatcggcatggccctgaggaataacgtgctg
ttctgtgtgtacaatctggatggagaagagtacgagatcaagacggactacatcactagg
tctccctctgagccttccttctttgacaaggtggacctgcgcagaatttaccaagacgca
gaagtgaacctcaccaagctgttcacatccaatcagccggacccacctcagatcagcagc
aagcagggagagctgaccaggaaccttctaaatctggaccctagtgacattgtcttctat
gtcgggggctacccctccaacttcagtcctccagcctccctcaactaccccaactataag
ggatgcatcgagctgtccaccttcaatgacagattcatcagcctgtacaactttaagaat
gctgtcaaggtcaacctggagactccatgcaagaggtatagccaaccagtggtgtttgag
tactttgaggggactggttatgccaaggtgtccacccaaggtgtcaaggtgcccactctc
ctcctgggccagaccatctccactcgctcagagaatgggcttttcctctacattggaaat
gaggagaactactacagtgtgacgtttgagagaggctacgttgtcatccatagtaacctg
ctcggagaaccagtacaaagcgctaccaaagtcttcccagtgaattcagaccaagcagaa
gtgttgatcattattgagtctcaaggaagccaagagttgaagatccgtgtagcaggcaag
gaggtggtcaagtctaatgtccagtacaccccaggtgacttcacagactactacatcggt
ggcgtaccaccagccctgagagaaagacacaacatcaccgcccagccactgaaggcctgc
atgaacaacatcaagctcaacagcaagtaccccaccttcgaggaaaaagtgggcatcagc
cggggctgtcccacggacttcctggcgtctcgtaaatcagagtttaacgtggggagttct
ctgtcagctgctctcgaaggcttcagcctggcaagggatgtctcagtctcactgggattc
aggagctctgagaaaaatgggctcctactgcagaacaccgagtcgagcgttggcgccatc
gaacttgccttggtcaacggctatgtggtcctgacgttcaaagacacagcttggaaatct
ttgaaatcaagcaagcagtaccaggacggcaaatggcattacctgactgccaccagaagg
gtggcttctcaaagtatcgagctgcggatagatgacgaggatgtgacagggcagataacc
tcaagctccttcagttcaaacccagactctgtgttcctggggaaagacaccttcaaaggc
tgcatctccaacctctacctgagaagacctaactttctgtacagagcagaggacctgagt
cagttcagctctacaggagatgtgctgctggataagtgtagctctgacagacctccacaa
ctgatgctcgaccacaacacctccaggaagggtggtggtatggagatgtcagaggacagt
ctctctgtgtgtgcacactctgttctagtcaaacatgcctaccacattgggggcactgtg
agtagcctgagctacagcctcactccccaggtgctccagcccagacctcatttctccctg
gacgttaggaccaagtctgccgagggcctgctgttctatgcagccaccagaggggggagc
tctcacatggctctctacctgtccaagggcaggatcaggctgtcagtaggcaaggggaag
gagatcttcaacagggagaagtacaacgatggaagatggcactcggtaatattcagccta
gaaaagaagaggttccggttggtagtgaacggtattagggctcaggctggacagctgacc
agtgatgaggccacgtccatggaactgatctgtcctctttacctgggaagtgctcctgat
tccttgaacacagaacttaactggaagctcctcccaaagcaaagtgtgattggctgtgtg
cgtaacttcaagatgaatggcactcccatgcccgagccaaccaccaatcatggagctggc
ccctgctttgacggacagacacagagtggggcctacttctcagggagaggggcatatgtc
attattaatgattcctttgtggtgggctccagctttgaggtggtgtttgacatccgtccc
aggactctgactggtgttctgctccatgttggggactccagcaggcctcgccgtgggccc
aacactggacaccacctcagcctctacatgcacagaggagaggtggtggcatctgtgaac
aacggagctggtgaattcagtgtttccgttcggcccaagcagcccttgtgtgatggaatg
ttccacagagttgcagtaatcaagaggaacaacgttgtggagatgcatgtggacactgag
ggcaaccacaaaataggacctccttcctcctcccccactctgaccaaagacccactttat
gtgggcggcattccagaaacatccatgcacccatccctcccagtcacagggtcctttgag
ggctgcatccagaacatgaagatcaatgaggacccgatctccttcgagaggctctctggg
gtattcgggccactcaacctcagagagtgtccagctggctga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112227507
Entry
112227507         CDS       T05605                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: laminin subunit alpha-1-like
  KO
K05637  laminin, alpha 1/2
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112227507
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112227507
SSDB
Motif
Pfam: Laminin_G_1 Laminin_G_2 Laminin_EGF Laminin_N Laminin_B Laminin_II Laminin_I Laminin_G_3 ARA70
Other DBs
NCBI-GeneID: 112227507
NCBI-ProteinID: XP_024248087
LinkDB
Position
29
AA seq 3100 aa
MKLFFCAIVLLWASSADCQQRGLFPAILNLASNAEITTNATCGEPEPEMYCKLVEHVPGR
RIRNSQCRTCNAQSQNPKEQHPITNAIDGTNGWWQSPSIKNGRQFHLVTITLDLRQIFQV
AYIIIKAANSPRPGNWVLERSMDGVEFTPWQYYAISDTECLTRYNITPRFGPPTYKRDDE
VICTSYYSRLVPLEHGEIHTSLINGRPSADQLTPELLDFTSARYIRLRLQRIRTLNADLM
TLSYRDPKEVDPIVTRRYYYSIKDISVGGMCICYGHAQSCPWDPVAKKLQCVCEHNTCGE
SCNECCPGYHQEPWQPGTLSNGNTCEKCNCHNKAEDCYYNQTMDDHTMSMNSPGHFQGXG
VCMIVPRTRPGVNCETCADGFYRPHEDPLVFLCVPMSPLPEDPPPPGLPLCPYGPRYLRT
PWSSFVSLWAPLPEDPLVYLCLNPGQCLCKEGFVGEHCERCAFGYRDFPLCSRCECSLEG
SLNIDPCTECICKENVMGANCDLCKQGFYNLEDRNPEGCTECFCFGVSDVCESSPWSLFQ
TVDSNGWLLPTQSVSIYTAPLTDDDNNLIVPSITMIQSYRFVSTWAAPEGFLGNRLTSYG
GLLNYTVAYDVSVDNVDNSLPSQFDLIIEGNGRTLRQTPPKQLFLTPLREQLVSVELLPQ
GFVDVHTGQRVDRDELMTVLADLAGLRIRGHLNASAEGALRLSTVSLDMADIRAANPVQA
RDVEQCECPWGYLGTSCEFCSSGFYRVGGILFGGNCLQCECNDHATECDINGVCLDCTHN
TTGPHCNQCLPGYYGDTSEGTPEDCQRCACPLIVATNNFSPTCLLEGPGQVTCDQCQQGY
TGTKCERCANGYHGDPNVAGKECVLCECNGNVDPWDPGHCDTSSGVCLKCHSHTSGDDCE
RCEDGYYGDAITAKNCQACSCHGNGSYSAMCDLLTGQCTCKPNVVGEKCDQCQVGFHSLL
SGQGCRDCNCSQSGSVSTACEEEGRCQCIPGVAGDKCDRCYHGYFNYQDRGCTQCECAHT
HGNCNATTGKCICPPHTIGEKCELCEEGHWGHDTVAGCKSCDCSEAGSSATQCDLTNGQC
LCRPDFARQKCDQCTMGYRGYPECTACNCNINGTREEFCDKELGLCSCEAPGNCVCKDNV
GGGGCDECKKGSFGLSGPNPDGCSPCFCFGVSSDCEELGGMVRVPITLGSDPELLHVVSQ
RDPQGSVEGVYYQASDMLLDTREKENITLPGPYYWRLPKHYQGNKLLSYGGKLSYMVAFY
ALDGAGLANYEPQVLMRGGHLGKKVIYIDMPAPDNRVKTRQDVPLTEHKWKYFNSVSEKA
VSHSDFLAVLSNIEYITIKASYGTGLQQSRISNITMDTALEAEEGSEGLEVACLIETCEC
PAGYAGLSCQECSPGYYRQPVTDLNLRGKRPLIQPCVPCQCNNHSQACDLDTGECLGCQH
NTAGEHCNVCGSGYYGNVKGSVSDCSLCACPLKENSFSPTCAMEGVMGDFRCNACKPGYE
GRYCERCSVGYYGNPSGPGGKCEACQCSTAGSLHLVCDSLKGQCECKAGVRGHLCDQCEA
RHVLDGDQCVSCDDECTGVLLDDLDALESSFLSVNLTGVILSPYSTLVSLENDTREVKNL
MSWESSPAYHLNRVEEDLTNLTQDIDGLLRQATGLSADGEEVAQSTENSVTQGAKFLEYI
ITIHTAIQVLAEEAAGLNRTENVEKDEANSTRLWEQVAAMLETIKLVNLSQANASVSTEL
SATEALLQRVLEDLLEPQGAIESQTLNISNTLTEHHQQLEDAHALLMTARENNNHTHTLL
GSIYTNLPEYQGLKQNVSRLNQTAETQLEETQDILADAVNLAEDMSNVTSLRQLEQWNPM
LRKHVDTLVMELRKKDALELVYKAEDHARELSKKAQGLQSSLVEVMNTTLNATSAEHGDS
NIRANVQPAEEMANLANLTATMALNMIVQPEESFTDLGSEAVQRSEKILAESLTLRNSTE
GLVANISDVTDRIALLKEKLCNTSRLIPEQGALLHSLPNGTSEQVLDAKEQAALANTSLQ
RALERLEELRVRLEKSSTAVAQTRTSISNTNQLFSDSQSTASTAESKLKEAESRTERLYD
RLKPLKTLGENLSRNLSEIREMINQARKQAASIKVAVLADKNCVRAYTPEVSSSNFNTLT
MTVKTSEPDNLLFYMGSSSSVDFMAVEMQHGKVAYLWDTGSGHAKLEYPDVQINNNKWHH
INATRFGRHGTLSVHQLESEPLPAVKTTSPGSATILEVNKSTLIFVGGLGGQIKSSVVKM
TQFKGCMGEASLNEKNIGLWNYAEREGQCRGCFMSPQTEETSFHFDGSGYSVVEKPLRST
STSIVMLFKTLSPNGLLLYLASNGTRDFLSIELVEGQVRLTFELGSGPLTLTSNKAYNTG
SWYKITLQRNKRKVYMAVMAADNSSEKEIMEAESPGTASDLNRSDLDPIYIGGLPMSRPI
RRQVVARSYVGCIKNMEIARSNFDLLRDSYGVKKGCVLEPIRSVSVLREGYVELPSVSLD
PQGELLASFSTRNDTGIILAGFSKAGTRKSRQARQPFLAVMLISGRLEVHVNMAEGGSVH
KVVVKSRSGSFSDGQEHSVILQRNRKMLVVLVDEDHQEMVRLSSEKASLTLTSLYMGGVP
PGEGAGQLRTTSSFYGCIRNLALDSKLLDLSAAVRYRNVDMDSCLLEERPKRVLLPDDTD
LDAEPTPDPARTPSPPPGQLSALTPGTLTCASMDNTSSIPEAQQFGISRHSHMVLSINPN
TVRRSFSLELSVRTYTQSGLIYYMAHANQMDYATLQLLGGHLFFTCDKGSGPATATFPVP
VNDGQWHTVKTDFNKKSVVLSVDGQPSTPVPAKGNTLDVENKLYLGGLPQTYTAKKIGNV
THSLAGCIQKVLLNSVKLNTQSPVSEQSTAYCFTAAQDGTFFNGSGYAALIKNGYKVGSD
MEVSLEFRSTVSDGVLLGVSSAKVDAIGLELANGQAVFHVNNGAGRVSATSRLGWWLCDG
LWHTLLAKKTKNALSLTVDGVTVLTDNPHPQSTSAETKDPVYVGGFPVGVKQNCLTSRMP
FRGCMRNIRLIKGHMTNILDFSTAFTLHGVSPHSCPSTAT
NT seq 9303 nt   +upstreamnt  +downstreamnt
atgaagctcttcttctgtgcaattgtgctgctatgggcatcctccgcggactgccagcaa
agaggtctcttccctgccatcctcaacctggccagtaatgcagagatcaccaccaatgcc
acctgtggagagcctgagccagagatgtactgtaagctggtggaacacgtaccaggacga
cgcatccgcaactcccagtgtcgaacctgtaatgcccagagtcaaaaccccaaagagcaa
catccaatcaccaatgctattgacggcaccaatgggtggtggcagagcccaagcataaaa
aatggccgccagttccacttggtgaccatcactctggatttacgacagattttccaggtg
gcctacatcatcatcaaggcagccaactcccctcgtcccggtaactgggtgctggagcgt
tcaatggacggtgtggagttcacaccctggcagtactacgccatcagcgacacagaatgt
ctgacccgctacaacatcaccccccgcttcggaccccccacctacaaacgagacgacgag
gtcatctgtacctcctactactcacgtctcgtacccctggagcacggagagatccacacg
tctttgatcaacgggcggcccagtgctgaccaactgaccccagagctgctagacttcact
tcagcccgctacatccggctgcgcctgcagaggatccgcacgctcaacgccgacctcatg
accctcagctaccgtgaccctaaggaggtggaccccatcgtcaccagacggtactactat
tccatcaaggacatctcagtgggcgggatgtgcatctgttacggccacgcccagagctgc
ccctgggaccccgttgccaagaagttgcagtgtgtgtgtgagcacaatacgtgtggggag
agctgtaatgagtgttgccccggctaccaccaggaaccgtggcaaccgggaaccctctcc
aacggcaacacatgcgagaaatgtaactgccacaacaaggccgaggactgctattacaac
caaactatggacgaccacacgatgagcatgaactcgcctggacacttccaaggcnggggt
gtgtgtatgattgtacccagaacacggccgggtgtcaactgtgagacctgcgcagatggc
ttctacagaccccacgaggaccccctggtcttcctttgtgtccctatgtccccgttacct
gaggacccccccccccctggtcttcctttgtgtccctatggtccccgttacctgaggacc
ccctggtcttcctttgtgtccctatgggccccgttacctgaggaccccctggtctacctt
tgtctgaacccagggcagtgtctgtgtaaagagggttttgtgggtgagcactgtgaacgc
tgtgcctttggctacagggacttccccctgtgttcacgctgtgagtgcagtctggaaggc
agcctcaacatcgacccctgcacagagtgcatctgcaaggagaacgtgatgggggccaac
tgtgacctgtgtaagcagggtttctacaacctggaggaccgtaaccctgagggatgcaca
gagtgtttctgcttcggtgtgtctgacgtgtgtgagagttcaccctggtctttgtttcag
actgttgactccaatggatggctccttcctacccaaagcgtctccatctacacggcaccc
ctcactgatgacgacaacaacctcattgtccccagcatcaccatgatccagtcgtaccgt
tttgtgtctacctgggccgctccggagggcttcctggggaacaggctgacatcatatgga
gggcttttaaactacactgtggcctatgatgtttctgtggacaatgtggacaattctctg
ccatcacagtttgatctgattattgaggggaacgggagaaccctgcgtcagacgcccccc
aagcagctcttcctgacgcccctgcgggagcagcttgtttccgtggagctcctaccgcag
ggcttcgtagacgtacacacaggccagagggttgacagggacgagctgatgactgtattg
gcggacttggctggactgaggatcagaggccacctcaatgccagcgcagagggggcactc
aggttgagcaccgtatctctggacatggcagacatcagggctgctaacccagtccaggcc
cgggacgtggagcagtgtgagtgcccctggggctacttgggcacatcctgtgagttctgt
tcatctggattctatcgcgtcggcgggatcctgttcggaggtaactgtctccagtgtgag
tgtaacgaccacgctacagaatgtgacatcaacggagtctgtctggactgtactcacaat
accactgggccccactgtaaccaatgccttcccggttactatggcgacacctcagagggc
accccagaggactgccagagatgtgcctgcccgctgatagtggcgacgaacaatttcagc
cccacctgtctcctggagggccctggacaggtgacatgtgaccagtgccagcagggctac
actgggactaagtgtgagaggtgtgctaatggttaccatggcgacccgaatgtggcaggc
aaggagtgtgtgctgtgtgagtgtaacggaaacgtggacccctgggacccgggccactgt
gacaccagcagcggtgtgtgtctgaagtgtcacagccacaccagcggagacgactgtgag
aggtgtgaggacggctactatggtgacgccatcactgccaagaactgccaggcttgcagt
tgccatggaaatgggtcatactcggccatgtgtgacctgctcactggacagtgtacctgc
aaacccaacgtagtgggagagaagtgtgaccagtgtcaggtgggcttccacagtcttctc
agtggacaggggtgcagagactgtaactgtagccaatcaggatctgtgtccacagcatgt
gaggaggaggggcggtgccaatgcatcccaggggtggcgggggacaaatgtgaccgatgt
taccatggttacttcaactaccaggacagagggtgtacacagtgtgagtgtgcccacacc
cacggaaactgtaatgcgacgacaggcaagtgtatctgccctccccacaccataggagag
aagtgtgagttgtgtgaggaaggtcactggggtcacgacactgtggcaggttgtaagtca
tgtgattgcagtgaggcgggcagttctgccacccagtgtgacctcaccaatgggcagtgc
ctgtgccgtccggattttgccaggcagaaatgtgaccagtgcaccatgggctacaggggc
tacccagaatgcacggcgtgcaactgcaacatcaacggcaccagagaggagttctgtgat
aaggaactgggcctgtgcagctgtgaggccccagggaactgtgtgtgcaaggacaatgtg
ggcggaggaggctgtgatgagtgtaagaagggatccttcggcctatctggtcctaacccg
gacggctgcagcccctgtttctgtttcggagtctcctcagactgcgaggagctcggtggg
atggtccgtgtaccgatcacactggggtctgacccagagctgctgcatgtggtcagtcag
cgtgacccccagggcagtgtggaaggggtctactaccaggcctcagacatgctgctggac
accagggagaaagaaaacatcacactgcctggaccctactactggaggcttcccaaacac
taccagggaaataagttgttgtcgtatggagggaagctgtcctacatggtggcgttctat
gctctggacggggccggcctggccaactacgagcctcaggtcctgatgagggggggtcat
ctgggaaagaaggtcatctacatcgatatgcctgcccctgacaacagggtcaaaacacgt
caggacgtcccactgacggagcacaagtggaagtatttcaactctgtgtcagagaaagct
gtgagtcactccgatttcttggcggtcctgagcaatatcgagtacatcaccatcaaggcc
tcgtatggtacagggttgcagcagagcagaatctccaatatcaccatggatacggcccta
gaggcagaggaggggtcagagggtttggaggtggcatgtctgatagagacctgcgagtgt
ccagctggctacgctggactgtcctgccaggagtgttcccccggctactaccgccaacca
gtgactgatctgaacctgcgggggaagagacccctgatccagccctgcgtgccctgccag
tgtaacaaccacagccaggcctgtgatctggacacgggagaatgtctgggctgccagcac
aacacagcaggcgagcactgtaacgtgtgtggctctgggtactatgggaacgtgaaaggc
tccgtcagtgactgctctctgtgtgcctgccccctcaaagagaacagcttcagtcctacc
tgtgcaatggagggagtgatgggagacttccgctgtaatgcctgcaagcctggttatgag
ggacgctactgtgagaggtgttcagtgggttactatgggaacccgtctggtccaggaggg
aagtgtgaggcgtgtcagtgtagtactgcaggttctctccatctggtgtgtgactctctg
aagggccagtgtgaatgtaaggccggtgtccggggacatttgtgtgaccagtgcgaggcg
agacacgtcctggacggggaccagtgtgtctcatgtgatgatgagtgtacgggggtcctc
ctggatgacctggatgcattagagagctccttcctgtctgtcaacctgaccggtgtcatc
ctgtccccctacagcacactggttagcctggagaacgacacacgagaggtcaagaatctg
atgtcttgggaaagtagcccagcatatcacctgaacagggtggaggaggacttgacaaat
ctcacccaggacatagacggactgctacggcaggctacagggctgtctgctgatggagag
gaagtggctcagtccacagagaacagcgttacccagggggccaagtttctggagtacatc
atcaccattcacactgccatacaagtcctggcggaggaagctgccggtctgaacaggaca
gagaacgtggagaaggacgaggctaacagcacacgtctatgggagcaggtggcagccatg
ttggaaaccatcaaattagtcaacctatcccaggccaatgccagcgtctctacagaactc
agtgctaccgaggctctcctccagagggtgctggaggaccttctggagccccagggggcg
atagagtcccagaccctcaacatctctaacacactgactgaacaccaccaacagctagag
gatgcccatgccctactgatgactgccagggagaacaacaaccacacacacaccctgctg
gggagcatctacaccaacctgccagagtaccagggtctgaagcagaatgtgagccggctg
aaccagacagcagaaacccaactagaggagactcaggacatcctggctgatgctgtcaat
ctagcagaggacatgagcaacgtcacctctttgaggcagctggagcagtggaaccccatg
ttgaggaagcatgtggacactctggtgatggagctgaggaagaaagatgctctggagctg
gtctacaaggctgaggaccacgcccgggaacttagcaagaaggcccagggtctgcagagc
tctctagtggaggtgatgaataccactctgaacgccaccagcgcagagcatggcgactct
aacatcagagctaacgtccagcctgcagaggagatggctaacctagccaacctgaccgct
actatggccctcaatatgattgtccagccagaggagtctttcactgatctgggatctgag
gctgtgcagcgtagtgagaagattctggccgaaagtctaaccctgagaaacagcactgag
ggtctcgtggctaacatcagtgatgtgacagatagaatagccttgctgaaagagaaactc
tgtaacaccagccgtctcatcccagagcaaggcgccctgctccacagcctgcccaacggc
accagtgagcaggtgctggacgccaaggagcaggctgccttggccaacacttccctacag
agggcgctggagcgcctggaggagcttcgggtcagactggagaagtccagcacggctgtg
gcccagaccagaaccagcatctccaacaccaaccagctgttctccgactcacaatccact
gccagtacagctgagtctaagctgaaggaggcagagagtcgtacagagagactgtatgac
cgtctcaaacccctcaagaccctgggggagaacctgagcagaaacctgtctgagatcaga
gagatgatcaaccaggcccgcaaacaggctgcctctatcaaggtggcagtgctggcagac
aaaaactgtgtgagggcctacacacctgaggtatcctccagtaacttcaacactcttacc
atgaccgtcaagaccagcgagcctgacaacctgctcttctacatgggcagcagctccagc
gtagacttcatggcggtggagatgcagcatggcaaggtggcgtatctgtgggacacgggt
tcaggccacgccaagctggagtaccccgacgtccagatcaacaacaacaagtggcaccac
atcaacgccacacgctttgggaggcacggcacactgtcagtccaccagctggagtctgaa
cccctgcccgcggtcaagaccacctcaccaggctccgctacgatcctggaagtcaacaag
tccaccctgatattcgttggtggcctgggaggccagatcaagtcctctgtggtgaaaatg
acccagtttaagggctgtatgggggaggcgtcgctcaacgagaagaacatcgggctgtgg
aactacgctgagagggagggccagtgtcgcggctgcttcatgagtccgcagacggaggag
acgtccttccactttgatggcagtggctactcagtggtagagaaacccctccgttccacc
tccacttccatcgtcatgctgttcaagaccctctcccccaacggcctgctgctctacctg
gcctccaacggcacgagggacttcctgtccattgagctggtggagggccaagtgcgtctg
acctttgaactgggctctggcccgctgaccctcacctccaacaaagcctacaacaccggc
agctggtacaagatcaccctgcagaggaacaaacgcaaagtttatatggcggtgatggcg
gcagacaactcatcagagaaagagatcatggaggcggagtctcctgggaccgcctccgac
ctcaaccgctccgacctggacccaatctacatcgggggactgcccatgtctcgccctatc
aggagacaagtagtagcacggtcctatgtgggctgcatcaaaaacatggagattgcccgc
tccaactttgacctgctccgagactcctatggtgtcaagaaaggctgtgtgctagagccc
atccgcagtgtgtctgtactgagagagggctatgtggagttgccgtctgtgtctctcgac
ccccagggggagctgttggcctccttctctacccgcaatgacactggcataatcctggca
ggcttcagcaaggcaggcacccgcaaaagcagacaggctcgccagcccttcctggcagtc
atgctgatttcggggcgcttggaggttcatgtcaacatggcagagggcgggagcgtccac
aaggttgtggtcaaatcacgctctgggagtttcagtgacggacaggagcactcggtcatc
ttgcagaggaacaggaagatgctggttgtactagtggatgaggaccaccaggagatggta
cgtctgtcctcggagaaggcctctctgaccctcacctctctgtacatgggcggagtccca
ccaggagagggcgccgggcagctccgaaccacctcctccttctacggctgcatcaggaac
ctggccctggactccaagttgttggacctgtcagctgctgtgaggtaccgcaacgtggac
atggacagctgtctattggaggagaggcctaaaagggtcctcctacctgatgacactgac
ctagatgccgagcccactccggaccctgccagaaccccttcaccaccccccggccagctc
agcgcgctcacccccggcacactcacgtgtgcatcgatggacaacacctcatccatccca
gaagcccagcagtttggcatctccagacacagtcacatggtcctcagcatcaaccccaac
acagtgaggaggagtttctctctggagctgtcagtgcgtacctatacccagagtggtttg
atctactacatggcccacgccaaccagatggactacgccactctgcagctgctgggagga
catctgttcttcacctgtgacaagggcagcggccccgccaccgccaccttccctgtgccc
gtcaacgacggccagtggcacacagtgaagacggacttcaataagaagagtgtggttctc
agtgtcgacggccagccgtcaactccagtgccggctaaaggaaacactctggatgtggag
aacaagctgtatctgggaggacttccccagacctacaccgccaagaagataggcaatgtg
acccatagtttggcaggctgcatccagaaggtgttgctgaacagtgttaagttgaacacc
cagagtccagtgtctgaacaatccactgcgtactgcttcaccgcagcccaggacgggacc
ttcttcaatgggagcggatacgctgctctgataaagaatgggtacaaagtgggctcagat
atggaggtgtctctggagttccgcagcacagtgtcagatggagtcctccttggggtcagc
agtgccaaggtggacgccatcgggctggagctagccaacggacaggcggtgttccacgtg
aacaacggtgccgggcgggtgtcggccacttcgcggctgggctggtggctgtgtgacggt
ctctggcacaccctgctggcaaagaagaccaagaacgctctgagtctgaccgtggacgga
gtcacggtgctcaccgacaacccccacccccagtccacctcggctgagaccaaggacccg
gtctacgtgggaggcttccctgtcggcgtgaaacagaactgcctgacatccagaatgccg
ttccgtggttgtatgcgtaacatccgcttgatcaagggtcacatgaccaacatcctggac
ttcagtactgccttcaccctccatggagtgtcaccccactcctgccctagcaccgccaca
taa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112228464
Entry
112228464         CDS       T05605                                 

Definition
(RefSeq) thrombospondin-3a-like
  KO
K04659  thrombospondin 2/3/4/5
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04145  Phagosome
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112228464
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    112228464
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112228464
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112228464
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112228464
   00536 Glycosaminoglycan binding proteins [BR:otw00536]
    112228464
   04990 Domain-containing proteins not elsewhere classified [BR:otw04990]
    112228464
Membrane trafficking [BR:otw04131]
 Endocytosis
  Phagocytosis
   Opsonins
    112228464
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   112228464
  Exosomal proteins of colorectal cancer cells
   112228464
  Exosomal proteins of bladder cancer cells
   112228464
Glycosaminoglycan binding proteins [BR:otw00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   112228464
Domain-containing proteins not elsewhere classified [BR:otw04990]
 Thrombospondin domain-containing proteins
  Thrombospondins
   112228464
SSDB
Motif
Pfam: TSP_C TSP_3 COMP EGF_CA cEGF EGF_MSP1_1 EGF_3
Other DBs
NCBI-GeneID: 112228464
NCBI-ProteinID: XP_024249571
LinkDB
Position
3
AA seq 955 aa
MGARRDVPTFLALSTFLFVATCEPMDQNDMQVIDMLTLDSKTSVSAVEKVTGAMSVFSDI
YIVSTFRLPPKMGGVLLGLYSKEENKKYLELAIMGKINKALVRYVREDGKLHTVNLQSTN
LADGRTHSIILRIGGLRRDNLHLELYVNCRLADSSQGLPPLVPLPAEKVEIRNGFKAYAR
LQGAVESLKIALGGSVAKAGTLTDCPFQGDSSVYSTVGTTAEVNSILGDHTKALIGQLII
FNQILGELREDIREQVKEMSLIRNTILECQVCGFHDPRSRCSPNPCFKGLSCMETSDYPG
YRCSPCPEGMTGNGTHCQDIDECSIAQPCYSPGACINTVKGFSCELCPPGLWGPPLFGVG
LEYANHHKQECADIDECIEVANACVPHSMCTNTIGSFRCGGCKVGYLGNQTVGCVPRRSC
ATLSFNPCDANAHCIIERNGEVSCACNIGWAGNGNTCGTDTDIDGYPDRSLPCMDNDKHC
KQDNCVYTPNSGQEDADNDGIGDQCDEDADGDGIKNVEDNCRLEPNKDQQNSDTDSFGDA
CDNCPNVPNIDQRDTDSNGQGDACDNDIDGDGIPNVLDNCPKVPNPMQTDRDGDGVGDAC
DSCPEISNPMQTDIDNDLVGDVCDTDQDTDGDGHQDSRDNCPDHPNSSQLDSDNDGLGDD
CDDDDDNDGFPDVQDNCRLITNPNQKDSNSNGVGDVCENDFDNDSVWDLIDVCPESSEVT
LTDFRAYQTVILDPEGDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFNGVDFEGTFH
INTVTDDDYAGFIFGYQDSSSFYVVMWKQTEQTYWQSTPFRAMAQPGLQLKAVKSRTGPG
EYLRNALWHTGDTNEEVKLLWSDPRNVGWRDKTSYRWQLSHRPQVGYIRVKLYEGTEMVA
DSGVVIDTTMRGGRLGVFCFSQENIIWSNLRYRCNDTVPDDFNPYRKQVLLHIKV
NT seq 2868 nt   +upstreamnt  +downstreamnt
atgggtgcgaggcgcgatgtgccaacttttctggctctatccacatttctattcgttgca
acatgtgagccaatggaccagaacgatatgcaagtcattgacatgctaaccctggactcc
aagaccagtgtgtctgcggtggagaaggtgacaggtgccatgagtgtgttcagtgacatc
tacatcgtgtccacattccgcttgcctcccaagatgggaggggtgctgctgggcctctac
agcaaagaggagaacaagaagtacctggagctggccatcatgggaaagatcaacaaagct
ctggtgcgttacgtgagggaggatggcaaacttcacacagtgaacctccagagcacaaac
ctggctgatggtcgcacacactccattattctccggatcggaggcctgcgcagagacaac
ctacacctggagctctacgtcaattgtcgattggctgactccagccagggcctccctcca
ttggtccctctccccgcggagaaggtggagattcgtaatggcttcaaggcctacgcaagg
ctacagggtgctgtggagtccctcaaaattgcactagggggcagtgtggccaaagcaggg
accctgacagactgtccattccagggggattcatcagtctacagcacagtcggtacgact
gcagaagtgaactccattctaggagaccacacaaaggctctgattggtcagctgatcatc
tttaaccagatcctaggagagctgcgagaggacatcagagagcaggtgaaggagatgtcc
ctgattaggaacaccattctggagtgccaagtgtgtggcttccacgaccctcgttcccgc
tgctcccccaacccctgttttaagggcctgtcctgcatggagacctctgactacccaggg
taccgctgtagtccctgtccggagggcatgacgggcaacggaacccactgccaagacatt
gacgagtgttccatagcccagccctgctactctccaggtgcgtgtataaacacagtgaag
ggtttcagctgtgagctctgcccccctggtctctggggcccacccctctttggggtcgga
ctggagtacgccaaccaccacaaacaggagtgtgcagacatcgatgagtgtattgaagtt
gccaacgcctgtgtgccccactccatgtgtaccaacaccatcggctcgttcaggtgtggt
ggctgtaaggtgggttacttggggaaccagacagtgggctgcgtgccccgtaggtcctgt
gccacactcagctttaacccttgtgatgcgaacgcccactgcattatagagaggaacgga
gaggtgtcctgtgcgtgcaacattggctgggccggtaacgggaacacttgtggcacagac
acagacattgatggatacccagaccgctctctgccctgtatggacaatgacaagcactgt
aaacaggacaactgtgtttacacacccaactcaggccaggaggacgcagacaacgacggc
atcggagaccagtgtgacgaggacgcagatggggacggcatcaagaatgtggaggataac
tgtcgactagaacccaacaaagatcagcagaactcagacacagactctttcggtgacgcc
tgtgacaactgtcccaatgtccctaacattgaccagagggatacagacagcaacgggcaa
ggagacgcctgtgacaatgacatagatggagatggtatccccaacgtgctagacaactgc
cccaaagtccccaaccccatgcagacagacagggatggagacggggtaggagacgcctgc
gacagctgccctgagatcagcaaccccatgcagacggacattgacaatgacctggtgggg
gatgtgtgtgacactgaccaggacacggatggggacggtcaccaggattccagggacaac
tgccctgaccatcccaacagctcccagctggactcggacaatgatggccttggggacgac
tgtgatgatgacgatgacaatgacggattcccagacgtacaagacaactgcagactcatc
accaatcccaaccagaaagattctaacagtaacggggtgggcgacgtgtgtgagaacgac
tttgacaatgattcagtctgggatctgattgatgtgtgccctgagagttcagaggtcaca
ctgacagacttcagagcctatcagacagtcattctggatccagagggcgatgcccagatc
gatcccaattgggtggtgctcaatcagggcatggaaatagttcagaccatgaacagtgat
cctggtttagctgtgggctacacagcgttcaacggggtggactttgagggcaccttccac
atcaacacggtgacggacgacgactatgcaggcttcatcttcggctaccaggactcctct
tccttctacgtggtgatgtggaaacagacagagcagacctactggcagtcgacacccttc
agggccatggcccaacctggcctgcagctcaaagcagtgaagtcccgtacagggcctggt
gagtacctgcgtaacgccctgtggcacacaggggacaccaacgaggaggtgaagctgctg
tggtcggacccacggaacgttggctggagagacaagacatcttaccgctggcagctcagc
cacaggccccaggtgggctacatcagggtgaagttatatgaggggacggagatggtggct
gactctggcgtggtgattgacactaccatgagaggcggacgactgggggtcttctgtttc
tcccaagagaacatcatctggtccaacctgcgctaccgctgcaacgacactgttccagac
gacttcaacccatatcgcaaacaggttctgctgcacatcaaggtgtga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112229484
Entry
112229484         CDS       T05605                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: collagen alpha-2(I) chain-like
  KO
K06236  collagen type I alpha
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112229484
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112229484
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:otw00536]
    112229484
Glycosaminoglycan binding proteins [BR:otw00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   112229484
SSDB
Motif
Pfam: Collagen COLFI
Other DBs
NCBI-GeneID: 112229484
NCBI-ProteinID: XP_024251118
LinkDB
Position
31
AA seq 1358 aa
MLSFVDNRILLLLAVTSLLASCQSGGLKGPRGAKGPRGDRGPQGPNGRDGKAGLPGIAGP
PGPPGLGGNFAAQFDGGKGIDPGPGPMGLMGSRGPNGPPGSPGPQGFTGHAGEPGEPGQT
GSIGARGPTGSAGKPGEDGNNGRPGKPGDRGGPGTQGARGFPGTPGLPGMKGHRGYNGLD
GRKGESGTAGAKGETGAHGANGTPGPAGSRGLNGERGRAGPAGPAGARGADGSTGPAGPA
GPLGAAGPPGFPGAPGPKGEIGGAGSNGPSGPQGGRGEPGINGAVGPVGPVGNPGNNGIN
GAKGAAGLPGVAGAPGFPGPRGGPGPQGPQGSTGARGLGGDPGPSGQKGDSGAKGEPGHS
GVQGAAGPAGEEGKRGSTGEAGATGPAGLRGARGGAGTRGLPGLEGRGGPIGMPGARGAT
GPGGIRGAPGDAGRAGESGLTGARGLPGNSGQGGPPGKEGPSGAAGLDGRTGPPGPTGPR
GQPGNIGFPGPKGPGGEAGKGGDKGPTGATGLRGGPGADGNNGAPGPLESLXVGNAGEKG
EQGPSGAPXFPGSTCPAGPAGEXGKAGNQGMPGDQGLPGPAGVKGERGNSGPAGSAGSQG
AIGARGPAGTPGPDGGKGEPGSVGIVGAAGHQGPGGMPGERGAGGTPGPKGEKGEGGHRG
LEGNMGRDGARGGPGPSGPPGPSGANGEKGESGSFGPAGPAGLRGPSGERGEGGPAGPPG
FAGPPGSDGQSGSRGEKGPAGGKGDVGPAGPAGPSGQSGPSGASGPAGPPGGRGDAGPSG
LTGFPGAAGRVGGPGPAGIAGPPGSAGPAGKDGPRGLRGDPGPGGPQGEQGVVGPAGITG
DKGPSGESGPPGAPGTAGPQGVLGPSGFVGLPGSRGDKGLPGGPGAVGEPGRLGPAGASG
PRGPSGNIGMPGMTGTQGEAGREGNPGNDGPPGRPGAAGFKGDRGEPGSPGALGSSGQPG
PNGPAGSAGRPGNRGESGPTGNGGPVGAAGARGAPGPAGPRGEKGGAGEKGDRGMKGLRG
HGGLQGMPGPNGPSGETGSAGITGPAGPRGPAGPHGPPGKDGRAGGHGAIGPVGHRGSPG
HLGPAGPPGSPGLPGPAGPAGGGYDQSGGYDEYRADQPSLRAKDYEVDATIKSLNSQIEN
LLTPEGSKKNPARTCRDIRLSHPEWSSGFYWIDPNQGCIADAIKAYCDFSTGHTCIHPHP
ESIARKNWYRSSENKKHVWFGETINGGTEFAYNDETLSPQSMATQLAFMRLLANQATQNI
TYHCKNSVAYMDGENGNLKKAVLLQGSNDVELRAEGNSRFTFNVLEDGCTRHTGQWSKTV
IEYRTNKPSRLPILDIAPLDIGEADQEFGLDIGPVCFK
NT seq 4077 nt   +upstreamnt  +downstreamnt
atgctcagctttgtggataaccggattctgttgctgcttgcagtaacttcattgctagca
tcatgccaatcggggggactcaagggcccaagaggagctaaggggcctcgaggtgacagg
ggtccccaaggtcctaatggaagagatggtaaagctggactccccggcattgccggcccc
cctggtccccctggacttggaggaaactttgctgctcagtttgatggaggaaagggcatt
gaccccggacctggaccaatgggtttaatgggatctagaggacccaacggacctcccgga
tcccctggaccccaaggattcacaggacacgctggagagcctggagagcccggacagact
ggctccattggtgctcgtggacccactggatccgctggcaaacctggtgaggatggtaac
aacggcagacctggcaagcctggtgacagaggtggccccggaactcagggtgctcgtgga
ttccccggaactcctggacttcctggaatgaagggacacagaggttacaatggtctggat
gggcgcaagggagagtctggtactgctggtgccaagggtgagacaggtgcccatggagct
aacggaacccccggaccagctggttctcgtggtctgaatggtgagagagggcgtgccggc
cctgctggaccagctggtgcccgtggtgctgatggaagcactggacccgccggccctgct
ggtcctcttggagcagctggcccccctggtttccctggtgcccctggccccaagggagag
attggaggtgctggatccaatggcccatccggacctcagggaggcagaggagagcccggt
atcaatggagcagttggccccgtcggtcccgttggtaaccctggtaacaacggtatcaac
ggtgccaagggagctgctggtctccccggtgttgctggagcccctggtttccctggccca
agaggaggtcccggcccccagggcccccaaggatccactggagctagaggccttggtggt
gaccctggaccctctggacaaaagggagattctggtgctaagggagagcctggtcactct
ggtgtccagggtgccgctggtcctgctggtgaggagggcaagagaggctcaactggcgag
gctggtgccaccgggcccgctggtctgcgtggagctagaggaggtgctggaactcgtggt
ctgcctggtctggagggaagaggtggtcccattggtatgcccggagctcgtggagccacc
ggccctggtggtatccgtggagcccctggtgatgccggtcgtgctggcgagtctggtctg
actggagccagaggcctccctggaaactctggacagggtggacccccaggcaaagaaggc
ccatctggtgctgctggtctggatggccgcactggtccccctggcccaactggacccaga
ggccagcccggtaacatcggattccccggccccaagggacctggaggtgaggctggcaag
ggtggtgataagggacctactggtgcaactggtctgagaggcggccccggtgctgatggc
aacaatggagctcccggcccactggagtcgttgtaagtaggtaacgctggtgagaaggga
gagcagggaccctctggtgcaccanngtttccagggtctacctgccctgctggacctgcc
ggtgagncaggcaaagctggcaaccaaggtatgcccggagaccagggactcccaggaccc
gctggtgtcaagggagagcgtggaaactctggtcctgctggttctgccggatctcaggga
gccatcggtgctcgtggacctgctggaactcctggccccgatggtggcaagggagagcct
ggttctgtcggcattgttggtgccgccggacaccaaggacccggtggtatgcccggtgag
cgcggtgctggtggtactcccggacccaagggtgagaagggtgagggcggacacagagga
cttgagggtaacatgggaagagacggcgcccgtggtggtcccggaccaagtggaccccct
ggaccttccggtgctaatggtgaaaagggtgagtctggctccttcggccctgccggacct
gctggtcttcgtggacccagtggagagcgtggagagggtggacctgctgggcctcccggc
ttcgccggaccccctggttctgatggtcagtctggctctagaggagagaagggacccgct
ggtggaaagggagatgtcggccccgccggccctgctggaccttctggccaatctggacct
tctggtgctagcggacccgctggtcctcctggtggtcgtggtgatgctggaccttctggt
ctgaccggtttccctggtgctgccggtagagttggaggccccggtcccgctggtattgct
gggccccctggctccgctggtcccgctggcaaggatggccctcgtggtctccgtggtgat
cctggccccggtggacctcagggagagcagggagttgttggacccgctggtatcactgga
gacaagggacccagtggagagagcggtcctcccggtgctcctggtaccgctggaccccaa
ggtgtgctcggaccctctggcttcgttggtctgcctggttcccgtggtgacaagggtctt
cctggcggtcctggtgctgtgggtgagcctggtagacttggacccgctggtgcctctgga
ccccgtggtccctctggtaacattggcatgcccggtatgactggtactcagggagaagct
ggacgtgagggtaaccctggcaacgatggacctcccggtcgtcccggagctgctggtttc
aagggtgaccgtggtgagcctggttctcctggagcccttggaagctctggtcaacctgga
cccaacggacccgctggctccgctggcagacctggaaaccgtggagagtctggccccact
ggaaatggtggtcccgtcggtgctgctggtgcccgtggtgcccccggccccgctggtccc
cgtggagagaagggtggcgctggagagaagggagacagaggcatgaagggtctgcgtgga
catggtggtctccagggaatgcccggacctaatggaccatctggtgagactggctctgct
ggtatcactggacctgctggacccagaggccccgccggaccccatggtccccctggtaag
gatggtagagctggaggtcatggtgctatcggacctgttggacaccgtggttcccctgga
catcttggacctgctggtccccccggctctcctggtcttcccggacccgcaggtcccgct
ggtggtggatacgaccagtctggtggatacgatgagtacagagccgaccagccctctctc
agggccaaggactacgaggtggacgccaccatcaagtccctgaactcccagatcgagaac
ctgctcacccccgagggctccaagaagaaccccgcccgtacctgcagagacatccgcctc
agccaccccgaatggagcagcggtttctactggatcgaccccaaccagggctgcatcgct
gacgccatcaaggcctactgcgacttctccaccggacacacctgcatccaccctcacccc
gagagcatcgcccgcaagaactggtacaggagctctgagaacaagaagcacgtctggttc
ggcgagaccattaacggtggtactgagtttgcttacaacgacgagaccctgagccctcag
agcatggccacacaactggccttcatgcgtctcctggccaaccaggccacccagaacatc
acataccactgcaagaacagcgtggcgtacatggacggagagaacggcaacctgaagaag
gctgtgctcctgcagggttccaacgacgtggagctgagggccgagggcaacagccgcttc
actttcaacgttctggaggatggctgcactagacacactggccaatggagcaagacagtc
attgaatacagaacaaataaaccatctcgcctgcccatcctcgacattgcacctttggac
attggtgaagctgatcaagagtttggtttggacattggcccagtctgtttcaaataa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112229692
Entry
112229692         CDS       T05605                                 

Definition
(RefSeq) thrombospondin-3b-like
  KO
K04659  thrombospondin 2/3/4/5
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04145  Phagosome
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112229692
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    112229692
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112229692
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112229692
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112229692
   00536 Glycosaminoglycan binding proteins [BR:otw00536]
    112229692
   04990 Domain-containing proteins not elsewhere classified [BR:otw04990]
    112229692
Membrane trafficking [BR:otw04131]
 Endocytosis
  Phagocytosis
   Opsonins
    112229692
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   112229692
  Exosomal proteins of colorectal cancer cells
   112229692
  Exosomal proteins of bladder cancer cells
   112229692
Glycosaminoglycan binding proteins [BR:otw00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   112229692
Domain-containing proteins not elsewhere classified [BR:otw04990]
 Thrombospondin domain-containing proteins
  Thrombospondins
   112229692
SSDB
Motif
Pfam: TSP_C TSP_3 COMP EGF_CA cEGF EGF_3 EGF_MSP1_1
Other DBs
NCBI-GeneID: 112229692
NCBI-ProteinID: XP_024251431
LinkDB
Position
31
AA seq 955 aa
MDMVRFVLNLLLASAAVLLGLTRASEMQVIDMLELHDARQSASAVGKMSGALGFVSDLYL
VSTLRLPPKLGGVLLGVYNKGDNRKYLEVALMGKVNKVLVRYVRKDGKLHTVNLQNPGLS
DGRTQSLILRVGGLQRNHLHMELYVNCRLADSAQVLPSMVQLPAEAESVEIRNGQKAYAR
LQGSVDSLKLALGGSIAKAGILTDCPFQGDTHFPNSVSADVNAILGDHTKALIGQLIIFN
QILGELREDIREQVKEMSLIRNTILECQVCGFHETHSRCEPNPCYKGLACTETREYPGYR
CGACPDGMTGNGTHCQDIDECALARPCFSPEGCVNTAKGFTCEPCPVGFSGPLLSGLGVE
FAKSHKQKCRDVDECAVLYKACVPNSVCINTEGSFRCGPCKESFVGNQTVGCFLRRSCAT
LGFNPCDVNAHCVIKGAARVSCECNVGWAGNGHTCGPDTDIDGYPDQPLPCIDNDYHCRA
DNCVNTPNSGQEDADGDGIGDQCDEDADGDGIKNVEDNCRLVPNKDQQNSDTDSYGDTCD
NCPNVPNGSQKDTDGNGAGDTCDNDIDGDGIPNVLDNCPKVPNPMQTDRDGDRVGDACDS
CPEVNDPMQSDTDNDLVGDVCDTNQDMDGDGHQDSRDNCPDVPNSSQLDSDNDGIGNECD
DDDDNDGIPDARPPGPDNCRLIPNPSQTDTNGNGIGDMCENDFDNDSVIDLIDVCPESAE
VTMTDFRNYQTVILDPEGDAQIEPKWIVLNRGMEIVQTMNSDPGLAIGYTAFNGVDFEGT
FHINTATDDDYVGFIFGYQDSSSFYVVMWKQTEQTYWQSLPFRAMAQPGLQLKAVKSRTG
PGEYLRNALWHTGDTPGEVTLLWKDPRNVGWRDKTSYRWHLSHRPQMGYIKVRLYEGMTL
VADSGVLVDTSMRGGRLGVFCFSQEQIIWSNLGYRCNDTVPEDYEFYRKQIHIRV
NT seq 2868 nt   +upstreamnt  +downstreamnt
atggatatggtgaggtttgtgctaaatttgctgcttgcgagcgcggcggttctgttgggc
ttgaccagggcttcagaaatgcaagtgattgacatgctggagctgcacgatgccaggcag
agtgcgtccgcggtggggaagatgtcgggggctctgggcttcgtgtcggacctttacctg
gtgtcaactcttcgtctgccgcccaaactgggaggagtgctgttgggagtctacaacaaa
ggcgacaacaggaagtacctggaggtggccctcatgggcaaggtcaacaaagttctggtg
cgctacgtacgcaaggatggtaaactccacacagtgaacctccagaaccccggcctctct
gatggacgcacccagtcactcatcctccgtgtgggtgggctccaacgaaaccacctccac
atggaactctatgtcaactgccgattggctgactcagcacaggtcctgccttccatggtc
cagctcccagccgaggcagagtctgtggagatacgcaacgggcagaaggcctatgccagg
ctacagggctcagtggactctttgaaactggctttgggtggctctatagccaaagcagga
atccttaccgactgtccatttcagggagatacacattttccgaattcagttagcgccgat
gtcaatgccattctgggtgaccacaccaaggctttgattggccagctgatcatcttcaac
cagattcttggcgaactccgagaggacatcagggaacaggtaaaggagatgtctctgatt
aggaacactatcctggagtgccaagtgtgtggcttccacgagacccactctcgctgcgag
cccaacccttgctataagggcttggcctgtacagagaccagggagtacccagggtaccgt
tgtggtgcctgcccagacggcatgacggggaatggcacccactgccaggacattgacgag
tgtgctctagcccggccctgtttctcgcccgagggttgcgtaaacacggcaaagggcttc
acctgtgaaccatgtcccgtcggcttctccggacccctccttagcgggcttggggtggag
tttgccaaaagccacaagcagaagtgcagagatgtggatgagtgtgctgtcctctacaag
gcctgtgtgccgaactctgtctgcatcaacacagagggctcgttcaggtgtggtccgtgt
aaggagagcttcgtaggcaaccagacggtgggctgtttcctacggaggtcctgcgccacg
ctgggcttcaacccctgtgacgtcaacgcccactgtgtcataaagggtgctgccagggtc
tcctgcgagtgtaatgtgggctgggcaggtaatgggcatacatgtggcccagacacagac
attgatggctaccccgaccaacctctcccctgcatagacaatgactatcactgccgagcc
gacaactgtgtgaacacgcccaactctggccaggaggacgcagacggagacggtataggt
gaccagtgtgatgaggatgcggacggagacggcatcaagaacgtggaggacaactgccgt
ctggtccccaacaaagatcaacagaactcggacacagactcgtatggggacacgtgtgac
aactgccccaacgttcccaacggaagccagaaggacacagatggaaacggggctggggat
acctgtgacaatgacattgatggggatggtatcccaaacgtgctggacaactgtcccaag
gtgcccaaccctatgcagactgaccgtgatggggatcgagtgggggacgcttgtgacagc
tgcccggaagtcaacgaccccatgcagtctgatacagacaacgacctggtgggagatgtg
tgtgacaccaaccaggacatggatggggacggccaccaggattcaagggacaactgtcca
gacgtccctaacagctcccagctggactcagacaatgacggcatcggcaacgaatgcgac
gatgacgacgacaacgatggcattccagatgcgagacctcccgggccggataactgtcgt
ctcatccctaaccccagccagacagacactaatggaaatggcattggtgacatgtgcgag
aatgactttgacaacgactccgtgatagacttgattgacgtgtgtccagagagcgctgaa
gtcacaatgaccgacttcagaaactatcagacggtcatcctggacccggagggcgatgcc
caaatcgaacccaagtggattgtgctcaatcggggtatggaaattgttcaaaccatgaac
agtgaccctggtttggccataggctacacagcctttaacggggtagactttgaagggaca
ttccacatcaacacggccacagacgatgactatgtgggcttcatcttcggttaccaggac
tcgtccagcttctacgtggtcatgtggaaacagacggagcagacctactggcagtcgctg
ccttttagggccatggcccagccaggcctgcaactaaaggcagtgaagtcacgtacaggt
ccaggcgagtacctccggaacgccctgtggcacacgggcgacaccccgggcgaggtcacc
ctgctgtggaaggacccccggaatgtgggctggagggacaagacatcctaccgctggcac
ctcagccaccgcccgcagatgggctacatcaaagtgaggctgtatgaaggcatgacattg
gtggcagactcgggcgtgctggtggacacctcaatgaggggcgggaggctgggcgtcttc
tgcttctcccaggagcaaatcatctggtccaacctgggctatcgctgcaacgatactgta
ccagaggactatgagttctaccgcaagcagatccacatcagggtgtga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112229790
Entry
112229790         CDS       T05605                                 

Definition
(RefSeq) tenascin-X-like
  KO
K06252  tenascin
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112229790
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112229790
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:otw00536]
    112229790
Glycosaminoglycan binding proteins [BR:otw00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   112229790
SSDB
Motif
Pfam: Fibrinogen_C fn3 EGF_Tenascin EGF_2 hEGF EGF
Other DBs
NCBI-GeneID: 112229790
NCBI-ProteinID: XP_024251607
LinkDB
Position
31
AA seq 1173 aa
MPLVPSFLILLLTCPALLTPSASQDLQPGGQRAPRDTKPEGGGQPIKVVISEACVQGDSS
QTQGKELDLEPGSALVLTHRIRLVPGSCAGGCEAEFAALRDRLERLEKEVSTLREKCGGP
EGGCCTSQQSKGAECSIKPEGDECPNECSDQGRCEDGKCVCFPGFSGPDCSLSDCPGNCN
DKGKCVNGQCVCDPGFTGPDCSSESCPGNCNNKGRCVNGQCVCDSGFTGPDCSSESCPGN
CNNKGRCVNGQCVCDSGFTGPDCSSESCPGNCNNKGRCVNGQCVCDSGFTGPDCSTKACP
GNCNNKGRCVNGQCVCDSGFTGPDCSSESCPGNCNNKGRCVNGQCVCDPGFTGPDCSTKA
CPGNCKNGGKCVNGKCVCDSSFTGPDCSTKSCPGNCSNRGKCVNGQCVCDSGFTGPDCSA
KACPNNCSNKGRCVNGKCVCEVGFSGQDCAAKGCPNNCSNKGRCVKGRCVCRRGFAPPDC
SQCEAGFTGADCGTAMSGVSQLNTKDITESSVTLYWTPPPVQYDTYHVTFTSQKEGDQQI
TSQVGGKLTTYTQTGLAAGQEYTVTIKGEINRRMGTESTVEFTTLISGPTNLRVVKTTTT
SAVVQWEQSQGHVDRYRLTVAPNQTDGTAKGRQDLTLPPERDSAQIDGLDPGHLYDITLV
AEKGGIKSKPATVQVTPGPEPPSGLVFSEVTETSFSVSWTKPKGPVSGFKVTYTNTQEGE
PLSATVDSGDSTLALSKLSPGSSYEVSVISVLGLDESDAIKDLVMTLPDPPRDLRAINVT
DTKALLLWRPALAPVDHYVIVYGSEKGSDDAKITVSGNAAEQQLKGLQGSTRYTVTVTSQ
LGNLDSSAAITVFTTTGGSRGDGEVPRDLKASQVTPRSALLTWKAPSAAVGSYKLTYQTE
GQEIKEVTIDSTVTEFKLTRLHPMSKYTVHLQGERGGSYTATISTEFTTGNLRYPFPSDC
SQELLNGIHESGEVEIFPRGRQGKPVLVYCDQVTDGGGWTVFQRRMDGKTDFFRGWKNYS
KGFGELSGEFWLGNENLHNLTSMAPMTLRVDLRAGDESVFAKYSAFTVDTVRRNYALKVS
GYSGTAGDSMSYHNARMFSTRDRDPTPFITRCAMSYRGGWWYKNCHEANLNGLYDTSVNH
QGVIWTAWKGKDLSIPFTEMKLRPTSFTPPTQG
NT seq 3522 nt   +upstreamnt  +downstreamnt
atgcctcttgtcccatccttcctcatcctgctcctcacctgccctgccctcctgacccca
tcagcttcccaggacctgcagcctgggggtcaaagggcacccagggacacaaagccagaa
ggtggcgggcagccaatcaaagtagtgatctctgaggcgtgtgttcagggggactccagt
cagacccagggcaaggaactggaccttgagcctggttctgctctagtccttacccatcgg
atccgactggttccggggtcgtgcgcaggcgggtgcgaggccgagtttgctgccctgcga
gaccgtctggagaggctggagaaggaggtgtcaacattgagggagaagtgtggaggccca
gaggggggctgctgcacgtcccagcagagtaaaggtgcagagtgctccatcaagccggag
ggagacgagtgtcctaatgagtgcagtgaccagggacgctgtgaagatggcaagtgtgtc
tgcttcccagggttcagtgggcccgactgcagtttgtctgactgccccggcaactgcaat
gacaaggggaagtgtgtgaacggccagtgtgtgtgcgacccaggtttcacagggccagac
tgctcttcagagtcctgtcctggaaactgtaacaacaagggccgatgtgtgaacgggcag
tgtgtgtgcgactcgggtttcacggggccagactgctcttcagagtcctgtcctggaaac
tgtaacaacaaggggcgatgtgtgaacgggcagtgtgtgtgcgactcaggtttcacgggg
ccagactgctcttcagagtcctgtcctggaaactgtaacaacaaggggcgatgtgtgaac
gggcagtgtgtgtgcgactcaggtttcacagggccagactgctccaccaaggcatgtcct
ggaaactgtaacaacaaggggcgatgtgtgaacgggcagtgtgtgtgcgactcaggtttc
acggggccagactgctcttcagagtcctgtcctggaaactgtaacaacaaggggcgatgt
gtgaacgggcagtgtgtgtgcgacccaggtttcacagggccagactgctccaccaaggct
tgtcctggaaactgcaaaaacggggggaaatgtgtgaacggtaagtgtgtgtgtgatagc
agttttacaggcccagactgctccaccaagtcctgccctggcaactgcagcaaccgtgga
aagtgtgtgaacggccaatgtgtctgcgatagcggctttacggggccggactgttccgcc
aaagcatgtcccaataactgcagcaacaagggaaggtgcgtgaacgggaagtgcgtgtgt
gaagtgggcttcagcggacaggactgcgccgctaagggctgtcccaataactgcagcaac
aaagggcgctgcgtgaaggggaggtgtgtgtgtcgccgtggtttcgcccccccggactgc
agccagtgtgaagctgggttcactggagctgactgtggcaccgccatgtctggtgtgtcc
cagctcaacaccaaggacatcactgaatcctctgttaccctctactggacaccacctcca
gtccagtatgacacctaccacgtcaccttcaccagccagaaagagggcgatcaacagata
acatctcaagttggtgggaagctcacgacctacacccaaacaggactggcggccgggcag
gagtacacggtgacaatcaagggagaaataaataggagaatgggcactgagagcacagta
gaattcacaacccttatctctggacccacaaaccttcgagttgtgaagacaaccacaaca
tctgcagttgtccaatgggaacaatcgcaaggacacgtcgacaggtatcgcttaactgtt
gcacccaatcagacggacggaacagccaagggaagacaagacctgacactgccccctgag
agggactctgcccagattgacggtttggacccgggacatttgtatgacatcacactagtg
gctgaaaagggcgggatcaagagcaagccagcaacagtccaagtcactcctggtccagag
cctccctcaggtcttgtcttcagtgaagtgactgagacgtctttctctgtgtcctggacc
aagccaaaaggtcccgtgagtggcttcaaggtcacctacactaacacacaggaaggggag
cctctctccgcaacggtggactctggggattccactctggcactgtcaaagctctctcca
gggtcctcctatgaggtcagtgtgatatccgtccttggactggacgagagcgatgcaatc
aaagacctggttatgacactccctgaccctccgagggatctccgggccattaatgtcaca
gacaccaaggccttgctgctatggcgaccagcactggcaccagtcgaccattacgtcata
gtttatggctctgaaaaagggtcagatgatgccaagatcactgtatcgggcaatgcggcg
gagcagcagctgaaaggcctacagggctccactaggtacaccgtcacagtcaccagtcag
ctgggcaacctggacagctctgccgccatcaccgtcttcaccaccaccggtggatccagg
ggagacggggaagttccgcgtgacctgaaggccagtcaggtgactcctcgctcagcgctg
ttgacgtggaaagcaccctctgccgccgtgggaagctacaagctgacctatcaaacggag
ggacaggagataaaggaggttaccattgactccacagtaacagagttcaaattgaccagg
ctgcatcccatgtccaagtacaccgtgcatctacagggggagaggggagggagctatact
gctacaatttccactgagttcaccacagggaatctccgataccccttcccaagtgactgt
tcccaggagctgctaaacgggatacacgagtctggagaggtggaaatcttccccagggga
aggcaggggaaaccagtgctggtctactgcgaccaggtgactgatggaggtggctggacg
gttttccagagaaggatggatgggaaaacggacttcttcagaggctggaaaaactacagc
aaaggttttggagaactgagtggggaattttggctgggtaatgagaacctacacaatcta
accagcatggcaccaatgaccctacgtgtggacctccgtgcaggggacgaatcagtgttt
gccaagtactctgcattcacagtggacactgttagaaggaactatgctctcaaagtgtct
gggtacagcggtacagcaggtgactctatgagttaccacaacgcgcgaatgttctctacc
agagacagagaccccacgcctttcatcacccgctgcgccatgtcctatagggggggttgg
tggtacaagaactgccacgaggccaaccttaatggcctctacgacaccagtgtcaatcat
cagggtgtgatctggactgcctggaaaggcaaggacttgtccatccctttcaccgagatg
aagctccgaccaacatctttcacccctccaactcagggataa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112230791
Entry
112230791         CDS       T05605                                 

Definition
(RefSeq) tenascin-like isoform X1
  KO
K06252  tenascin
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112230791
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112230791
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:otw00536]
    112230791
Glycosaminoglycan binding proteins [BR:otw00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   112230791
SSDB
Motif
Pfam: fn3 EGF_Tenascin Fibrinogen_C EGF_2 EGF Pur_ac_phosph_N hEGF Glyco_hydro_66
Other DBs
NCBI-GeneID: 112230791
NCBI-ProteinID: XP_024252858
LinkDB
Position
33
AA seq 1757 aa
MGTKSILGCVFLTLLLNLCQAGLVRKLLRDKRATLTTPGGNNVTLTSAEQPVVFNHVYNI
NVPSGSLCSVDLDALGSTSLEPQDAGPPSSLRTTEHTLDGQNQIVFTHRINIPQQECACT
DGLPDLKDLLSRLEMLEGEVSTLRDQCASGDAGGCSVQPVTGEVGTKPYCNGHGNYSADT
CGCICEPGWKGPNCTKSECPNNCQDQGRCVDGKCVCFEGFGRDDCSLKVCKVDCGGNGQC
IGGVCVCAKGYTGEDCSQTDCLNNCLSRGKCVDGECVCEEPWTGYDCSELICPNDCYDRG
RCVNGTCYCEEGFTGEDCGEKTCPSDCLGNGFCVDGQCVCSAGYTGEDCSKLTCPSDCND
RGVCFNGMCICNAGYQGEDCSQLACPNNCHNRGQCVNRQCVCNVGYQGEDCSELSCPNNC
QDQGRCVDGKCVCFEGFGRDDCSLKVCKVDCGGNGQCIGGVCVCAKGYTGEDCSQTDCLN
NCLSRGKCVDGECVCEEPWTGYDCSELICPNDCYDRGRCXNGTCYCEEGFTGEDCGEKTC
PSDCLGNGFCVDGQCVCSAGYTGEDCSKLTCPSDCNDRGVCFNGMCICNAGYQGEDCSQL
ACPNNCHNRGQCVNGQCVCNVGYQGEDCSELSCPNNCLNRGRCVNGQCVCDEGFGGEDCS
IKICPSDCYGSGDCVDGRCVCYAGFTGEDCSELSCPNNCLNRGRCVDGQCVCDEGFTGED
CTEKHCPNDCLDRGYCVDGKCVCLEGYAGVDCSELTCPDNCNNRGHCVNGKCMCEERYMG
DNCGELSCLNNCQDMGRCVNGQCLCDEGYIGEDCSEVSPPKDLTVTEVTTETVDLTWNNE
MLVTEYLIAYVPTSPGGLYQEFRVPGDKTAATVSELEPGIEYLINVYAILSNKKSIPISA
RVATNLPEPDGLKFKSVRDTSVEVLWDQLDIPFDAWELYVRNTKEENGKILTTLPSSQTM
YEQSGLGPGQEYEVSVGVIKNNTRGPQSTKIITTRIDGPRQVEVRDVTDCSGLVTWFQPV
AQVDGVTVSYGPSSHPTERTSVDLSTSDKQYSIDRLSPDTEYQVSLISRRGDYTSEPVSE
IFTTDLDAPKDLKPLGQTDDSVTLEWINSRADVDSYRVKYSPISGGSHGEEVFSRGSGDS
TQATITGMKPGTEYGIGVTAVKNERESHPATTNAATDLDGPKDLEVSVSTETSMTLVWRR
PRAKITIYRLVYISRDGRREEVEVPGTATTYVLTNLTPGMLYTITLVAERGSKKSTPVTL
SASTGLGAPRGIRFSEVTESSAIVHWTVPRARVDSYRIVYVPLQGGSPMTVLADGTETQA
LLPDMLPGVTYQVTIFSTKGLEESDPGTDTITTALDRPQGLSAVNVTDRTALLLWQPTRA
TVDGYVITYSADSGSPVMEHVSGNTVEFEMGSLVPATHYTVGVYAMREALKSGTTTTEFT
TDVDSPRDLAASNVQTDSATLTWKPPRADITGYVLTFTSSDSTVREVVLSPTATSYSMTQ
LSGTTDYNVRLQAIAGAQRSRHVTTVFTTIGVLYRYPKDCSQALLNGDTTSGIYTIYLGG
EESQPIQVYCDMTTDGGGWMVFLRRQSGKLEFFRNWKNYTGGFGDINAEFWFGLANLHKL
TTAGQYELRVDLRDKGESAYAQYDKFTIAEPRSRYKIHIGGYSGTAGDSMTYHQGRPFST
YDNDNDIAVTNCALSYKGAFWYKNCHRVNLMGRYGDDSHSKGINWFHWKGHEHSIQFAEM
KIRPVNFRNFESRRKRS
NT seq 5274 nt   +upstreamnt  +downstreamnt
atgggaactaaaagcattttagggtgtgtcttcctgactctccttctcaacctctgccaa
gctgggctggtgagaaaattacttagggataaacgggcgaccttgacaacccctggcgga
aacaatgtgaccctgaccagcgctgagcaaccagtggtcttcaaccacgtctacaacatc
aatgtcccttccggctcactatgctcagtggacctggatgccctaggaagcaccagcctc
gagccccaggacgcaggtccgccttcaagcctccgcaccaccgaacataccctggatggc
cagaaccagatagttttcactcaccgcattaacattcctcagcaggagtgtgcatgcact
gatgggctcccggatctgaaggacctcctgagcagattggagatgctggagggagaggtg
tccacgctgagagaccaatgcgctagtggagacgctggcggctgcagcgttcagccagtc
acaggtgaggtggggaccaagccttattgcaatggccatggcaactacagtgctgacacc
tgtggttgcatttgcgagcctggctggaagggacccaactgcaccaagtctgaatgcccc
aacaactgccaggaccaaggtcgctgtgtggatgggaagtgcgtctgctttgagggcttt
ggcagggatgactgttcactcaaggtttgcaaagtggactgtggtgggaacggacaatgt
attggtggggtctgtgtctgtgccaagggttacactggagaggactgttctcagacagac
tgcctgaacaactgtctaagccgtggaaagtgtgtggacggggagtgtgtgtgtgaagag
ccctggacgggctacgactgctccgaactcatctgccccaacgactgctacgaccgcggc
cgctgcgtcaatggaacctgctactgcgaagaaggattcaccggggaggactgtggggag
aaaacctgcccaagtgactgcctgggaaatggtttctgtgtggacggccagtgtgtctgc
agcgctggctacactggagaggactgctccaagctcacctgccccagtgactgcaacgat
agaggtgtctgcttcaacggcatgtgtatctgtaatgctggctaccaaggagaggattgt
agccagctggcttgtcccaacaactgccacaacaggggacagtgtgtcaacagacaatgc
gtctgcaatgtaggctaccagggagaggactgctctgagctctcctgccccaacaactgc
caggaccaaggtcgctgtgtcgatgggaagtgcgtctgctttgagggctttggcagggat
gactgttcactcaaggtttgcaaagtggactgtggtgggaacggacaatgtattggtggg
gtctgtgtctgtgccaagggttacactggagaggactgttctcagacagactgcctgaac
aactgyctaagccgtggaaagtgtgtggacggggagtgtgtgtgtgaagagccctggacg
ggctaygactgctccgaactcatctgccccaacgactgctacgaccgcggccgctgcrtc
aatggaacctgctactgcgaagaaggattcaccggggaggactgtggggagaaaacctgc
ccaagtgactgcctgggaaatggtttctgtgtggacggccagtgtgtctgcagcgctggc
tacactggagaggactgctccaagctcacctgccccagtgactgcaacgatagaggtgtc
tgcttcaacggcatgtgtatctgtaatgctggctaccaaggagaggattgtagccagctg
gcttgtcccaacaactgccataacaggggacagtgtgtcaacgggcagtgcgtctgcaat
gtaggctaccagggagaggactgctctgagctctcctgccccaacaactgtctcaaccgg
ggccgctgtgtcaacggacagtgtgtgtgcgatgaagggttcggtggtgaggactgcagc
atcaagatctgcccctcagactgctatggcagtggagattgtgtggatggccggtgtgtc
tgctatgctggcttcaccggtgaggactgcagcgagctgagctgccccaacaactgcctg
aaccggggacgctgcgttgacgggcagtgcgtctgcgacgagggcttcacaggggaagac
tgcactgagaagcactgtcccaatgactgcctggacaggggatactgcgtggatggcaaa
tgtgtctgcctggagggctatgcgggtgtcgactgctctgaactcacctgccctgataat
tgcaacaacagggggcactgtgttaatgggaagtgcatgtgtgaggagcgatacatggga
gacaactgtggagagctgagctgcctcaacaactgccaggacatgggccgctgtgtgaat
ggacaatgtctctgtgatgagggatacatcggagaagactgctcagaagtttcacctcca
aaggacctgactgtaacagaggtcaccaccgagacagtggatctgacctggaacaatgag
atgctggtgacagagtatctgattgcatatgtgcccactagtcctgggggtctgtaccag
gagttcagagtgcccggagacaagactgctgccacagtcagcgagctggagcccggcatc
gagtacctgatcaacgtctacgccatcctcagcaacaagaagagcatcccaatcagtgcc
agggtggccacaaatctaccggagccagacggcttgaagttcaaatcggtgagggacacc
tcagtagaagtgttgtgggatcagctggacattccctttgatgcctgggagctctatgtc
cgtaacacgaaagaggagaatgggaagatcctgacaacccttccatcctcccagactatg
tatgagcagtcagggcttggtcccggtcaggagtacgaggtctcagtgggcgtcatcaag
aacaataccagaggacctcagtctactaaaatcattaccaccaggattgatggccccaga
caggtagaggtgcgtgatgtgacagactgctcaggcttggtcacctggttccagcccgtg
gcccaggtggacggtgtcaccgtgtcctacggccccagctcccaccccacagagaggacc
agcgtggacctgtccacctcagacaaacagtacagcatcgacagactcagcccagacact
gagtaccaggtgtccctgatctccaggaggggagactacaccagtgagccagtctctgag
atattcaccacagacctggacgcccccaaagacctgaagcccttgggccagacagacgac
agtgtcacactggagtggataaacagccgggcagatgttgacagctacagggtgaagtac
agccccatctctgggggttcccatggcgaggaggtgttctcccgtgggtcaggagacagc
actcaggccaccatcactggaatgaaaccaggtacagaatacgggattggtgtgactgcc
gtgaagaacgagagggagagccaccctgccactacaaacgcagccactgatctcgatggg
cccaaggacttggaagtgagcgtgtccacagagacaagcatgaccctggtgtggaggaga
cccagagccaagatcaccatctacagactggtgtacatttccagggacggtcgaagggag
gaggtggaggtccctggaactgccaccacctatgtcctgaccaacctgacccccggtatg
ctgtacaccattaccctggtcgctgagaggggctcaaagaagagcacacccgtaaccctg
tccgcatctacaggcctgggcgctccaaggggcatccgcttctctgaggtgaccgagtcc
tcggccatagtccactggaccgtgcctcgtgccagagtggacagctaccgcatcgtttat
gtgcccctccaaggaggtagcccaatgacagtgcttgcggatgggactgagacccaggcc
ttgctgcctgacatgttgccaggggtgacctaccaggtgaccatattctccacgaagggc
ctggaggagagtgacccagggacagacaccatcaccacagctctggacagacctcagggt
ctttctgctgtcaacgtcactgacaggaccgccctgctgctatggcaacccactcgggcc
actgtggatggctacgtcatcacctacagtgcagattcagggtccccagtgatggagcat
gtttctgggaacacagtggagtttgagatgggctctctggtccctgccacccattacaca
gttggggtatacgccatgagggaggcactgaagagtggcaccaccaccaccgaattcacc
acagatgtggattctcctcgcgacctggcagccagtaatgtccagacagacagtgccact
ctcacttggaagcccccgcgggccgacatcaccggatacgtcctcaccttcacctcatct
gacagcacagtccgggaagtggtcctgagccctacagccacatcatacagcatgactcag
ctgagtggcactaccgactacaacgtcaggctacaggccatcgctggagcccagcggagc
cgccacgtcaccaccgtcttcaccaccatcggagtgttgtacagataccccaaggactgc
tcacaggctctgctgaatggagacaccacctctggcatctacaccatctacctgggagga
gaagagagccagcccatccaggtctactgtgacatgaccaccgatggaggtggatggatg
gtgttcctgaggcgccagagtggaaagctggagttcttcaggaactggaagaattacact
ggtggctttggggacattaatgctgaattctggtttggtctggccaacctccacaagttg
acaacagcaggccagtatgagttgcgtgtggacctgagggacaaaggggagtcggcctat
gctcagtatgacaaattcacgatcgcagaaccccgtagccgctacaagatccacatagga
gggtacagcggcacagcaggtgactctatgacttatcaccagggccgacccttctccacg
tatgacaatgacaatgacatcgctgtcaccaactgtgccctgtcctataagggtgccttc
tggtacaagaactgccatcgtgtcaaccttatggggagatatggtgacgatagtcacagc
aagggtatcaactggttccattggaagggacacgagcattcaatccagttcgccgaaatg
aagattagaccagtcaacttcagaaactttgaaagtcgaaggaaaagatcatag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112230880
Entry
112230880         CDS       T05605                                 

Gene name
lamc3
Definition
(RefSeq) laminin subunit gamma-3 isoform X1
  KO
K06247  laminin, gamma 3
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112230880 (lamc3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112230880 (lamc3)
SSDB
Motif
Pfam: Laminin_N Laminin_EGF Laminin_B
Other DBs
NCBI-GeneID: 112230880
NCBI-ProteinID: XP_024252993
LinkDB
Position
33
AA seq 1629 aa
MDIPLTTPLLLALLLCSLSFVHGAMDSCYDDDEGVPSRCMPKFENAAFNHTIIASNVCGS
PPEDYCMQTSSTRSCHHCSVSDMGLSHNASLLTDFHTDEEPTWWQSQSMFYRVQHPNSVN
LTLRLGKAFEITYVRLKFYTSRPESFAIYKRTNQDGPWVPYQYYSASCSKTYGKNAKGYI
RPGDDERMALCTDEFSDISPLTGGNVAFSTLEGRPSAYNFDQSAVLQEWVTATDLLISLD
RLNTFGDEFFKDAKVLRSYFYAISDFSVGARCKCNGHGSECVLDEQGALVCDCQHHTAGV
DCQKCHPFYQDRPWARATGDSANQCMKCNCSGRADACVFDAEQYRSTGSGGRCVDCRDHT
DGPHCERCKENHYRRSPRDLCRPCDCNTIGSVSLQCGAEGMCTCRPSVMGEKCDTCQRGF
HSLSPGGCRSCDCETRGSVGICSTLDGSCHCKDNVEGQACDRCKPGSFNLQENNPAGCTS
CFCFGHSLACRSSNDHAAVNITSDFLEDPDRWSGQFSGGQEYPLLWKEGEVYLLPLSEDD
LGFYRAPEKFLGNHLLSYGQLLSLTFTAEAQCLLPHSVTVLLEGSGITLSADLLPQPGLV
HQPGLAPQHTFTLRLHKEETRLRPFLSAFEFQSLLFNLTAFRISNAGGHNYTSQLSGVTL
ASAAHSSSPVTSSTPPAPWVEVCTCPPGFGGQFCELCAPGYTREVPNRGPLSPCVPCTCH
QHGPCHPETGVCKCADFTTGPTCEHCLDGYYGNALIGTTNDCQTCPCPDRTSCAQIMEIG
DVVCTNCPSGQRGTRCELCEDGFHGDPLGRSGLVRQCERCDCNGNVDPNALGVCDHMTGR
CFKCLGHTEGDHCQRCRRGYYGDAMDRTMAGKCKPCDCSPAGTSGLLEDCDPQTGSCQCL
SHVTGRDCGQCSVGFFNLQHGVGCERCNCNPIGSSSAGCHPITGQCVCQPGLEGRLCSTC
RMGFFGFSSRGCRACNCDPMGSRSMQCHTNGTCPCRQGFVGYKCDQCELNYFHNRATHQC
EECPVCYGLVKEEAGKLKARLQDLEKLLARFDCRNGSGRQHHVREYHVRQHHERGHQGED
SLPNALEDFLAIQEAKEAFVKQFALLETSTHTLSAQLHTVATAMNCSASMEEEQEEGWRT
LCRTLADSVSVVRSAQTQLMQATLDLDNMVIPFKMTPVPNRWNSAVNESEILMKSHTEMA
GHIESIATKAFMASNQTYSLLMDLLEDNSIEEYISNLTEQMADMQQMKENLTAQVNETLA
IQLSLEEESAEIMVAFVNLTSSILELSKKMPNPTSGTNQSDPSLRSGANQTEGVELSNRT
SELAFHVQSKEELASKIREEMEPRIQTAHKNLAAVQDMHKLTVQAQGSKVIALSSVVTGK
EVESKAITLRRELEDMQREWPQRQAQTKAALKRERLLREKVLEDVSKKVNQTKRVLRPAL
ESATLSNATAQEAKHTANALSKEAKATLTQGKHTRTLSAQLSSSVDITLQQLEEQENHTV
QAQTQTNAEPVESLASVKVNIQAAQLQLEAYSLTLTQLVNKIDGGMALERFEHILSETAV
RLSVLRGSVESPALNGKIQTLQSAAQDQNSQLTHLEQDLQEIRQERDSLKDIALHLPQTC
PQASGIEGH
NT seq 4890 nt   +upstreamnt  +downstreamnt
atggatatcccactgaccaccccactcctcctcgccctccttctctgctccctctccttc
gttcacggggccatggactcctgctacgatgacgacgagggtgtccctagccgttgcatg
cccaagttcgagaacgcagcctttaaccacacgatcattgcttccaatgtgtgcggttca
ccgccagaggattactgcatgcagacgagctcgacgcgctcctgccaccactgtagtgtg
tcggacatgggcctcagccacaacgccagcctgctgacggacttccacacggacgaggaa
cccacctggtggcagagccagtccatgttctacagagtccagcaccctaactctgttaat
ctcaccctgcgcctcggtaaggcctttgagatcacctacgtgcggctcaagttctacacc
agccgaccagagagctttgccatctacaagcggacaaatcaggatggaccatgggtgccc
taccagtactacagcgcctcctgtagcaagacctacgggaagaacgccaagggatatatc
cgcccgggtgacgacgagaggatggcattgtgcacagacgagttcagtgacatctcccct
ttgaccgggggaaacgtggccttctctactttggagggacgacccagcgcatataacttt
gaccagagcgccgtgctgcaggagtgggtgacagccaccgacctgctgatctctctggac
aggctcaacactttcggagacgagttcttcaaggacgccaaggtgctgcgatcctacttc
tacgccatctctgatttctctgtgggagccaggtgtaagtgtaatggccatggcagtgag
tgtgtgttggatgagcagggggctctggtgtgtgactgccagcatcacacggccggggtg
gactgccagaagtgtcacccgttctaccaggacaggccatgggccagggccaccggagac
tctgccaaccagtgtatgaagtgtaactgcagtgggcgagcggatgcatgtgtgttcgat
gcggagcagtaccgtagcacagggagtggggggcgctgtgtggactgtagggaccacact
gacggaccgcactgtgaacgctgcaaagagaaccactaccgacggtcaccacgggacctc
tgccgcccctgcgactgtaacaccataggttctgtgagtctgcagtgtggtgcagagggg
atgtgtacgtgcagacccagtgtgatgggggagaagtgtgatacctgtcaacgcggcttc
cactcgctcagccctggtggctgcaggtcgtgtgactgtgaaaccaggggcagtgttggc
atctgctctacgctggacggcagttgtcactgcaaggacaacgtggagggacaggcgtgt
gacaggtgcaagccaggctccttcaacctgcaggagaacaacccagctggctgcacctca
tgtttctgcttcggacactcattggcctgcagatcctccaatgaccatgcagctgtcaac
atcacttctgacttccttgaagacccagaccgctggtctggacagttctctgggggacag
gagtaccctctgctgtggaaggaaggtgaggtctacctgctaccactcagtgaggatgac
ctgggcttctacagagctccagagaagttcctggggaaccatctcctgagctatggccag
ctcctctccctgaccttcacggccgaggcccagtgcctcctccctcacagtgtcactgtg
cttctggaaggatctggaatcaccctgtcagctgaccttttaccccaacctggacttgtc
caccagccaggcctcgctccccagcacaccttcactctcagacttcacaaggaggagaca
agactgaggccttttctgtctgccttcgagttccaaagtcttctcttcaacctcactgca
ttcaggatcagcaacgcaggaggacacaactacacgtcccaactctcaggggtaaccctg
gcctccgctgcccactcctccagccctgttacatcctctaccccccctgctccctgggtt
gaggtgtgtacgtgccccccggggtttgggggtcagttctgtgagctctgtgccccaggc
tacaccagagaggtccctaacagaggacccctgtcaccctgtgtgccctgcacctgccac
cagcacggaccctgccaccctgagacaggtgtgtgtaagtgtgcagatttcaccacagga
ccaacctgcgagcactgcctggatggttactatggcaacgcgttgattggcacgaccaac
gactgtcaaacttgcccctgcccggaccgcaccagctgtgctcaaattatggagattggg
gacgtggtctgtaccaactgcccttcaggacagaggggaaccaggtgtgagttgtgtgag
gacggtttccacggcgaccccctgggccgttctgggctggttcggcagtgcgagcggtgc
gactgtaacggtaacgtggaccccaacgcgctgggcgtgtgtgatcacatgacgggccgc
tgcttcaagtgtctgggacacaccgagggagaccactgtcaacgttgtcgacgcggttac
tatggagatgccatggaccggacgatggccgggaagtgcaaaccctgcgactgcagtcct
gcagggacttctgggttgttggaggactgcgacccccagactggaagttgtcagtgcctt
agtcatgtgaccgggcgagactgtggccagtgctcagtcggcttcttcaacctgcagcat
ggagtaggctgtgagaggtgcaactgtaaccccattggctcgtcttccgcggggtgccac
ccaatcacagggcagtgtgtgtgtcagccgggactggaggggcggctgtgcagcacctgt
cgtatgggcttctttggtttctcctcacgaggctgcagagcctgtaactgcgaccctatg
ggttcccgctccatgcagtgccacaccaacggcacctgtccctgccgccagggcttcgtg
gggtacaagtgtgaccagtgtgagctcaactacttccacaacagagccacgcaccagtgt
gaagagtgccccgtctgctacgggctagtcaaggaggaggcagggaagctgaaggcacgg
ctgcaggatttggagaagctcctggcacgcttcgactgccggaatggctccggacgccag
catcacgtgcgcgagtatcacgtgcgccagcatcacgagcgtggccatcagggggaggac
agcctgcccaatgcgctggaggacttcctggctatccaagaggcaaaagaagcctttgtc
aaacagtttgctctcctggagacgtctacacacactctctcagctcagctgcacactgtt
gccaccgctatgaactgtagcgccagcatggaggaagagcaggaggaagggtggagaaca
ttgtgcaggacccttgctgactctgtgtctgtggttagaagtgcacagacccagctgatg
caggcaactctggacctggacaacatggtcatccctttcaagatgacacctgtgcccaac
cgctggaactctgcggtgaacgaatcagagatacttatgaaaagtcacacagagatggct
ggtcatatagagtctatagcgaccaaagctttcatggcctccaaccagacctactctctc
ctgatggacctactggaggacaactctattgaggaatacatcagcaacctcacggagcaa
atggcagacatgcagcagatgaaggagaatttgacggcccaggtgaatgaaactctagcc
attcagctgtctctggaggaggagtctgctgagatcatggttgcctttgttaacctcaca
tcctccatattggagctgtccaaaaagatgcccaaccccacatcaggaaccaaccaatca
gaccccagcctaagatcgggtgccaaccaaacagagggtgttgagctgagcaacaggaca
tctgagctggcgttccatgtccagtctaaagaagaactggccagtaagatcagagaggag
atggagcctcgaatacagaccgcccacaagaaccttgctgccgtacaggacatgcacaag
ctgacagttcaagcccaggggtcaaaggtcattgccctgtcatcggtggtgacagggaag
gaagtggagtcaaaggccattaccctgcggagagaactagaagacatgcagagagagtgg
cctcaaaggcaggcccagacgaaggctgctctgaagagggagaggctgctgagggagaag
gttctggaagacgtcagtaagaaggtgaaccagaccaagcgagtccttaggcctgccttg
gagagcgctaccctctccaacgctaccgctcaagaagcaaaacacaccgcaaatgctctg
tctaaagaggccaaggccaccctaacccagggcaagcacacgaggacattgtctgcccag
ctcagctcatctgtagacataaccctgcagcagctggaggagcaggagaaccacactgtt
caggcacaaacccagacaaacgcagagcctgtagagtctctggccagtgtaaaggtgaac
atccaggcagctcagcttcagcttgaggcctactccctcacactcacccagctcgtcaat
aaaatagatgggggcatggcgctggaacggtttgaacatatactgagtgagacggcggtg
cggttgagtgttctgcgtggcagcgtggagagcccggccctgaacgggaagatccagacc
ctgcaatcagccgcccaggaccagaacagccagctgacccacctggaacaggacctgcag
gagatcagacaggagagagacagtctgaaggacattgccctgcacctgccccagacctgc
cctcaggcctcggggatagagggacactag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112232336
Entry
112232336         CDS       T05605                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: reelin-like
  KO
K06249  reelin [EC:3.4.21.-]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112232336
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112232336
Enzymes [BR:otw01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     112232336
SSDB
Motif
Pfam: EGF_2 Reeler EB
Other DBs
NCBI-GeneID: 112232336
NCBI-ProteinID: XP_024255072
LinkDB
Position
Unknown
AA seq 3478 aa
MAWASVWGALGCALLALVLGTGVDLGSPPAAGFYPRFNPFFFLCTHHGELEGSGVAEGGG
EVLLTLQIAGHPTAYTPGQEYQVTVSTSVYFDGLLVTGLYTSTPVQSAPIPAPAAFGFGV
MPEQRQFRTQFVCSVVASHVSHQPSTSLSFVWIAPPPSTGCVNFLATATHRGQIIFKDAL
AQQLCEQGAPTESPLRPSLAEIHGNHAVLRDDFDSNLQGELDPRIWSECSNCEVGEQCGV
LMHGRAVTFCEPFRERELTTVPLNTTTASVLQFALGSGTCRFSYSDPSIIVAFSLNKNNS
TNDWITLEKIRAPTNSSTIVHLLPLPVQSRGDGVRVRWSQEAPQGPEGYESCWGLDNVLL
VNAAYIPPLLEDNLDPPDTANWLFFPGATVKRACQSEGNTLYFHGNNEEGVGHTFASTRD
IDLHREEGRSYWEEDFESLPTNWDIEGAVYGTHCGEIESGMALVFERDGERKMCTPYLDT
TSFGNLRFYFTMGGGECDPGESHENDVILFGRSEGRRDLVLLDTLPYSSYMTPSVVSVAL
STDLQTPITQFCLEQRAHGGANRHVWAVDFMQLLPVLPGTHTHVAQFSINLGCGSYQPAN
SVNLEFSTNHGRSWSLLHTECLPDLCAGPHLPHSTIYSSENYSGWTRISIPLPNAALTET
TQFRWRQSGMGAGNMWAIDNVYIGPSCLRFCSGRGQCSRTGCKCDPGFNGPACELASQTF
SAFLSEGFSSPRLSSYHSFSSLRGAEVSFGCGVLASGKALVFNRDSRRHLVTAPLDSSQA
RYLQFTLRLGSRSILSSCPAPDQPGEGVLLHFSSDNGITWILLQHYAYKGFHEPRIVSVE
LPPGARRFGVQFRWWQPYHSGRGHDVWAVDEITMTSVLFNTISLDFSNVLDVTQSLGFYL
GHVQPYCQHDWTLSFSGDPSPGSSIRYVETQSMQIGASYTLQFSLVMGCGRDPSPHIDTQ
VRLEFSTNHGLTWHLVKEACLPGMPSCSEFTAPSVYHPSEFTDWRRITLPLPHRAWSSAT
RFRWIQNYYGEQDEWALDDIYIGQQCLQMCHGHGWCDHGHCRCDEGFSGSDCQASSPLSS
SILSDFESQDGLLAVWQEVIGGEVVTPDMGCGVVSSGSSLYFSKAGLRQLVSYDLDTEWA
EFVQFYLRVGGDWVQCNMADSREEGVLLQYSNDGGISWGLIAEMYFTDFTKPRFVHYELP
QASKTPCTRFRWWQPLHSGDGYDQWAIDDVIILSEREKHIIPMANPTIPQNFYEKPAFDY
PLNQMSVWLLLGNEGMEKERNGSFCAPTPSAMVFGRSDGDRVAVTRDLVLRPGYTLQFKL
NIGCESQFSASASVLXQYSHDAGRTWALVKXGCYLGSSGAGGCEGSGRELREPTVYATGD
YESWTRVTIVIPRNVAASKTRFRWFQESSVYRDAPAFALDGVYISEPCPNHCGGHGDCIS
GVCFCDMGYTVEQDSCVPAVASPTELAEGFESKLSPVWQTLSGGQVGGGCGTISEGKALY
FSSPGKREARTVPMDTTNTRLVQFYIRIGGKNVGPTCTRPRSRNEGVIVQFSNNNGVQWQ
FLRELDFGSFLDSQVVTIELPPPAKTPYTVFRWWQPQQSKHSAQWALDDVLIGMNDSSRT
GFHDKFDGTSPLRHNWYRIQGGEITVDCLSLDTALSFNSDTTGKKPRYAESWDFEVSGSS
FLQFELSMGCSKVATSSHGVRLEYSTDCGRHWALLTPECVPPATAVPATHELSLTATQYN
RWRRVTVYLPSTANSPRTRFRWPTPLHPGGTVGALDNVLLPCGPWMVPGHGLCDNGFVCE
CDRGYGGAHCVPLAPLPSILRDDFNENLAAEQWPEVYGAERGTLSGEPLKSGTALIFKGE
GLRMLMSRDMDCTSTLYIQFSFKFITKGVPERSHSVLLQYSVNGGISWLLLDEFYFPTST
DTLFIHLALPTNAQTNATRFRLWQPYNSGKKEEVWVIDDLIIDGSSLNNPPVVSDSFEGG
PQDYNWLFYPGGNTGLYCPYQKSGLEDDESAMVFVSSELGEHSITTRDIDVNENTIIQFE
INVGCTADSSSSNPVRLEFSRDFGATWHLLVPLCSGGPQPSSLCSTELHPASVYYPGTTQ
GWRREIIHFGKLRLCGSIRFRWYQGFYSSGSSPPTWALDSVYIGPQCQDMCNGHGSCVRG
TQCVCDSGYSGPDCSQPDTSNPDFLKEDFEGGAVDADRFRLLSGGKPSRKCGIMSSGNHL
FFSEDGLRMLVTNDMDLSNARFIQFFLRLGCGKASPDPRSQPVLLQFSVDGALTWGLLQD
FFFSNSSNQARLVALEIPLRARTSATRLRWWQPSENGHFYSPWVIDQVVVGGSASGWGPL
EDDFSSMDGRSWLLYPGGTRMPVCGSDGAAFAFIEKSNTRYAVTTDISLGQDAFIQFDFS
ASCSVTNSCYAIELEYSLDLGLHWQPLVRDCLPTSQDCSSYTLQRLLVADTYNKWGRVTL
PIPIYARSPATRFRWFQQAPFDKQQTWALDNLYIGDGCSDMCSGHGRCQQSSCVCDPEWE
GEYCDEPVAPLPSQLKDSFSRAPSLSHWHLVTGGKLSTVCGAVASGAALHFSGSCSRQLV
TVDLNLTNAEFIQFYFMYGCMTPPSNRNQCVLLEFSLNGGINWILLTEIFYDLYRKPGFV
NVLLPHAARQEGVRVRWWQPTHEGSDHSDWALDNVLIAGSDPRAQISDTFGGVALPNHER
APADGTPTGRIGLLNEGEEESTSVGDHWLFSEDCAVQRFCSSPDGVMVCGNDDGREVYAV
THDIVPDKGWVMQFKIVVGCSVPERHAEHQVHVQYSVDFGVSWRYLVPQCLPADPCCGGQ
ISQPSVFFPAQGWKRAVYPLTDSLADTAVRFRFYQQHSDTQWAVENLYIGPACDSHCGGH
GECLDQRCICEPGFTGPSCYASTALKTSLKERFDWEGAPGPQWQVLEGGRPCTDCGVLVE
GTALYFGGADARQAVTADLDLRGAKFVEYWARIGSEDNMTMCHRPTCRKEGVLLDYSKDG
GVSWTLLHEMDYLKYVSVRRDYIVLPEGALSNTTRLRWWQPFSVSSGLASPGLERAQWAV
DNILVGGSDINPSTLLDTFDDEGVSHEESWNFYPNAVRTAGFCGNPSFHLYWPNKNQDKT
HNILATRELIVQPGYILQFKIVVGCEADSCEDHHSVLLQYRKDARSDSWQLVQSECLPSS
VNNVGCSPFMFHESTIYSPVNSSTWTRVTVQLPDHVSSGATQFRWIQKEGVGERHGWGVD
HMYIGEACPGLCSGHGYCTSGVVCICDEGHHGDDCSLSGSDLPSSIKDNFESGSMSEESW
QLIQGGGVGSGCGQLSPHAHGDSLYFNGCKMRQAVTKPLDLTRASKIMFVLQIGSVSQTD
SCNTALDQPDTVDRAVLLQYTVNNGVSWHVIAQHQPKDFIKAQRVSYNIPLEARAKGVKL
RWWQPRHGGVGHDQWALDHVEVVLVSTRKQNYMMNFARQTGLRHYYSRKRRALLQHRA
NT seq 10437 nt   +upstreamnt  +downstreamnt
atggcatgggcctctgtctggggtgccctcggctgtgccctgctggccctggtgttgggg
accggtgtggatttggggagccccccagcagcaggcttctacccccgcttcaaccccttc
ttcttcctgtgtacccaccatggggagctggaggggtccggggtagccgagggaggggga
gaggtgctcctcaccctacagatcgctgggcaccccactgcctacacccctggacaggag
taccaagtgactgtctccaccagtgtgtattttgatggtttgctggtgaccggtctctac
acgtccactcctgtccagtctgctcctatccctgctcctgctgccttcggcttcggtgtg
atgccagagcagcgtcagtttaggactcagtttgtgtgtagtgtcgtggcgtctcacgtc
agccaccagccctccaccagtctcagcttcgtctggattgctcctccacccagcaccggc
tgtgtcaacttcctggccactgctacacatcgaggacagatcatcttcaaggacgcactt
gcccagcagctgtgtgagcagggagcacctacggaatcgccattgagacccagtcttgct
gagatccatgggaaccatgcggtgctccgtgatgactttgactccaacctgcagggagag
ctggaccccagaatttggtcagagtgtagtaactgtgaggtaggagagcagtgtggggtt
ctgatgcatggcagagctgtcacattctgtgagcccttcagagagagagaactgaccact
gtacctctcaacaccaccacagcctctgtcctgcagtttgctcttggttcaggcacatgt
aggttcagttactccgaccccagcatcatcgtggcgttcagtctgaacaagaacaacagc
accaatgactggatcaccctggagaagatcagagctccaactaacagcagtacaatagtc
catctcctgcccctgccagtgcaatccaggggagatggggtgcgtgtacgctggtcccag
gaggccccccagggacccgaaggctacgagtcgtgctggggcctggacaacgtactcctg
gtcaacgctgcttacatacctcccctactggaggataatctggaccccccagacacagcc
aactggcttttcttccctggggctaccgtcaagcgtgcctgtcagtcagagggcaacacc
ctgtatttccatggcaacaatgaggagggggtgggccacaccttcgcctccaccagagac
attgacctccaccgagaggagggtcggagctactgggaggaggactttgagagtctgccc
accaactgggacatcgagggggctgtgtatgggacccattgtggggagatagagtcaggc
atggccctggtgtttgagagggatggagagaggaagatgtgtactccctacctggatacc
acctccttcggaaaccttcggttctacttcaccatgggtggtggggagtgtgacccagga
gagtcccatgagaatgatgtcatcttgtttggtaggtcagaggggagacgagaccttgtg
ctgttggataccctgccatactcctcttatatgactccgtcagtagtgtcagtagccctg
tccacagacctccagacccccatcacccagttctgcctggagcagcgggcacatggcggt
gccaaccgtcacgtctgggcagtagacttcatgcagttgctgcctgtccttcctggcaca
catacccatgtagcacagttctccatcaacctgggctgtgggtcctaccagcctgccaac
agtgtgaatctggagttttccaccaatcacggtcgttcctggtcgctgctccacacagag
tgtcttccagatttgtgtgctggcccccacctaccacacagcaccatctactcctcagaa
aactacagcggctggactaggatctccatcccacttcccaacgctgccttgactgagacc
acacaatttcgctggagacagagtggcatgggtgctggcaacatgtgggccatagacaat
gtgtacattggtccatcctgccttcgtttctgctctggaagaggacaatgctcccgcacc
ggctgcaagtgtgacccagggtttaatggtccagcatgtgagctggcatcccagacattc
tctgccttcctgtctgagggtttctcctcccccagactctcctcctaccacagtttctcc
tccctgaggggagcggaggtgagtttcggctgtggggttctggccagtggcaaggctttg
gtcttcaacagagacagcagacgacacctggtgaccgcaccgctcgacagctctcaggcc
aggtacctccagttcactttgcgtctgggaagtcgtagcatcctgagctcctgtcctgcc
cctgaccaaccaggagaaggtgtgttgctgcacttctcctcagacaatggcattacctgg
atcctgctgcaacactacgcatataagggcttccacgaacccaggattgtatcagtggag
ttaccccccggtgcccgtaggtttggggtgcagttccgttggtggcagccgtaccactct
gggcgtgggcatgacgtttgggcagtggatgagatcactatgacctctgtgctgttcaac
accataagtctggacttcagtaatgtacttgatgtcactcagagtctgggcttctacctg
gggcacgtccagccctactgccagcacgactggacactcagtttctcaggtgatcccagc
ccaggctccagtatccgttatgtggagacccagtccatgcagattggagcctcctacaca
ctgcagttctcattggtcatgggctgtggcagagacccctccccccacatcgacacacag
gtccgcctggagttctccaccaatcatggtctgacctggcacctggtcaaagaggcctgc
ctaccagggatgcccagctgttcagagttcactgctcccagtgtgtaccatccctctgag
ttcactgactggagacgcatcactctgcccctgcctcatagagcatggtccagtgccaca
cggttccgttggatccagaactactatggagagcaggatgaatgggctctggacgacatc
tacatcgggcagcagtgccttcagatgtgccacggacacggatggtgcgaccacggacac
tgcaggtgtgatgaaggtttctcaggttcagactgccaggcatcctctcctctttcttcc
agcatcctgtcagactttgagtcccaggatggtctgctggccgtgtggcaggaggtgatt
ggtggagaggtggtaacacctgacatgggctgtggggtggtctcctctgggtcctcgctc
tacttcagcaaggccggattgaggcagctggtgagctatgacctggacacagagtgggca
gagtttgtgcagttctacctgcgtgtgggcggagactgggtacaatgtaacatggcagac
agcagggaggaaggagtgctgctgcagtacagtaatgacggaggaatcagctggggactc
atcgctgagatgtacttcaccgacttcaccaagccacggtttgtccactatgagttgcca
caggcctctaagaccccatgtacccggttcagatggtggcagccccttcactctggggac
ggctacgaccagtgggccattgatgatgtcatcatcttgtcagagagagagaaacacatc
atccctatggccaaccccactataccacagaacttctatgagaagccggcgtttgactac
cctctgaaccagatgagtgtgtggctcctgctgggcaatgagggtatggaaaaggagagg
aacggcagcttctgtgctcccaccccctctgccatggtgttcgggcgatctgacggagac
agggtggcagtgaccagagacctggtcctaagaccagggtacacactgcagtttaagttg
aacatcggttgcgagtctcagttcagtgcatcggcctcagtcctgncgcagtactcccat
gatgctggccgtacctgggcgctggtgaagngaggctgttacctaggctcctctggggcg
ggtggctgtgagggcagtgggcgggagctcagggaacccactgtctatgccacgggagac
tacgaaagctggaccagggttaccattgtcattccgcgtaacgtggctgccagtaaaacg
aggttccggtggttccaggagagtagtgtgtacagggacgctccagcctttgccctagat
ggagtctatatctctgagccctgccccaaccactgtggaggacatggagactgcatctct
ggggtctgcttttgtgacatgggatacacagttgagcaggacagctgcgtgccagcggtg
gccagccccacagagttggcagagggctttgagagcaagctgagcccggtttggcagacc
ctgagtggggggcaggttggagggggctgtggcaccatcagcgagggaaaggctctgtac
ttcagcagccctgggaagagagaggcacgcactgtacctatggatacaacaaacacacgg
cttgtccagttctacatccgtattggagggaagaatgttggacccacctgcaccagacct
cgctcccgcaacgaaggagtgatagtccagttctccaacaacaacggagttcagtggcag
ttcctacgtgagctggactttggttccttcctggattcccaggtggtcaccatcgagctg
cctccacccgccaagactccctacactgtgttccgctggtggcagccacagcagagtaaa
cactcagcccagtgggctctggatgatgttctgatcggtatgaatgacagctccaggact
ggcttccatgataagtttgacgggacgtctcctctgagacacaactggtaccgcatacag
gggggagagatcactgtagactgtctgtctctggacactgctctgtccttcaacagcgac
accactggcaagaagccgcggtatgcagaaagctgggactttgaggtgtcaggctcctcc
ttcctgcagtttgaactgtctatgggctgcagtaaggttgccacctcatcccacggtgtc
aggctggagtactccacggactgtgggcgccactgggccctgctcaccccagagtgtgtt
ccacctgccacggctgtgccggctacacatgagctcagtctcactgctacacagtataac
cgctggaggagggttacggtgtacctgcccagcactgccaattctcccaggactcggttc
aggtggccaaccccacttcatcccgggggcacggttggggccttggacaacgtgctgctg
ccctgcggcccctggatggtgcctggacacggactctgtgacaacggattcgtttgtgag
tgtgaccggggttatggcggggcccactgcgtgcccttggcccccctcccctccattctg
agagacgacttcaacgagaacctggcggcggagcagtggcccgaggtgtacggggctgag
agggggactctcagtggggagcccctcaaatctggcactgcactaatcttcaaaggggaa
ggtctgcgtatgttgatgtctagggacatggactgcaccagcactctctacatccagttc
tccttcaagttcatcactaagggtgtcccagagcgctcccactcggtgctactacagtac
tctgtgaacggggggatcagttggctgttgttagatgagttttacttccctacttccacc
gacacgctgttcatccaccttgctctgcccaccaatgcccagaccaacgctacccgcttc
aggctctggcagccctacaacagcggtaaaaaggaggaggtgtgggtgattgatgacctg
atcatcgatggcagctcgctcaacaaccctcctgtagtctctgacagcttcgagggcgga
ccccaggattacaactggctcttctacccaggaggcaacactggactctactgcccctac
cagaagagtggcctggaggatgatgagtctgccatggtgtttgtctccagtgagttggga
gaacattccataaccaccagagacattgatgtcaatgaaaacaccatcatacagtttgag
atcaacgtaggctgtacggcagattcttcctcctctaacccagtgagactggagttctcc
agggactttggggctacatggcatctcctggtgcccctgtgttcggggggcccccagccc
tcatccctatgctccacagagctgcaccccgccagcgtctactaccccgggacaacacag
ggctggaggagggagatcatccactttggaaagctcagactttgcggatccatccggttc
cgttggtaccagggcttctactccagcggttcatccccccctacctgggctttggacagt
gtgtacattggcccccagtgccaggacatgtgtaacggacacgggtcatgtgtgaggggt
acccaatgtgtgtgtgactcgggatactcaggaccagactgctcccaacccgacacatcc
aaccctgacttcctcaaggaagactttgaaggaggggcggtggatgctgacaggtttagg
ctgctgagtggagggaaacctagcaggaaatgtggcatcatgtccagtgggaaccacctg
ttcttcagcgaggacggccttcgcatgctggtcaccaacgacatggacctttccaacgca
aggtttattcagttcttcctgcgtctgggctgtggtaaggcctccccagacccccgctcc
cagcctgtcctgctccagttctctgtagacggggctctgacctggggcctgctgcaggac
ttcttcttctccaacagcagtaaccaagctcgcctcgtggccctggagatccctctgcgt
gcccgtacctccgccacgcgcctacgctggtggcagccctctgagaatggacacttctat
agtccatgggttattgaccaggtggtggtggggggcagtgccagtggctggggtccttta
gaagatgacttctcctctatggacgggcgttcttggctgctctaccccgggggtacccgc
atgcccgtgtgtggttctgacggggcggccttcgctttcatagaaaagtccaacacgcgc
tacgctgtcaccacagacatcagcctgggacaggatgctttcatacagtttgatttctca
gcttcatgctctgtcacaaactcctgctacgccattgagcttgagtattctctggacctg
ggtctgcactggcagcctctggtgcgtgactgtctccccaccagtcaagactgctcctcc
tacaccctacagagactgctggtggcagacacatacaacaagtggggccgagtcactctg
cccattcccatctacgccaggtctccagctacgcgtttccgttggttccagcaagctccg
tttgacaagcagcagacctgggctctggacaatctctacatcggagacggctgctccgac
atgtgctccggacatggacgctgccagcagagctcctgtgtgtgtgacccagagtgggaa
ggcgagtactgtgatgagcctgtggcccccctgccctcccagctgaaggacagtttcagc
cgggccccctctcttagccactggcacctggtaaccgggggaaagctcagcactgtttgt
ggggccgtggcatctggggctgcactgcacttcagcgggagttgtagtcgtcagctggtg
acggtggatctgaacctgaccaacgcagagttcatccagttctactttatgtatggctgc
atgaccccgccgagcaaccgtaaccagtgtgtactactggagttcagtctgaatggtgga
atcaactggatcctgttgacagagatcttttacgacctgtacagaaagcctggattcgtc
aatgtactgctgccccatgcggcccgtcaggagggtgtgcgtgtgcgctggtggcaaccg
acccacgaggggtccgaccacagtgactgggcactggataacgtcctaatcgctggttcc
gacccgcgggcacagatctctgacaccttcggaggggtggcgctgcctaaccacgagaga
gcgcccgctgatggtacccccacgggcaggataggcctgttgaatgagggagaggaggag
agcacctcagtgggtgatcactggctgttcagtgaggactgtgcggttcagaggttctgt
agctctccagacggagtcatggtgtgtggtaatgatgacggcagagaggtgtatgcagtc
acacatgacatcgtcccggacaaaggctgggtcatgcagttcaagattgtggtgggctgc
agtgtgccggagcgccatgccgagcatcaggtccatgtccagtattctgtggacttcggt
gtctcctggaggtacctggtgccccagtgtctacctgctgacccctgctgtggaggacag
atctcccagcccagtgtcttcttccctgcccagggttggaaaagggccgtctacccccta
acggacagcctggcagatacggcggtgcgtttccggttctaccagcagcacagtgatacc
cagtgggctgtggagaacctctacattgggccagcgtgtgacagccattgtgggggacat
ggagagtgtctggaccagcgatgtatctgtgaaccaggcttcactggacccagctgctac
gccagcactgcactcaagacatctctgaaggagcgttttgactgggagggggcgccgggc
cctcagtggcaggtgttggaggggggtcgtccctgtactgactgtggggttctggtggag
gggaccgctttgtactttggaggagcagacgccaggcaggccgtcaccgctgacctcgac
ctcagaggagccaagtttgtagagtactgggccaggataggaagtgaagacaacatgacc
atgtgccatcgcccaacctgtcgyaaagagggagtgctgctggactactccaaagacgga
ggtgtgtcctggaccctgcttcatgagatggactatctgaagtacgtgtctgtgaggcgt
gattacattgttttaccagagggggcgctgtctaacaccacgcggctgcggtggtggcag
cccttctctgtctcctccggtctggcatcacccgggctggagcgtgctcagtgggctgta
gacaacatcctggtgggagggtcygacatcaacccctccaccctgctcgacaccttcgat
gacgagggtgtgtcccacgaggagagctggaacttctatcccaatgcggtgcgtacggct
ggattttgtggcaacccatccttccacctctactggcccaacaagaaccaggacaaaaca
cacaacatcctagccacccgagagcttatagtacagcctggatacatcctacagttcaag
attgtggtgggctgtgaggcagacagctgtgaagaccaccattctgtcctgctgcagtac
agaaaggatgccaggtctgactcatggcagctggtccagtcagagtgtcttccctcctct
gtgaacaacgtgggctgctctcccttcatgttccatgaatctaccatctacagtcctgtc
aacagctctacctggacaagagtcactgtccagctgcctgaccacgtctcctcaggtgcc
acgcagttccgttggatccagaaggagggtgttggcgagcgtcacggctggggggtggac
cacatgtacattggggaggcgtgcccagggctgtgtagtggtcatggttactgtactagc
ggagtggtctgtatctgtgacgagggacaccatggtgatgactgctccctgtccggcagt
gacctacccagctccataaaggataactttgagtcaggtagcatgtcagaggagagctgg
caactcatccagggtggcggggtgggaagtgggtgtggtcagctttctccccacgcccac
ggtgactcgctctacttcaacggctgtaagatgaggcaggctgtcaccaagccactcgac
ctgacacgagccagtaagatcatgttcgtcctgcagataggtagtgtgtcccagacagac
agttgtaacacagccctggaccagcctgacacagtggacagagctgtgctgctacagtac
actgtcaataatggagttagctggcacgtgatcgcccagcaccagcccaaagacttcatc
aaggcccagagagtgtcctacaacatcccactagaagcgagagctaaaggggtgaagctg
cggtggtggcagccgcgtcacggcggtgtgggacatgaccagtgggcgctggaccatgtg
gaagtagttctagtcagcactcgtaaacaaaactatatgatgaactttgccagacagacc
ggcctacgccactactacagccggaagaggcgggcactgctacaacatcgtgcctaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112232479
Entry
112232479         CDS       T05605                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: reelin-like
  KO
K06249  reelin [EC:3.4.21.-]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112232479
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112232479
Enzymes [BR:otw01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     112232479
SSDB
Motif
Pfam: EGF_2 Reeler EB
Other DBs
NCBI-GeneID: 112232479
NCBI-ProteinID: XP_024255275
LinkDB
Position
Unknown
AA seq 3478 aa
MAWASVWGALGCALLALVLGTGVDLGSPPAAGFYPRFNPFFFLCTHHGELEGSGVAEGGG
EVLLTLQIAGHPTAYTPGQEYQVTVSTSVYFDGLLVTGLYTSTPVQSAPIPAPAAFGFGV
MPEQRQFRTQFVCSVVASHVSHQPSTSLSFVWIAPPPSTGCVNFLATATHRGQIIFKDAL
AQQLCEQGAPTESPLRPSLAEIHGNHAVLRDDFDSNLQGELDPRIWSECSNCEVGEQCGV
LMHGRAVTFCEPFRERELTTVPLNTTTASVLQFALGSGTCRFSYSDPSIIVAFSLNKNNS
TNDWITLEKIRAPTNSSTIVHLLPLPVQSRGDGVRVRWSQEAPQGPEGYESCWGLDNVLL
VNAAYIPPLLEDNLDPPDTANWLFFPGATVKRACQSEGNTLYFHGNNEEGVGHTFASTRD
IDLHREEGRSYWEEDFESLPTNWDIEGAVYGTHCGEIESGMALVFERDGERKMCTPYLDT
TSFGNLRFYFTMGGGECDPGESHENDVILFGRSEGRRDLVLLDTLPYSSYMTPSVVSVAL
STDLQTPITQFCLEQRAHGGANRHVWAVDFMQLLPVLPGTHTHVAQFSINLGCGSYQPAN
SVNLEFSTNHGRSWSLLHTECLPDLCAGPHLPHSTIYSSENYSGWTRISIPLPNAALTET
TQFRWRQSGMGAGNMWAIDNVYIGPSCLRFCSGRGQCSRTGCKCDPGFNGPACELASQTF
SAFLSEGFSSPRLSSYHSFSSLRGAEVSFGCGVLASGKALVFNRDSRRHLVTAPLDSSQA
RYLQFTLRLGSRSILSSCPAPDQPGEGVLLHFSSDNGITWILLQHYAYKGFHEPRIVSVE
LPPGARRFGVQFRWWQPYHSGRGHDVWAVDEITMTSVLFNTISLDFSNVLDVTQSLGFYL
GHVQPYCQHDWTLSFSGDPSPGSSIRYVETQSMQIGASYTLQFSLVMGCGRDPSPHIDTQ
VRLEFSTNHGLTWHLVKEACLPGMPSCSEFTAPSVYHPSEFTDWRRITLPLPHRAWSSAT
RFRWIQNYYGEQDEWALDDIYIGQQCLQMCHGHGWCDHGHCRCDEGFSGSDCQASSPLSS
SILSDFESQDGLLAVWQEVIGGEVVTPDMGCGVVSSGSSLYFSKAGLRQLVSYDLDTEWA
EFVQFYLRVGGDWVQCNMADSREEGVLLQYSNDGGISWGLIAEMYFTDFTKPRFVHYELP
QASKTPCTRFRWWQPLHSGDGYDQWAIDDVIILSEREKHIIPMANPTIPQNFYEKPAFDY
PLNQMSVWLLLGNEGMEKERNGSFCAPTPSAMVFGRSDGDRVAVTRDLVLRPGYTLQFKL
NIGCESQFSASASVLXQYSHDAGRTWALVKXGCYLGSSGAGGCEGSGRELREPTVYATGD
YESWTRVTIVIPRNVAASKTRFRWFQESSVYRDAPAFALDGVYISEPCPNHCGGHGDCIS
GVCFCDMGYTVEQDSCVPAVASPTELAEGFESKLSPVWQTLSGGQVGGGCGTISEGKALY
FSSPGKREARTVPMDTTNTRLVQFYIRIGGKNVGPTCTRPRSRNEGVIVQFSNNNGVQWQ
FLRELDFGSFLDSQVVTIELPPPAKTPYTVFRWWQPQQSKHSAQWALDDVLIGMNDSSRT
GFHDKFDGTSPLRHNWYRIQGGEITVDCLSLDTALSFNSDTTGKKPRYAESWDFEVSGSS
FLQFELSMGCSKVATSSHGVRLEYSTDCGRHWALLTPECVPPATAVPATHELSLTATQYN
RWRRVTVYLPSTANSPRTRFRWPTPLHPGGTVGALDNVLLPCGPWMVPGHGLCDNGFVCE
CDRGYGGAHCVPLAPLPSILRDDFNENLAAEQWPEVYGAERGTLSGEPLKSGTALIFKGE
GLRMLMSRDMDCTSTLYIQFSFKFITKGVPERSHSVLLQYSVNGGISWLLLDEFYFPTST
DTLFIHLALPTNAQTNATRFRLWQPYNSGKKEEVWVIDDLIIDGSSLNNPPVVSDSFEGG
PQDYNWLFYPGGNTGLYCPYQKSGLEDDESAMVFVSSELGEHSITTRDIDVNENTIIQFE
INVGCTADSSSSNPVRLEFSRDFGATWHLLVPLCSGGPQPSSLCSTELHPASVYYPGTTQ
GWRREIIHFGKLRLCGSIRFRWYQGFYSSGSSPPTWALDSVYIGPQCQDMCNGHGSCVRG
TQCVCDSGYSGPDCSQPDTSNPDFLKEDFEGGAVDADRFRLLSGGKPSRKCGIMSSGNHL
FFSEDGLRMLVTNDMDLSNARFIQFFLRLGCGKASPDPRSQPVLLQFSVDGALTWGLLQD
FFFSNSSNQARLVALEIPLRARTSATRLRWWQPSENGHFYSPWVIDQVVVGGSASGWGPL
EDDFSSMDGRSWLLYPGGTRMPVCGSDGAAFAFIEKSNTRYAVTTDISLGQDAFIQFDFS
ASCSVTNSCYAIELEYSLDLGLHWQPLVRDCLPTSQDCSSYTLQRLLVADTYNKWGRVTL
PIPIYARSPATRFRWFQQAPFDKQQTWALDNLYIGDGCSDMCSGHGRCQQSSCVCDPEWE
GEYCDEPVAPLPSQLKDSFSRAPSLSHWHLVTGGKLSTVCGAVASGAALHFSGSCSRQLV
TVDLNLTNAEFIQFYFMYGCMTPPSNRNQCVLLEFSLNGGINWILLTEIFYDLYRKPGFV
NVLLPHAARQEGVRVRWWQPTHEGSDHSDWALDNVLIAGSDPRAQISDTFGGVALPNHER
APADGTPTGRIGLLNEGEEESTSVGDHWLFSEDCAVQRFCSSPDGVMVCGNDDGREVYAV
THDIVPDKGWVMQFKIVVGCSVPERHAEHQVHVQYSVDFGVSWRYLVPQCLPADPCCGGQ
ISQPSVFFPAQGWKRAVYPLTDSLADTAVRFRFYQQHSDTQWAVENLYIGPACDSHCGGH
GECLDQRCICEPGFTGPSCYASTALKTSLKERFDWEGAPGPQWQVLEGGRPCTDCGVLVE
GTALYFGGADARQAVTADLDLRGAKFVEYWARIGSEDNMTMCHRPTCRKEGVLLDYSKDG
GVSWTLLHEMDYLKYVSVRRDYIVLPEGALSNTTRLRWWQPFSVSSGLASPGLERAQWAV
DNILVGGSDINPSTLLDTFDDEGVSHEESWNFYPNAVRTAGFCGNPSFHLYWPNKNQDKT
HNILATRELIVQPGYILQFKIVVGCEADSCEDHHSVLLQYRKDARSDSWQLVQSECLPSS
VNNVGCSPFMFHESTIYSPVNSSTWTRVTVQLPDHVSSGATQFRWIQKEGVGERHGWGVD
HMYIGEACPGLCSGHGYCTSGVVCICDEGHHGDDCSLSGSDLPSSIKDNFESGSMSEESW
QLIQGGGVGSGCGQLSPHAHGDSLYFNGCKMRQAVTKPLDLTRASKIMFVLQIGSVSQTD
SCNTALDQPDTVDRAVLLQYTVNNGVSWHVIAQHQPKDFIKAQRVSYNIPLEARAKGVKL
RWWQPRHGGVGHDQWALDHVEVVLVSTRKQNYMMNFARQTGLRHYYSRKRRALLQHRA
NT seq 10437 nt   +upstreamnt  +downstreamnt
atggcatgggcctctgtctggggtgccctcggctgtgccctgctggccctggtgttgggg
accggtgtggatttggggagccccccagcagcaggcttctacccccgcttcaaccccttc
ttcttcctgtgtacccaccatggggagctggaggggtccggggtagccgagggaggggga
gaggtgctcctcaccctacagatcgctgggcaccccactgcctacacccctggacaggag
taccaagtgactgtctccaccagtgtgtattttgatggtttgctggtgaccggtctctac
acgtccactcctgtccagtctgctcctatccctgctcctgctgccttcggcttcggtgtg
atgccagagcagcgtcagtttaggactcagtttgtgtgtagtgtcgtggcgtctcacgtc
agccaccagccctccaccagtctcagcttcgtctggattgctcctccacccagcaccggc
tgtgtcaacttcctggccactgctacacatcgaggacagatcatcttcaaggacgcactt
gcccagcagctgtgtgagcagggagcacctacggaatcgccattgagacccagtcttgct
gagatccatgggaaccatgcggtgctccgtgatgactttgactccaacctgcagggagag
ctggaccccagaatttggtcagagtgtagtaactgtgaggtaggagagcagtgtggggtt
ctgatgcatggcagagctgtcacattctgtgagcccttcagagagagagaactgaccact
gtacctctcaacaccaccacagcctctgtcctgcagtttgctcttggttcaggcacatgt
aggttcagttactccgaccccagcatcatcgtggcgttcagtctgaacaagaacaacagc
accaatgactggatcaccctggagaagatcagagctccaactaacagcagtacaatagtc
catctcctgcccctgccagtgcaatccaggggagatggggtgcgtgtacgctggtcccag
gaggccccccagggacccgaaggctacgagtcgtgctggggcctggacaacgtactcctg
gtcaacgctgcttacatacctcccctactggaggataatctggaccccccagacacagcc
aactggcttttcttccctggggctaccgtcaagcgtgcctgtcagtcagagggcaacacc
ctgtatttccatggcaacaatgaggagggggtgggccacaccttcgcctccaccagagac
attgacctccaccgagaggagggtcggagctactgggaggaggactttgagagtctgccc
accaactgggacatcgagggggctgtgtatgggacccattgtggggagatagagtcaggc
atggccctggtgtttgagagggatggagagaggaagatgtgtactccctacctggatacc
acctccttcggaaaccttcggttctacttcaccatgggtggtggggagtgtgacccagga
gagtcccatgagaatgatgtcatcttgtttggtaggtcagaggggagacgagaccttgtg
ctgttggataccctgccatactcctcttatatgactccgtcagtagtgtcagtagccctg
tccacagacctccagacccccatcacccagttctgcctggagcagcgggcacatggcggt
gccaaccgtcacgtctgggcagtagacttcatgcagttgctgcctgtccttcctggcaca
catacccatgtagcacagttctccatcaacctgggctgtgggtcctaccagcctgccaac
agtgtgaatctggagttttccaccaatcacggtcgttcctggtcgctgctccacacagag
tgtcttccagatttgtgtgctggcccccacctaccacacagcaccatctactcctcagaa
aactacagcggctggactaggatctccatcccacttcccaacgctgccttgactgagacc
acacaatttcgctggagacagagtggcatgggtgctggcaacatgtgggccatagacaat
gtgtacattggtccatcctgccttcgtttctgctctggaagaggacaatgctcccgcacc
ggctgcaagtgtgacccagggtttaatggtccagcatgtgagctggcatcccagacattc
tctgccttcctgtctgagggtttctcctcccccagactctcctcctaccacagtttctcc
tccctgaggggagcggaggtgagtttcggctgtggggttctggccagtggcaaggctttg
gtcttcaacagagacagcagacgacacctggtgaccgcaccgctcgacagctctcaggcc
aggtacctccagttcactttgcgtctgggaagtcgtagcatcctgagctcctgtcctgcc
cctgaccaaccaggagaaggtgtgttgctgcacttctcctcagacaatggcattacctgg
atcctgctgcaacactacgcatataagggcttccacgaacccaggattgtatcagtggag
ttaccccccggtgcccgtaggtttggggtgcagttccgttggtggcagccgtaccactct
gggcgtgggcatgacgtttgggcagtggatgagatcactatgacctctgtgctgttcaac
accataagtctggacttcagtaatgtacttgatgtcactcagagtctgggcttctacctg
gggcacgtccagccctactgccagcacgactggacactcagtttctcaggtgatcccagc
ccaggctccagtatccgttatgtggagacccagtccatgcagattggagcctcctacaca
ctgcagttctcattggtcatgggctgtggcagagacccctccccccacatcgacacacag
gtccgcctggagttctccaccaatcatggtctgacctggcacctggtcaaagaggcctgc
ctaccagggatgcccagctgttcagagttcactgctcccagtgtgtaccatccctctgag
ttcactgactggagacgcatcactctgcccctgcctcatagagcatggtccagtgccaca
cggttccgttggatccagaactactatggagagcaggatgaatgggctctggacgacatc
tacatcgggcagcagtgccttcagatgtgccacggacacggatggtgcgaccacggacac
tgcaggtgtgatgaaggtttctcaggttcagactgccaggcatcctctcctctttcttcc
agcatcctgtcagactttgagtcccaggatggtctgctggccgtgtggcaggaggtgatt
ggtggagaggtggtaacacctgacatgggctgtggggtggtctcctctgggtcctcgctc
tacttcagcaaggccggattgaggcagctggtgagctatgacctggacacagagtgggca
gagtttgtgcagttctacctgcgtgtgggcggagactgggtacaatgtaacatggcagac
agcagggaggaaggagtgctgctgcagtacagtaatgacggaggaatcagctggggactc
atcgctgagatgtacttcaccgacttcaccaagccacggtttgtccactatgagttgcca
caggcctctaagaccccatgtacccggttcagatggtggcagccccttcactctggggac
ggctacgaccagtgggccattgatgatgtcatcatcttgtcagagagagagaaacacatc
atccctatggccaaccccactataccacagaacttctatgagaagccggcgtttgactac
cctctgaaccagatgagtgtgtggctcctgctgggcaatgagggtatggaaaaggagagg
aacggcagcttctgtgctcccaccccctctgccatggtgttcgggcgatctgacggagac
agggtggcagtgaccagagacctggtcctaagaccagggtacacactgcagtttaagttg
aacatcggttgcgagtctcagttcagtgcatcggcctcagtcctgncgcagtactcccat
gatgctggccgtacctgggcgctggtgaagngaggctgttacctaggctcctctggggcg
ggtggctgtgagggcagtgggcgggagctcagggaacccactgtctatgccacgggagac
tacgaaagctggaccagggttaccattgtcattccgcgtaacgtggctgccagtaaaacg
aggttccggtggttccaggagagtagtgtgtacagggacgctccagcctttgccctagat
ggagtctatatctctgagccctgccccaaccactgtggaggacatggagactgcatctct
ggggtctgcttttgtgacatgggatacacagttgagcaggacagctgcgtgccagcggtg
gccagccccacagagttggcagagggctttgagagcaagctgagcccggtttggcagacc
ctgagtggggggcaggttggagggggctgtggcaccatcagcgagggaaaggctctgtac
ttcagcagccctgggaagagagaggcacgcactgtacctatggatacaacaaacacacgg
cttgtccagttctacatccgtattggagggaagaatgttggacccacctgcaccagacct
cgctcccgcaacgaaggagtgatagtccagttctccaacaacaacggagttcagtggcag
ttcctacgtgagctggactttggttccttcctggattcccaggtggtcaccatcgagctg
cctccacccgccaagactccctacactgtgttccgctggtggcagccacagcagagtaaa
cactcagcccagtgggctctggatgatgttctgatcggtatgaatgacagctccaggact
ggcttccatgataagtttgacgggacgtctcctctgagacacaactggtaccgcatacag
gggggagagatcactgtagactgtctgtctctggacactgctctgtccttcaacagcgac
accactggcaagaagccgcggtatgcagaaagctgggactttgaggtgtcaggctcctcc
ttcctgcagtttgaactgtctatgggctgcagtaaggttgccacctcatcccacggtgtc
aggctggagtactccacggactgtgggcgccactgggccctgctcaccccagagtgtgtt
ccacctgccacggctgtgccggctacacatgagctcagtctcactgctacacagtataac
cgctggaggagggttacggtgtacctgcccagcactgccaattctcccaggactcggttc
aggtggccaaccccacttcatcccgggggcacggttggggccttggacaacgtgctgctg
ccctgcggcccctggatggtgcctggacacggactctgtgacaacggattcgtttgtgag
tgtgaccggggttatggcggggcccactgcgtgcccttggcccccctcccctccattctg
agagacgacttcaacgagaacctggcggcggagcagtggcccgaggtgtacggggctgag
agggggactctcagtggggagcccctcaaatctggcactgcactaatcttcaaaggggaa
ggtctgcgtatgttgatgtctagggacatggactgcaccagcactctctacatccagttc
tccttcaagttcatcactaagggtgtcccagagcgctcccactcggtgctactacagtac
tctgtgaacggggggatcagttggctgttgttagatgagttttacttccctacttccacc
gacacgctgttcatccaccttgctctgcccaccaatgcccagaccaacgctacccgcttc
aggctctggcagccctacaacagcggtaaaaaggaggaggtgtgggtgattgatgacctg
atcatcgatggcagctcgctcaacaaccctcctgtagtctctgacagcttcgagggcgga
ccccaggattacaactggctcttctacccaggaggcaacactggactctactgcccctac
cagaagagtggcctggaggatgatgagtctgccatggtgtttgtctccagtgagttggga
gaacattccataaccaccagagacattgatgtcaatgaaaacaccatcatacagtttgag
atcaacgtaggctgtacggcagattcttcctcctctaacccagtgagactggagttctcc
agggactttggggctacatggcatctcctggtgcccctgtgttcggggggcccccagccc
tcatccctatgctccacagagctgcaccccgccagcgtctactaccccgggacaacacag
ggctggaggagggagatcatccactttggaaagctcagactttgcggatccatccggttc
cgttggtaccagggcttctactccagcggttcatccccccctacctgggctttggacagt
gtgtacattggcccccagtgccaggacatgtgtaacggacacgggtcatgtgtgaggggt
acccaatgtgtgtgtgactcgggatactcaggaccagactgctcccaacccgacacatcc
aaccctgacttcctcaaggaagactttgaaggaggggcggtggatgctgacaggtttagg
ctgctgagtggagggaaacctagcaggaaatgtggcatcatgtccagtgggaaccacctg
ttcttcagcgaggacggccttcgcatgctggtcaccaacgacatggacctttccaacgca
aggtttattcagttcttcctgcgtctgggctgtggtaaggcctccccagacccccgctcc
cagcctgtcctgctccagttctctgtagacggggctctgacctggggcctgctgcaggac
ttcttcttctccaacagcagtaaccaagctcgcctcgtggccctggagatccctctgcgt
gcccgtacctccgccacgcgcctacgctggtggcagccctctgagaatggacacttctat
agtccatgggttattgaccaggtggtggtggggggcagtgccagtggctggggtccttta
gaagatgacttctcctctatggacgggcgttcttggctgctctaccccgggggtacccgc
atgcccgtgtgtggttctgacggggcggccttcgctttcatagaaaagtccaacacgcgc
tacgctgtcaccacagacatcagcctgggacaggatgctttcatacagtttgatttctca
gcttcatgctctgtcacaaactcctgctacgccattgagcttgagtattctctggacctg
ggtctgcactggcagcctctggtgcgtgactgtctccccaccagtcaagactgctcctcc
tacaccctacagagactgctggtggcagacacatacaacaagtggggccgagtcactctg
cccattcccatctacgccaggtctccagctacgcgtttccgttggttccagcaagctccg
tttgacaagcagcagacctgggctctggacaatctctacatcggagacggctgctccgac
atgtgctccggacatggacgctgccagcagagctcctgtgtgtgtgacccagagtgggaa
ggcgagtactgtgatgagcctgtggcccccctgccctcccagctgaaggacagtttcagc
cgggccccctctcttagccactggcacctggtaaccgggggaaagctcagcactgtttgt
ggggccgtggcatctggggctgcactgcacttcagcgggagttgtagtcgtcagctggtg
acggtggatctgaacctgaccaacgcagagttcatccagttctactttatgtatggctgc
atgaccccgccgagcaaccgtaaccagtgtgtactactggagttcagtctgaatggtgga
atcaactggatcctgttgacagagatcttttacgacctgtacagaaagcctggattcgtc
aatgtactgctgccccatgcggcccgtcaggagggtgtgcgtgtgcgctggtggcaaccg
acccacgaggggtccgaccacagtgactgggcactggataacgtcctaatcgctggttcc
gacccgcgggcacagatctctgacaccttcggaggggtggcgctgcctaaccacgagaga
gcgcccgctgatggtacccccacgggcaggataggcctgttgaatgagggagaggaggag
agcacctcagtgggtgatcactggctgttcagtgaggactgtgcggttcagaggttctgt
agctctccagacggagtcatggtgtgtggtaatgatgacggcagagaggtgtatgcagtc
acacatgacatcgtcccggacaaaggctgggtcatgcagttcaagattgtggtgggctgc
agtgtgccggagcgccatgccgagcatcaggtccatgtccagtattctgtggacttcggt
gtctcctggaggtacctggtgccccagtgtctacctgctgacccctgctgtggaggacag
atctcccagcccagtgtcttcttccctgcccagggttggaaaagggccgtctacccccta
acggacagcctggcagatacggcggtgcgtttccggttctaccagcagcacagtgatacc
cagtgggctgtggagaacctctacattgggccagcgtgtgacagccattgtgggggacat
ggagagtgtctggaccagcgatgtatctgtgaaccaggcttcactggacccagctgctac
gccagcactgcactcaagacatctctgaaggagcgttttgactgggagggggcgccgggc
cctcagtggcaggtgttggaggggggtcgtccctgtactgactgtggggttctggtggag
gggaccgctttgtactttggaggagcagacgccaggcaggccgtcaccgctgacctcgac
ctcagaggagccaagtttgtagagtactgggccaggataggaagtgaagacaacatgacc
atgtgccatcgcccaacctgtcgraaagagggagtgctgctggactactccaaagacgga
ggtgtgtcctggaccctgcttcatgagatggactatctgaagtacgtgtctgtgaggcgt
gattacattgttttaccagagggggcgctgtctaacaccacgcggctgcggtggtggcag
cccttctctgtctcctccggtctggcatcacccgggctggagcgtgctcagtgggctgta
gacaacatcctggtgggagggtcrgacatcaacccctccaccctgctcgacaccttcgat
gacgagggtgtgtcccacgaggagagctggaacttctatcccaatgcggtgcgtacggct
ggattttgtggcaacccatccttccacctctactggcccaacaagaaccaggacaaaaca
cacaacatcctagccacccgagagcttatagtacagcctggatacatcctacagttcaag
attgtggtgggctgtgaggcagacagctgtgaagaccaccattctgtcctgctgcagtac
agaaaggatgccaggtctgactcatggcagctggtccagtcagagtgtcttccctcctct
gtgaacaacgtgggctgctctcccttcatgttccatgaatctaccatctacagtcctgtc
aacagctctacctggacaagagtcactgtccagctgcctgaccacgtctcctcaggtgcc
acgcagttccgttggatccagaaggagggtgttggcgagcgtcacggctggggggtggac
cacatgtacattggggaggcgtgcccagggctgtgtagtggtcatggttactgtactagc
ggagtggtctgtatctgtgacgagggacaccatggtgatgactgctccctgtccggcagt
gacctacccagctccataaaggataactttgagtcaggtagcatgtcagaggagagctgg
caactcatccagggtggcggggtgggaagtgggtgtggtcagctttctccccacgcccac
ggtgactcgctctacttcaacggctgtaagatgaggcaggctgtcaccaagccactcgac
ctgacacgagccagtaagatcatgttcgtcctgcagataggtagtgtgtcccagacagac
agttgtaacacagccctggaccagcctgacacagtggacagagctgtgctgctacagtac
actgtcaataatggagttagctggcacgtgatcgcccagcaccagcccaaagacttcatc
aaggcccagagagtgtcctacaacatcccactagaagcgagagctaaaggggtgaagctg
cggtggtggcagccgcgtcacggcggtgtgggacatgaccagtgggcgctggaccatgtg
gaagtagttctagtcagcactcgtaaacaaaactatatgatgaactttgccagacagacc
ggcctacgccactactacagccggaagaggcgggcactgctacaacatcgtgcctaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112233141
Entry
112233141         CDS       T05605                                 

Definition
(RefSeq) thrombospondin-1-like
  KO
K16857  thrombospondin 1
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04115  p53 signaling pathway
otw04145  Phagosome
otw04350  TGF-beta signaling pathway
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    112233141
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112233141
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    112233141
  09143 Cell growth and death
   04115 p53 signaling pathway
    112233141
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112233141
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112233141
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:otw00536]
    112233141
   04990 Domain-containing proteins not elsewhere classified [BR:otw04990]
    112233141
Membrane trafficking [BR:otw04131]
 Endocytosis
  Phagocytosis
   Opsonins
    112233141
Glycosaminoglycan binding proteins [BR:otw00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   112233141
Domain-containing proteins not elsewhere classified [BR:otw04990]
 Thrombospondin domain-containing proteins
  Thrombospondins
   112233141
SSDB
Motif
Pfam: TSP_C TSP_3 TSP_1 TSP1_spondin VWC TSP1_ADAMTS EGF_3 EGF_CA Laminin_G_3 cEGF EGF TSP1_CCN Laminin_G_2
Other DBs
NCBI-GeneID: 112233141
NCBI-ProteinID: XP_024256317
LinkDB
Position
Unknown
AA seq 1172 aa
MKLIGIFLLLVLWTCEGSRVAESGDDNGVYDLFELVKVNKRHQGVTLVKGADPYSPAYKV
LNADLIPPVPEISFRDLIDSVQAERGFLLLVNFKQFKKTRGSILTVEKNDGSGPIFEIIS
NGKAQTLDVVYSTGNKQQVVSIEDADLATGHWKNITLFIQEDRAQLFVGCEEINISEIDV
PIQKVLTHEVADIARLRIGKGAVKDRFMGVLQNVRFVFGTTLEAIMRNKGCQSSETLADV
MTLDNPVNGSSPAIRTDYTGHKSKEIQQVCGFSCEDITSMFKELKGLGVVVKQLSNELNR
VNKESTLLMNQMRIHRGVCLHNGIVHKDKDEWTVDGCTECTCQNSATVCRKISCPLMPCA
NATVPDGECCPRCGTPSDYAEDGWSPWSEWTHCSVSCGRGIQQRGRSCDRINSNCEGTSV
QTRDCYPQECDKRFKQDGGWSHWSPWSSCSVTCGEGVITRIRLCNSPTPQMGGRDCQGQG
RETEVCQKSPCPIDGVWGPWSLWDTCSVTCGGGFQTRQRLCNNPTPKYGGKECQGDGKTS
QLCGKEDCPIDGCLSNPCFAGAKCISFDDGSWKCGACPVGYTGDGINCKDIDECKEVRDA
CFTLNGVHRCENTEPGYNCLACPPRYSGQQPFGRGVEQATAKKQVCTPRNPCQDGSHDCN
KNANCIYLGQFSDTMFRCECKPGYAGNGHICGDDTDLDGWPNKDLLCVENATYHCKKDNC
PNLPNSGQEDHDKDGLGDACDHDDDNDGIPDDRDNCPMVYNPAQYDVDRDDVGDRCDNCV
HESNPDQVDTDNNGEGDACAIDIDGDGILNERDNCPYVYNVDQRDTDGDGVGDHCDNCPL
ENNPDQIDSDSDRVGDKCDNNQDIDEDGHQNNLDNCPYIPNANQADHDKDGKGDACDHDD
DNDGIPDDKDNCRLAFNPDQLDSDGDGRGDVCKDDFDQDNILDIYDVCPENFDISETDFR
RFQMVPLDPKGTSQIDPNWVVRHQGKELVQTVNCDPGIAVGFDEFNAVDFSGTFFINTDR
DDDYAGFVFGYQSSSRFYVVMWKQITQTYWSHTPTRAQGYSGVSIKVVNSTTGPGEHLRN
ALWHTGDTAGQVRTLWHDPKNIGWKDYTAYRWHLIHRPKSGLIRVVMYEGKRIMADSGNI
YDNTYAGGRLGMYVFSQEMTYFSDLKYECKDS
NT seq 3519 nt   +upstreamnt  +downstreamnt
atgaagttgataggaatatttctccttttggtgctttggacttgtgagggcagccgggta
gcagagagtggagatgataacggtgtatacgacctattcgagcttgtgaaagtgaacaag
aggcaccaaggagttaccttggtaaaaggcgcagatccctacagcccagcctataaggtc
ttgaacgcagacctgatccccccggttcccgagatctccttcagggacctcattgattca
gtacaagctgaaagaggattccttctcctcgtcaacttcaagcagttcaagaaaaccagg
ggtagtattttgactgtggagaagaatgacggatcaggaccgatattcgaaattatttct
aatggcaaggcgcaaactctggatgtggtatactccaccgggaacaagcaacaggtagtg
tccatagaagatgcagatctagcgacaggacattggaagaatatcacgctgttcattcag
gaagatcgtgcccagctgttcgtaggatgtgaagagatcaatatatccgaaatagacgtg
cccatccaaaaggtcctgacgcatgaggttgctgacattgcccgtctgagaattggaaaa
ggagctgtgaaagacagatttatgggagtgcttcagaacgtgcgcttcgtttttggaacc
acgttggaggcaatcatgcgcaataagggatgccaaagctctgaaacattggctgatgtc
atgaccctggacaacccagtcaatgggtctagcccagcaataaggactgattacactggc
cacaaaagcaaagaaattcagcaggtctgtggcttttcctgtgaggatatcaccagcatg
ttcaaggagctcaagggactcggcgtggttgttaagcagctgtcaaacgagctcaacaga
gtgaataaggagagcactctgctcatgaaccagatgagaatccaccgtggggtctgtctt
cacaacggcattgtgcacaaggacaaagatgagtggaccgtggacggctgcacagagtgt
acctgccagaactctgccactgtgtgtcgcaaaatctcttgtcccctgatgccctgtgcc
aacgccaccgtgcccgatggagagtgctgcccacgttgtggaaccccgagtgactatgct
gaggatggctggtccccctggtctgaatggactcattgttctgtgtcttgtggacgggga
atccagcagcgcggtcgatcatgcgaccgcatcaacagcaattgcgagggcacctctgtg
cagacccgcgactgctaccctcaggaatgtgacaagcgcttcaagcaggatggtggttgg
agccactggtctccctggtcctcctgctctgtgacctgtggtgaaggagtcatcacccgc
attcgcctttgcaactccccaactccccagatgggaggcagagactgccaaggacaaggc
agagagaccgaggtctgccagaaatcaccatgtccaattgacggagtctggggaccctgg
tctttatgggacacctgctctgtcacctgtggaggtggattccagactcgccagcgtctt
tgtaacaaccctacccccaaatacggaggaaaggaatgtcagggcgatggcaaaacatcc
caactgtgtggaaaagaggactgccctattgatggctgtctgtccaacccctgctttgct
ggtgctaagtgtatcagctttgatgatggttcctggaagtgtggcgcatgcccagtgggc
tacaccggagacggcatcaactgcaaggacatcgatgagtgcaaggaggtccgtgacgca
tgcttcacactcaacggagtccaccgctgtgagaacactgagcctggttacaactgcctt
gcctgcccccctcgctactcaggacaacagcccttcgggagaggagtggagcaggcaaca
gccaagaaacaggtgtgcacaccccgtaacccctgccaagacggcagccatgattgcaac
aagaatgccaactgtatctacctgggtcagttcagcgacactatgttccgctgtgagtgc
aaaccaggttacgctggcaatggtcacatctgtggagatgacactgacctggatggatgg
cccaacaaagacctcctatgtgtggagaatgccacctaccactgcaagaaggacaactgt
ccaaaccttcccaactctggacaggaggatcacgacaaagatgggcttggtgacgcttgc
gatcacgatgatgacaatgatgggatccctgatgatagggacaactgcccaatggtctac
aaccccgctcagtatgatgtggacagagatgacgttggtgatcgatgtgataactgtgtg
catgagagtaaccccgaccaagtcgacacagacaacaacggagagggggatgcctgtgct
attgacattgacggtgatggcattctaaatgagagggacaactgcccatacgtctacaat
gtggaccagagagacactgacggggatggagtgggagaccactgcgacaattgccctctt
gaaaacaacccagaccagattgactctgactcagaccgtgtgggagacaagtgcgacaac
aaccaggacattgatgaggacggtcatcagaacaacttggacaactgtccctatatcccc
aatgccaaccaggctgaccacgacaaagacggcaagggtgacgcctgtgaccacgatgat
gacaacgacggtatccctgacgacaaggacaactgtaggctggcctttaaccctgaccag
ctggactctgatggtgatggtcgtggagatgtttgcaaagatgactttgaccaagacaac
attcttgatatctacgatgtgtgccctgagaactttgacatcagtgagacggacttccgc
aggttccagatggtaccactagaccccaagggaacctcccagatcgaccccaactgggtg
gtccgtcaccagggcaaagaactggtgcagaccgtcaactgtgaccctggcatcgctgtt
gggttcgatgagttcaacgcagtggacttcagtggaacgttctttatcaacacagacagg
gacgatgactatgctggatttgtgtttgggtaccagtccagctccaggttctacgtggta
atgtggaagcagatcacacagacctattggtcccacacgccgaccagagctcagggctac
tccggagtgtccatcaaagtggtcaactccaccacaggacctggggagcatctgaggaac
gccctctggcacaccggtgacactgctggacaggtgcgtactctgtggcacgaccccaag
aacatcggctggaaagactacactgcctacagatggcacctgatccaccggcccaagtct
ggactcatcagagttgtgatgtatgaaggcaagagaatcatggccgattccggaaatatc
tacgacaatacctatgctggtggaagactaggcatgtatgtcttctctcaggagatgaca
tacttctcagacctcaaatatgaatgcaaagattcttaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112233319
Entry
112233319         CDS       T05605                                 

Definition
(RefSeq) tenascin-X-like
  KO
K06252  tenascin
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112233319
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112233319
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:otw00536]
    112233319
Glycosaminoglycan binding proteins [BR:otw00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   112233319
SSDB
Motif
Pfam: Fibrinogen_C fn3 EGF_Tenascin EGF_2 hEGF EGF
Other DBs
NCBI-GeneID: 112233319
NCBI-ProteinID: XP_024256638
LinkDB
Position
Unknown
AA seq 1173 aa
MPLVPSFLILLLTCPALLTPSASQDLQPGGQRAPRDTKPEGGGQPIKVVISEACVQGDSS
QTQGKELDLEPGSALVLTHRIRLVPGSCAGGCEAEFAALRDRLERLEKEVSTLREKCGGP
EGGCCTSQQSKGAECSIKPEGDECPNECSDQGRCEDGKCVCFPGFSGPDCSLSDCPGNCN
DKGKCVNGQCVCDPGFTGPDCSSESCPGNCNNKGRCVNGQCVCDSGFTGPDCSSESCPGN
CNNKGRCVNGQCVCDSGFTGPDCSSESCPGNCNNKGRCVNGQCVCDSGFTGPDCSTKACP
GNCNNKGRCVNGQCVCDSGFTGPDCSSESCPGNCNNKGRCVNGQCVCDPGFTGPDCSTKA
CPGNCKNGGKCVNGKCVCDSSFTGPDCSTKSCPGNCSNRGKCVNGQCVCDSGFTGPDCSA
KACPNNCSNKGRCVNGKCVCEVGFSGQDCAAKGCPNNCSNKGRCVKGRCVCRRGFAPPDC
SQCEAGFTGADCGTAMSGVSQLNTKDITESSVTLYWTPPPVQYDTYHVTFTSQKEGDQQI
TSQVGGKLTTYTQTGLAAGQEYTVTIKGEINRRMGTESTVEFTTLISGPTNLRVVKTTTT
SAVVQWEQSQGHVDRYRLTVAPNQTDGTAKGRQDLTLPPERDSAQIDGLDPGHLYDITLV
AEKGGIKSKPATVQVTPGPEPPSGLVFSEVTETSFSVSWTKPKGPVSGFKVTYTNTQEGE
PLSATVDSGDSTLALSKLSPGSSYEVSVISVLGLDESDAIKDLVMTLPDPPRDLRAINVT
DTKALLLWRPALAPVDHYVIVYGSEKGSDDAKITVSGNAAEQQLKGLQGSTRYTVTVTSQ
LGNLDSSAAITVFTTTGGSRGDGEVPRDLKASQVTPRSALLTWKAPSAAVGSYKLTYQTE
GQEIKEVTIDSTVTEFKLTRLHPMSKYTVHLQGERGGSYTATISTEFTTGNLRYPFPSDC
SQELLNGIHESGEVEIFPRGRQGKPVLVYCDQVTDGGGWTVFQRRMDGKTDFFRGWKNYS
KGFGELSGEFWLGNENLHNLTSMAPMTLRVDLRAGDESVFAKYSAFTVDTVRRNYALKVS
GYSGTAGDSMSYHNARMFSTRDRDPTPFITRCAMSYRGGWWYKNCHEANLNGLYDTSVNH
QGVIWTAWKGKDLSIPFTEMKLRPTSFTPPTQG
NT seq 3522 nt   +upstreamnt  +downstreamnt
atgcctcttgtcccatccttcctcatcctgctcctcacctgccctgccctcctgacccca
tcagcttcccaggacctgcagcctgggggtcaaagggcacccagggacacaaagccagaa
ggtggcgggcagccaatcaaagtagtgatctctgaggcgtgtgttcagggggactccagt
cagacccagggcaaggaactggaccttgagcctggttctgctctagtccttacccatcgg
atccgactggttccggggtcgtgcgcaggcgggtgcgaggccgagtttgctgccctgcga
gaccgtctggagaggctggagaaggaggtgtcaacattgagggagaagtgtggaggccca
gaggggggctgctgcacgtcccagcagagtaaaggtgcagagtgctccatcaagccggag
ggagacgagtgtcctaatgagtgcagtgaccagggacgctgtgaagatggcaagtgtgtc
tgcttcccagggttcagtgggcccgactgcagtttgtctgactgccccggcaactgcaat
gacaaggggaagtgtgtgaacggccagtgtgtgtgcgacccaggtttcacagggccagac
tgctcttcagagtcctgtcctggaaactgtaacaacaagggccgatgtgtgaacgggcag
tgtgtgtgcgactcgggtttcacggggccagactgctcttcagagtcctgtcctggaaac
tgtaacaacaaggggcgatgtgtgaacgggcagtgtgtgtgcgactcaggtttcacgggg
ccagactgctcttcagagtcctgtcctggaaactgtaacaacaaggggcgatgtgtgaac
gggcagtgtgtgtgcgactcaggtttcacagggccagactgctccaccaaggcatgtcct
ggaaactgtaacaacaaggggcgatgtgtgaacgggcagtgtgtgtgcgactcaggtttc
acggggccagactgctcttcagagtcctgtcctggaaactgtaacaacaaggggcgatgt
gtgaacgggcagtgtgtgtgcgacccaggtttcacagggccagactgctccaccaaggct
tgtcctggaaactgcaaaaacggggggaaatgtgtgaacggtaagtgtgtgtgtgatagc
agttttacaggcccagactgctccaccaagtcctgccctggcaactgcagcaaccgtgga
aagtgtgtgaacggccaatgtgtctgcgatagcggctttacggggccggactgttccgcc
aaagcatgtcccaataactgcagcaacaagggaaggtgcgtgaacgggaagtgcgtgtgt
gaagtgggcttcagcggacaggactgcgccgctaagggctgtcccaataactgcagcaac
aaagggcgctgcgtgaaggggaggtgtgtgtgtcgccgtggtttcgcccccccggactgc
agccagtgtgaagctgggttcactggagctgactgtggcaccgccatgtctggtgtgtcc
cagctcaacaccaaggacatcactgaatcctctgttaccctctactggacaccacctcca
gtccagtatgacacctaccacgtcaccttcaccagccagaaagagggcgatcaacagata
acatctcaagttggtgggaagctcacgacctacacccaaacaggactggcggccgggcag
gagtacacggtgacaatcaagggagaaataaataggagaatgggcactgagagcacagta
gaattcacaacccttatctctggacccacaaaccttcgagttgtgaagacaaccacaaca
tctgcagttgtccaatgggaacaatcgcaaggacacgtcgacaggtatcgcttaactgtt
gcacccaatcagacggacggaacagccaagggaagacaagacctgacactgccccctgag
agggactctgcccagattgacggtttggacccgggacatttgtatgacatcacactagtg
gctgaaaagggcgggatcaagagcaagccagcaacagtccaagtcactcctggtccagag
cctccctcaggtcttgtcttcagtgaagtgactgagacgtctttctctgtgtcctggacc
aagccaaaaggtcccgtgagtggcttcaaggtcacctacactaacacacaggaaggggag
cctctctccgcaacggtggactctggggattccactctggcactgtcaaagctctctcca
gggtcctcctatgaggtcagtgtgatatccgtccttggactggacgagagcgatgcaatc
aaagacctggttatgacactccctgaccctccgagggatctccgggccattaatgtcaca
gacaccaaggccttgctgctatggcgaccagcactggcaccagtcgaccattacgtcata
gtttatggctctgaaaaagggtcagatgatgccaagatcactgtatcgggcaatgcggcg
gagcagcagctgaaaggcctacagggctccactaggtacaccgtcacagtcaccagtcag
ctgggcaacctggacagctctgccgccatcaccgtcttcaccaccaccggtggatccagg
ggagacggggaagttccgcgtgacctgaaggccagtcaggtgactcctcgctcagcgctg
ttgacgtggaaagcaccctctgccgccgtgggaagctacaagctgacctatcaaacggag
ggacaggagataaaggaggttaccattgactccacagtaacagagttcaaattgaccagg
ctgcatcccatgtccaagtacaccgtgcatctacagggggagaggggagggagctatact
gctacaatttccactgagttcaccacagggaatctccgataccccttcccaagtgactgt
tcccaggagctgctaaacgggatacacgagtctggagaggtggaaatcttccccagggga
aggcaggggaaaccagtgctggtctactgcgaccaggtgactgatggaggtggctggacg
gttttccagagaaggatggatgggaaaacggacttcttcagaggctggaaaaactacagc
aaaggttttggagaactgagtggggaattttggctgggtaatgagaacctacacaatcta
accagcatggcaccaatgaccctacgtgtggacctccgtgcaggggacgaatcagtgttt
gccaagtactctgcattcacagtggacactgttagaaggaactatgctctcaaagtgtct
gggtacagcggtacagcaggtgactctatgagttaccacaacgcgcgaatgttctctacc
agagacagagaccccacgcctttcatcacccgctgcgccatgtcctatagggggggttgg
tggtacaagaactgccacgaggccaaccttaatggcctctacgacaccagtgtcaatcat
cagggtgtgatctggactgcctggaaaggcaaggacttgtccatccctttcaccgagatg
aagctccgaccaacatctttcacccctccaactcagggataa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112234309
Entry
112234309         CDS       T05605                                 

Definition
(RefSeq) collagen alpha-2(IX) chain-like
  KO
K08131  collagen type IX alpha
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112234309
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112234309
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:otw00535]
    112234309
Proteoglycans [BR:otw00535]
 Extracellular matrix (ECM) proteoglycans
  Collagen family
   112234309
SSDB
Motif
Pfam: Collagen
Other DBs
NCBI-GeneID: 112234309
NCBI-ProteinID: XP_024258142
LinkDB
Position
Unknown
AA seq 684 aa
MSGLSAVLKSWVILQTLCLALAQVNGPPGPQGNPGPPGPSGTPGSDGIDGEKGPPGPSGP
PGLKGDPGEPGPDGPPGENGIDGLMGPKGDGGPIGNPGPKSNGSISIVQSNDSQIWWSRL
GSFWGPGLPGLAGAPGPIGLPGEIGQTGPTGILGEPGPPGIPGPPGKPGPPGKFLGGEEG
SADFQCPINCPAGPKGPQGLQGVKGHKGRAGVLGEPGSIGKLGTKGEVGISGEQGIPGPP
GPMGLRGYPGMMGPKAEAGRRDLRDTHGELGRRRFRWSRYQGPTRSCWQEGRERSAWYRW
KGWHSWHPWNQGCPRAGWEAWWSRSPGNSRFAWQPRTKGGPGGKGEPGPRGHVGMSGAPG
PQGEPGLPGEAGMEGVPGPKGDRGQRGAVGPQGIVGKAGNKGMRGPMGVPGAQGISGTKG
DKGFQGKVGAKGDFGDPGVEGLAGEKGEKGLGGEPGPKGQQGVRGETGFNGPTGDSGKPG
DQGPGGLPGPRGLNGERGVPGMPGIVGAAGRDASDQHIIEVVLKMLQERLAAVAVSAKRA
VLGGAGVMGPPGPPGPPGAPGAQGPHGLTGARGIPGMFGASGQIGNTGLKGKRGAKGDRG
DPGKPHAGQPGPPGITGPSGIDGVARNGKPGERGPQGSAGEAGRPGKAGPTGLPGFCEAA
ACLAASAYTSPRLQDSARVKGPGV
NT seq 2055 nt   +upstreamnt  +downstreamnt
atgtctggactctcggcagtgttgaagagctgggtcatcctgcagactctgtgcctggct
ctggcccaagtgaacggtcctccaggacctcaaggcaatcccggtccgcccggtccctct
ggcacccccgggtctgatggcattgatggggaaaaaggacctcctgggccttctggccca
ccagggttgaagggggacccaggtgagcctggtccagatggacctcccggagagaacggc
atcgacggtttgatgggaccaaagggagacggcggccctattgggaaccctggacctaag
agtaatggaagcatctcaatagtccaaagcaatgattctcaaatttggtggtcacggctc
ggtagtttctggggacccggactgcctggactggctggagccccaggcccaatcggcctt
cccggtgagattggacagactggacctacgggcatattgggagaacctggacctccagga
attccaggacccccaggaaaaccaggtcctccggggaagttcttgggaggagaggagggc
agtgcagacttccagtgtccaatcaactgcccagcagggcctaagggtccccagggtctg
cagggggtcaagggacacaaaggtcgtgctggtgtgctgggagagccaggcagcattggg
aaactgggtacgaagggagaggtcggcatctctggtgagcagggaatcccaggacccccg
ggtcctatgggattgaggggttacccaggaatgatgggccccaaggcagaggcggggagg
agggacctcagggacacacatggagagctggggagaaggagatttaggtggtcgaggtat
caagggcccacaaggagctgttggcaagaagggagagaacggtctgcctggtatcgatgg
aaaggatggcactcctggcatccctggaatcaagggtgccccagggcaggctgggaggcc
tggtggtcccggtcaccagggaacagcaggtttgcctggcagccccgaaccaagggtgga
cctggaggcaagggagagcctggtcccagaggtcatgtcggaatgtctggtgccccagga
cctcagggtgagcctggtcttcctggtgaagctggtatggagggcgttcctggacctaag
ggtgacagaggccagaggggagctgtagggccacagggtattgtcggcaaggctggcaac
aagggtatgagagggcctatgggtgtcccaggggctcaaggcatctcaggaaccaaggga
gacaagggattccaaggaaaagttggggcgaagggagactttggtgatcctggtgtagaa
ggcttggctggagagaaaggagagaagggtttgggtggtgagcctggacccaaaggacag
caaggagtgaggggagagacagggttcaatggccccacaggagactcaggcaaaccagga
gaccagggaccaggaggactgcctgggcctcgcggactcaatggggagagaggagttcca
ggcatgccaggcattgtgggggcagcaggacgggatgcatcagaccagcacatcattgag
gtggttctgaagatgctgcaagagcgtctggcggctgtagcggtgagcgctaagcgtgcc
gtactgggtggagccggtgtcatgggtccccctggtcctcctggacccccaggagctccc
ggggctcagggcccacacggcctcaccggcgcccgcggcatccctggcatgtttggagcc
tccggacagatcggcaacacgggactgaaaggaaagagaggagcgaagggagacagagga
gatcctggtaaaccacatgctggccagccaggacccccgggaataacaggtccctctggt
attgacggagtggctcgaaacggtaagcctggtgagcgaggcccccagggctcggcagga
gaggctggccgtcctggtaaggcgggccccactggtcttccagggttctgtgaggctgca
gcctgcctagctgcctcggcctacacctcccccagactacaggactccgccagggtcaag
ggcccaggagtctaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112234737
Entry
112234737         CDS       T05605                                 

Definition
(RefSeq) vitronectin-like
  KO
K06251  vitronectin
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112234737
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112234737
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112234737
   00536 Glycosaminoglycan binding proteins [BR:otw00536]
    112234737
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   112234737
Glycosaminoglycan binding proteins [BR:otw00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   112234737
SSDB
Motif
Pfam: Hemopexin Somatomedin_B
Other DBs
NCBI-GeneID: 112234737
NCBI-ProteinID: XP_024258789
LinkDB
Position
Unknown
AA seq 655 aa
MRLRLILLLAGLATVFAAEESCMDRCENGFDSKKDCQCDTMCRYYKSCCSDYETTCHMKT
RGDTFEFAEDDDGPFTPTTPAFPTQPEDRASRTSGGQHRQPTRIRTPNTTPTPAKIATKI
TPVTEPARGAARGPQRGQVPGVVPLPEAAKATKAPSATQAGRGSDRGQFPAVVPLPETAI
ATEATSVLQTTTEEVVTTTKAPVVDPDAEPCSSRPWDSLMQLKNGSVYAFRGEWFFELDE
KSVMPGYPKLIQDIWGIRGPIDAAFTRINCQGKTYMFKGNKYWRFDDGVLEADYPRDINV
GFEKIPDDVDAAFAIAAPGHHSKEKVYFFKGDQYYQYEFKHQPSHEECIKMAAESPSALF
TAYTDIYHNNWEELFNMLFRGIPNHHGGHRFINKDWIGIKAPVDAVMTGRLYITPRPLAP
PLFPPVPPLRDHNDGRRQPWDQQWGQYGQQDQLNGQQNGQQYGQQGQQYGQQWEQQWGHR
RSRRQSYWGAGTGMAMGQAFTEKGMDMGKRFAEKGLDLGRKLVERRMAMGQALAEKGMFG
GWDMRRTDARDEDRDRDRRRVDQDRRRDDQDRGRDDQDRRDGYNYDSRYNAEGRAYWEFV
NKGQPVQSVYFFKGDKYYRVDLKTKKVDPASPPYPRSIGKYWLGCPEKHLEAEKK
NT seq 1968 nt   +upstreamnt  +downstreamnt
atgaggctcaggctgatactcctgctagccgggctagctactgtgtttgctgcagaggag
tcatgcatggaccgctgtgagaatggcttcgactccaagaaggattgccagtgtgacacc
atgtgtcgatactacaagagctgctgctcagactacgagaccacctgtcatatgaaaaca
cgtggggacacctttgaatttgcagaggatgatgatggtccatttacccctacaacgccc
gccttcccgacccaacctgaagacagggcatccagaacctcagggggccaacataggcaa
cccacacgcatcagaacccccaacaccacccctactcctgccaaaattgccacaaagata
accccagtcacagagccagctagaggcgcagctcgaggcccacagagaggccaggtccca
ggggtagtcccactcccggaggcagctaaagccaccaaggcaccgtcggcaacacaggca
ggtagaggctcagatagaggccagttcccagcggtagtcccactcccagagacagctata
gccaccgaggcaacatcagtcctacagacaaccacagaggaagtggtgacgaccaccaag
gctccggtagtagacccagatgctgagccatgcagcagcaggccctgggactccctaatg
cagctcaagaacggctctgtctacgccttcagaggggagtggttctttgagctggatgag
aagtcggtgatgcccggctaccccaaactgatccaggacatctggggtatcagagggcct
atagatgctgcctttacacgtatcaactgccagggcaagacatacatgttcaagggtaac
aagtactggcggtttgatgatggtgtgctggaggcggactatcccagagatatcaacgtg
ggctttgagaagataccagacgacgtggacgcagccttcgccatagcagcccctggacac
cacagcaaagagaaggtctacttcttcaaaggtgaccagtactaccagtatgagttcaag
caccagccatcacatgaggagtgtatcaagatggcagctgagtctccctccgctctgttc
acagcctacactgacatctaccacaacaactgggaggaactcttcaacatgctcttcaga
ggcatccccaaccaccatggtgggcatcggttcatcaacaaggactggataggcatcaag
gccccagtggacgctgtcatgacagggagactctacatcacccccaggccactggcccca
cccctgttcccacccgtaccccctttacgggaccacaacgacgggaggcgccagccatgg
gaccaacagtgggggcagtatggtcaacaggatcagttaaatggacagcaaaatggacaa
caatatggacaacaagggcaacaatatggacagcagtgggaacagcagtggggccaccgc
agaagtaggcgccagtcttactggggtgccgggacgggaatggctatggggcaggcgttc
acagagaaggggatggatatggggaaacgattcgctgagaagggtttggatcttggtcgg
aagctggtggaaaggaggatggctatggggcaggcgttagcagagaaggggatgtttgga
gggtgggacatgcgccgaacggatgccagggatgaagacagagacagggatagaaggagg
gttgaccaggataggaggagggatgaccaggacagggggagggatgaccaggacagaaga
gatggatacaactatgactccagatacaacgctgaggggagggcctactgggagtttgtc
aacaagggccagccagtgcagagcgtctacttcttcaagggagataaatactacagagtg
gatctgaagaccaagaaagtggacccagccagccctccttaccccaggtccattggcaag
tactggctgggctgccctgaaaaacacctggaggccgagaagaaatag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112236423
Entry
112236423         CDS       T05605                                 

Definition
(RefSeq) thrombospondin-2-like
  KO
K04659  thrombospondin 2/3/4/5
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04145  Phagosome
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112236423
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    112236423
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112236423
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112236423
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112236423
   00536 Glycosaminoglycan binding proteins [BR:otw00536]
    112236423
   04990 Domain-containing proteins not elsewhere classified [BR:otw04990]
    112236423
Membrane trafficking [BR:otw04131]
 Endocytosis
  Phagocytosis
   Opsonins
    112236423
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   112236423
  Exosomal proteins of colorectal cancer cells
   112236423
  Exosomal proteins of bladder cancer cells
   112236423
Glycosaminoglycan binding proteins [BR:otw00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   112236423
Domain-containing proteins not elsewhere classified [BR:otw04990]
 Thrombospondin domain-containing proteins
  Thrombospondins
   112236423
SSDB
Motif
Pfam: TSP_C TSP_3 TSP_1 TSP1_spondin VWC TSP1_ADAMTS EGF_3 EGF_CA cEGF TSP1_CCN EGF
Other DBs
NCBI-GeneID: 112236423
NCBI-ProteinID: XP_024260782
LinkDB
Position
Unknown
AA seq 996 aa
MFVAKGSIRENHFRGLLQNVRFMFDTSVDDVLRNKGCEVTKPDEANTVVSESTDMEDVSS
STAITTNFIGQKTENLGADMCERSCEELSIMFQELKGLRVVVGNLIDGLQKVTEENTVMK
DTLGKIKNSKEKHMCWQDGRMFEDKEDWVVDSCTTCTCQDSKIVCHQITCPPVACVGPSF
IDGECCPVCLPKDSEDGWSPWSEWTECTVTCGTGTQQRGRSCDATSNPCSGPSIQTRKCS
LGKCDSRVRQDGRWSLWSPWSSCSVTCGEGQITRIRHCNAPTPQLGGKDCEGQGRETQRC
EAKPCPIDGGWGPWSPWAICSATCGGGVKGRTRVCNSPEPQYKGKKCLGETNDSNACNKK
DCPIDGCLSNPCFGGVHCNSGSDGSWECGPCPLGFRGNGTHCEDVNECDIVSDVCFKAGG
ASRCVNTDPGFHCLACPPRYKGTQPFGVGVEAASKNKQVCEPENPCKDKTHNCHRSAECI
YLSHFSDPMYKCDCRIGYAGDGFICGEDSDLDGWPNQNLVCDANATYHCRKDNCPNLPNS
GQEDFDKDGQGDACDKDDDNDAIVDERDNCPLLYNPRQFDFDKDDVGDRCDNCPYEHNPA
QIDTDHNGEGDACAVDIDGDEIPNEQDNCPYVYNNDQKDTDMDRVGDQCDNCPLLHNPDQ
ADTDNDLVGDQCDNNQDIDEDGHQNNLDNCPYVANSNQADHDKDGKGDACDFDDDNDGIP
DDRDNCRLTPNKDQLDSDGDGRGDACKDDFDNDNIPDILDVCPENNAVTVTNFRKFQMVH
LDPKGTTQIDPNWVVRHQGKELVQTVNSDPGIAVGFDEFNAVDFSGTFYVNTDRDDDYAG
FVFGYQSSGRFYVVMWKQVTQTYWEDKPSKAFGISGVSLKVVNSTTGTGENLRNALWHTG
NTKDQVRTLWHDPKNIGWKDYTAYRWHLIHRPKTGFIRVVVYEGKQILADSGPVYDKTFA
GGRLGLFVFSQELVFFSDLKYECRDELEFPTVLSIR
NT seq 2991 nt   +upstreamnt  +downstreamnt
atgttcgtcgctaagggatccatccgtgaaaaccacttcagggggttactgcagaacgtt
cgcttcatgttcgacacatccgtggatgacgttcttaggaacaagggctgtgaagtcact
aagccagacgaggccaacactgtggtgagtgagagcacagacatggaggatgtgagttcc
tccaccgccatcaccactaacttcattggccagaaaacagagaatctaggagcagatatg
tgtgaacgatcctgtgaggaactcagcatcatgtttcaggagctcaaaggactgcgggtt
gtagtggggaacctcattgacggcctacagaaagtgaccgaggagaacacagtgatgaag
gacactctgggaaagataaagaactccaaggagaaacacatgtgctggcaggatggacgg
atgtttgaagataaggaggactgggtggtggacagctgcaccacgtgtacctgccaggac
tcaaagattgtgtgtcaccaaatcacctgtcctcctgtggcctgtgttggcccctccttc
atcgacggagagtgttgccctgtgtgtctgcccaaggacagtgaggacggctggtccccc
tggtcagagtggacagagtgtactgtcacctgtgggacaggtactcaacagagaggacgc
tcatgtgatgccaccagtaacccctgctctggaccatccatccagaccaggaaatgcagc
ctgggaaaatgtgacagccgagttcgtcaggatggtaggtggagcctgtggtctccatgg
tcatcatgttcagtgacgtgtggcgagggtcaaatcaccaggatacgccactgcaacgcc
cccacaccacaactggggggcaaagactgtgagggccaggggagagagacacagcgctgt
gaggccaagccctgtcccattgacggtggttggggaccatggtcgccatgggcgatctgc
tcggcaacctgtgggggtggagttaagggtcggacccgtgtctgtaacagccccgaaccc
cagtacaaaggcaagaagtgcctcggggagaccaatgacagtaacgcctgcaacaaaaag
gactgccctatcgacggctgtctgtctaacccatgctttgggggagtgcactgtaacagc
ggctctgacggatcctgggagtgtggaccctgcccccttggtttccgcggcaacggcacc
cactgtgaagatgtcaacgagtgtgacattgtgtcagatgtctgctttaaagctggtgga
gcatcgcgttgcgtcaacacagacccagggttccactgtctggcctgcccaccccgctac
aagggaacacagcccttcggtgtgggggtggaggctgccagcaagaacaaacaggtttgc
gagccagagaacccctgcaaagacaagacccacaactgtcatcgttcagctgagtgtatc
taccttagccacttcagtgaccccatgtataagtgtgattgtaggataggctatgccggg
gatggcttcatctgtggagaggactctgacctagacggatggcccaatcagaacctggtg
tgtgacgccaatgccacctatcactgcaggaaggataactgccccaacctgcctaactct
ggacaagaggactttgacaaagacggccagggagatgcttgcgacaaggatgatgacaat
gatgcaatcgtggatgagagagacaactgtcctctcctgtataaccccagacagtttgac
tttgataaagatgatgtgggggaccgttgtgataactgcccctacgaacacaaccctgcc
cagattgacactgaccacaacggcgaaggagatgcctgtgctgtcgacattgatggagat
gaaatcccaaatgagcaagacaactgtccgtacgtgtacaacaatgaccaaaaggacact
gacatggatcgagtgggtgaccagtgtgacaactgtcctctattacacaaccctgaccag
gctgacacagacaatgaccttgtaggagaccagtgtgacaacaaccaggacattgatgaa
gacggtcaccagaacaacctggacaactgtccttatgtggccaactcaaaccaggcagac
cacgataaggacgggaaaggggacgcctgtgacttcgacgatgacaatgacggtatccct
gacgatagagacaactgtagattgacgcccaacaaagatcaactggactctgatggcgac
ggtagaggagacgcctgcaaagacgactttgacaacgacaacatcccggacatccttgac
gtgtgtcctgagaacaacgccgtcaccgtcacaaacttccggaagtttcagatggtgcac
ctggaccccaagggaaccacgcagatcgaccccaactgggtggttaggcatcagggcaag
gagctggtgcagaccgtcaactctgacccaggcatcgctgttggctttgatgagttcaac
gcggtggactttagtggtacgttctacgtgaatacggaccgggatgacgactacgctggt
tttgtgttcggctaccagtcgagcggccgcttctacgtggtgatgtggaagcaggtcact
cagacctactgggaagacaaaccctccaaggccttcggtatctctggtgtctccctgaag
gtggtcaattcaaccacaggcacaggggagaacctgagaaacgccctgtggcacacagga
aacactaaagatcaggtgcgcactctttggcacgatcccaaaaacattggctggaaggat
tacacagcctataggtggcacctcatccacagacccaagactggtttcatcagggttgtg
gtttatgaagggaaacagatcttggcagactcaggaccagtgtacgacaagacgtttgct
ggaggacggttaggcctgtttgtgttctcccaggaactggtcttcttctccgatctcaaa
tacgagtgcagagatgagctggagtttccaactgtgttgtccatcagataa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112237051
Entry
112237051         CDS       T05605                                 

Definition
(RefSeq) collagen alpha-1(I) chain-like
  KO
K06236  collagen type I alpha
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112237051
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112237051
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:otw00536]
    112237051
Glycosaminoglycan binding proteins [BR:otw00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   112237051
SSDB
Other DBs
NCBI-GeneID: 112237051
NCBI-ProteinID: XP_024261443
LinkDB
Position
Unknown
AA seq 956 aa
MEQPDASYVEQPEPPYVKLMNFEEEVRAHRDLDDFLARASIILDETAPALNNVLKRMLHH
VGQDSHTAEPGCHFEEVMSMLFTDAGAQEINVSPPGSTSVSPPGFPLCLPPISPLPTTPV
SRRSPPPSPMCSHHLSGIQTGAPAGLATGAHALAGLAPPRRACRGAGGLAPLAGARPRSG
LARAVGSSHHRASRTSDSPPRGSGGRGGLTPRRYSRPTARPRTRAGGLARTRGDLRPSRV
PRAPRGPRATRGTLGRVRWREPLRGPRPRRARRGRRGPSPAPRAASQPHRGLDSPRGLAP
QARASRGGGDLAPRAVSATLSRASPPIAGLRGAGASRPSRALAPLADIAPRAVPSTRGHA
RCLRAGLAGPRRALRTGSARGASSPRAARALGSPPRGLAPLVVTSRPCEASPPPPAGLAP
RRHAPRPRDPSRAWPPGSGGLATPAASAPRGPRAPRGPSRGRGAIRPPGPSARLAERPRS
ARPRPLRTRAGLARRLRPWASRPARGHPPARSAGPRHAPAGRGARAHPRVPGSRAARGTE
APARAGHPRARRGAPGPRVPAAWRAAAPPRGTRGAARGSSRRRAGSAEGSRRRSRGHGCS
DRGAGPQREQRRALGRRGSAGATRGRAGHREAARGPRGAQGASGLAQPRGHTRGVVGSRR
RGGFAGRGLGGARGLAGSGGLTAAAEPLAYSRGAGLPEARASAARHGAAAGAPGSAGLLV
LAGGLPRATGTLAASGRPGGLPGRGPSPRRREGGRGGSQGRGPRGPSRGSRGGGPSVLAG
RPGAPGARACGLRGARGHPGGGSLASDGGAEEGLTEEPGGIRRPRPGGGDSPGRVPRRPR
GARGLTGRRAIEASILGVGAHQTRGRATGLAAPRGAGTRPAAPARGFRAQASSARGSGDG
RRPRSPAARLPEARSGRSTGGPARARPLRARPPTGSRPSLPGLAGARRPGARARAT
NT seq 2871 nt   +upstreamnt  +downstreamnt
atggagcagccagacgccagttacgtggagcagcccgagccgccatacgtgaagctgatg
aacttcgaggaggaggtgagggcgcatcgagacctggacgacttcctggccagagctagc
atcatattggacgaaacggcgccggcgctaaacaacgttctgaagaggatgttgcatcac
gtggggcaggacagccacacggccgagccaggatgccattttgaggaggtcatgagcatg
ttgttcaccgacgcaggagcacaggagattaacgtatctccccccggctccacctcggta
tctcccccgggtttccctctgtgtctcccacccatctcccctctgcctaccacccccgtc
tcccgccgttctcctcccccgtctcctatgtgttcccaccatctctctggaatccaaacc
ggcgcgccggcgggcctcgcgacgggggcccacgccctagcgggcctcgcgcccccgcgc
cgggcctgccggggcgccgggggcctcgcgcccctcgcgggcgcgcgaccccgctcgggc
ctcgcgagggccgtgggttcctctcaccaccgtgcctctcgcacctcggactcgcccccg
cgcggcagcgggggtcgcgggggcctcacgcctcggcggtactcgcgccccaccgcgcgg
cctcgtacgagggcggggggcctcgcgcgcactcgcggagacctgcgcccctcgcgcgtg
cctcgcgcccctcgcgggccgcgcgccactcgcgggacgctcgggcgagtgcggtggcgc
gagcccctacgcgggcctcgcccccgcagggcccgacgtgggcgacgggggccttcgcca
gcccctcgcgcggcatcgcagccccatcgcggcctcgactcacctcggggcctcgcgccc
caagcgagggcctcgcggggcggcggggacctcgcgccccgcgcggtctccgcgaccctc
tcgcgggcctcgccccccatcgcgggcctccggggcgcgggggcctcgcgcccctcgcgg
gcgctcgcgcccctcgcggacatcgcgccccgcgcggtcccctccacgcgcggccacgcg
cggtgcctccgcgcgggcctcgcgggccctcggcgggcactccgcacgggctccgcccgc
ggggcctcgtcgccccgcgcggcccgcgccctcggctcgccccctcgcggcctcgcgccc
ctcgtcgtgacctcgcgcccctgcgaggcctcgccgccgccgcccgcaggcctcgcgccc
cgccgtcacgcgcccaggcctcgcgacccctcgcgtgcctggcctccgggcagcgggggc
ctcgcgacccctgcggcatccgcccctcgcgggcctcgcgccccgcgcgggccatcgcga
gggcgcggggccatccgcccacccggtccctccgcgcggctagcggagcggcctcgcagc
gcgcgtcctcgccccctgcgcacgcgggcgggcctcgcccggcggctgcggccgtgggcc
tcgcgccccgcgcgagggcatcctccggctcgcagcgcggggccgaggcacgctcccgcg
gggcgcggggcgcgggcgcacccgcgggtgccgggctcgcgcgccgctcgcgggactgag
gcgccggctcgcgcggggcatccgcgggcgcggcggggggcgccgggtcctcgcgtcccc
gccgcctggcgcgcggccgcgcccccccggggcactcgcggtgcggcgcggggctcgtcg
cggcgcagggcgggctcggctgagggctcgcggcgccggtcgcggggacacgggtgctcg
gaccggggcgccgggcctcagcgggagcagcggagggctctcggtcgccggggctcggct
ggggcgacacgggggcgcgcgggccatcgcgaggcagcgcgggggccgcggggcgcgcag
ggggcatcgggcctcgcgcaaccgcgcgggcatacgcggggggtcgtgggctcgcggcgg
cgcgggggcttcgcggggcgcgggctcggcggggcgcggggcctcgcggggagcggcggc
ttaaccgcggccgcggagcccttagcgtactcgcggggcgcggggctcccggaggcccgg
gcctcagcggcccggcacggggcagccgcgggggctcccgggagcgcgggcctcctcgtc
ctcgccgggggcctcccgagggcgacgggaaccctcgcggcctccgggcgcccgggggga
ctccctgggcgcgggccatcgccgagacggcgagagggggggcgcgggggctcccagggt
cgcgggccgcgcggccctagccggggctcgcggggaggcgggcctagcgtcctcgcgggg
cggccgggggctcccggggcgcgcgcctgcggcctacgcggggcgcgggggcatcccggg
ggcgggagcctcgcgtcagacggaggcgccgaggaagggctcacggaggagcccggaggc
attcgccggcctcgcccggggggcggggactccccggggcgcgtgcctcggcgtcctcgc
ggggcgcgggggctcacggggcgacgggccatcgaggcctccatccttggcgtcggggcg
caccagacacgggggcgcgcgacgggcctggcggctccgcggggcgcgggcactcgaccg
gcagcgccggcccggggcttccgggcgcaggcctccagcgcgcggggctcgggggatgga
cgacgccctcggtcgccggccgcgcgtctccctgaggcgcgcagcggccgctctaccggc
ggcccagcccgggctcgccctctccgggcgcgcccgccgacgggctcgcggccatctctt
ccggggctcgcgggcgcgcgccgtccgggcgcgcgggctcgcgcgacctaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112237136
Entry
112237136         CDS       T05605                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: collagen alpha-2(VI) chain-like
  KO
K06238  collagen type VI alpha
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112237136
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112237136
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112237136
   00536 Glycosaminoglycan binding proteins [BR:otw00536]
    112237136
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   112237136
Glycosaminoglycan binding proteins [BR:otw00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   112237136
 Hyaluronan
  Extracellular matrix or blood plasma proteins
   112237136
SSDB
Motif
Pfam: VWA Collagen VWA_2
Other DBs
NCBI-GeneID: 112237136
NCBI-ProteinID: XP_024261519
LinkDB
Position
Unknown
AA seq 995 aa
MARLNRHGKHTSPLRGTDSAGTGLSRGSDCYHTANSPVADNITQIGHLVHLTHTEDHGRS
TEGCPVAVGPQVSAQDPEYDHLLVRPRNISDEMDDCPINVYFSWTPLRVHGRGTFIDCAL
GNMTEQVSEGQWKAPAQYAVVLTDGHITGSPCGGVHGPPRLQGSGHQDLVVATNEYTMES
DLKQIASSPVERIGKTTWRSQLASQEAVNRITDTMIKEAEFECQAPMCIQIKGADGPKGY
KGKKGGKGTNGAIGDPGQPGQQGDLGVEGSIGLHGQKGLPGLKGEKGDIGGSGLKGQRGS
PGYNGIDGEKGKTGTTGTPGCKGDAGMSGEAGLAGDFGIKGDTGKSGEKGVAGQSGRPGP
QGDHGDSGDKGVAGYVGNPGLPGQKGNKGKAGPGGSPGDTGSRGDSGRAGRRGKAGKKGD
KGELGPEGVRGVPGENGEEGAAGAPGFPGVRGPPGEVGEAGLQGSQGMQGTLAPGGNSGA
AGAKGDRGSDGYNYPGPRGNQGGRGDPGLPGLQGTRGYNGEKGAQGTTGTKGSAGEPGQE
GVPGDRGVRGSPGPLGVPGTRGASGLSECEIMGFVRETCGCCDCEKVCPPLDLVFVIDSS
ESIGKTNFSLAKNFVISVANRLGKMAKNISDISGSRLGVVQYSHQGAVQAIRMDDRGITS
VTSFNTKVKAMEWIAGGTWTASALKYTYDHLIVPGRRGRTKVVAIVITDGRYDPKDLDNL
GALCNGVDVYAIAIGDMFDSGAERQNLEKIACNMGDRVKTLSVYAELTAEEFLEEIEQIL
CPEPEMICPDLKCASDLSLAPLIQRPVDILFFIDGSERTGGRNFISILRFIGRLSQSIPL
SKEVSSGARFAVLQFGGEQDPEVLLDFSNNHRKISSLVSNAVYRDLSSTLGSAILYATEN
LVNNPGGRFRGVRPDAELTFVFITDGVTSDKNFAEGIRAMRRANAVGVAITVGSDIDRER
LLQLTLRDKALIFNLMSFNDLALPGVVKHMAHCLG
NT seq 2988 nt   +upstreamnt  +downstreamnt
atggcacgtctcaacaggcatggaaaacatacctcgccgctccgagggactgattctgca
ggtacgggactgagcagaggatcagactgttatcacacagctaactctcccgttgcagac
aatattacacagatcggacaccttgtacacctcacacacacagaggatcatggcaggagt
actgaaggctgtcctgttgctgtgggtccccaggtctctgcccaggacccagaatacgac
cacctgttagtgaggcccaggaacatcagtgatgaaatggacgactgccccatcaatgtg
tacttctcatggacacctctgagagtacatggtaggggaaccttcatcgactgtgccctg
gggaacatgacagaacaagtgagcgaaggccagtggaaagccccggcccagtacgctgtg
gtcctgactgacggccacatcactggcagcccctgtggaggggtccacgggccgccgagg
ctgcaaggcagcgggcatcaagatcttgtagtggccaccaacgagtacaccatggagagt
gatctcaagcagatcgccagttctcctgtggagcgtataggaaagactacatggcgttcc
cagctagcaagccaggaagctgtcaacaggataactgacaccatgatcaaagaggccgaa
tttgagtgccaagccccgatgtgcatccaaataaaaggagctgacgggccaaaaggatac
aagggaaagaaaggtgggaagggaactaatggtgcaataggagatcctggacagcctggg
caacagggagaccttggtgtcgagggctcgataggtttgcatggacagaagggtcttcca
ggcctcaaaggagagaagggagatattggtggatctggtctgaagggtcaaaggggatct
cctgggtataacggcattgatggcgaaaagggaaagactggcaccactgggacacctgga
tgtaaaggagacgctggcatgtcgggagaagccggtcttgccggtgactttggtatcaag
ggtgacacgggcaagtcaggtgaaaagggtgttgctgggcagagtggcaggcctggacca
cagggtgatcatggagacagtggagataagggtgttgctggctatgttggaaaccctggt
ctgcctgggcaaaaaggaaacaagggtaaagctggacctggtggaagtcctggcgacact
ggaagcagaggagacagtggcagagctggacgacggggcaaggctggcaagaaaggagat
aagggagaactaggcccagagggggtgagaggagttcctggagagaatggagaagaagga
gcagcaggggcaccaggtttcccaggggtccgtggtccacctggtgaggttggagaggcg
ggacttcagggctctcaggggatgcaggggactttggcccccggaggaaacagtggagca
gcaggagctaagggagatagaggaagtgatggatacaactacccaggacccagagggaac
cagggagggagaggagaccctggtttacctggactgcagggcaccagaggttataatgga
gagaaaggagcccagggaactacaggaacaaaaggatcagcaggggagccagggcaagag
ggtgttcctggggacagaggagtgagggggtcacctggaccactgggagtacctggtact
cgtggggcctctggtctatcggagtgtgaaatcatgggatttgtcagagaaacatgtggc
tgctgtgattgtgaaaaggtttgccctcccctggacctggtgtttgtgattgacagctct
gaaagtattggaaaaaccaacttcagcctggctaaaaactttgtcatcagtgtagcaaac
aggcttgggaagatggccaaaaacatatctgacatctcagggtctcgtctgggtgtggtt
cagtacagtcaccaaggggcggttcaggccatcaggatggacgataggggcatcacctct
gtaacctccttcaacacaaaggtcaaagccatggagtggatcgctggaggcacctggact
gcctctgccctgaagtacacatacgaccatctgatagttccaggtcgtagggggaggacc
aaggtggtggccatagttatcacagacggtcgctacgatcctaaagacctggataatctt
ggagccctgtgtaacggagtggacgtgtatgccatcgccatcggtgatatgtttgactct
ggggcagagaggcagaatctggagaagattgcctgtaatatgggcgaccgggtgaagacc
ctgagtgtctacgctgaacttactgctgaggaattcttagaggaaattgaacaaatcctc
tgcccagaaccagagatgatctgtccagacttgaagtgtgcctcggatttgagtttggct
ccactgatccagcgccccgtagacatcctcttcttcattgacggttctgagagaacaggg
ggcagaaacttcatcagcatcctgcgcttcatcgggagactctcccaatcgatccctctc
tccaaggaggtctcttcaggagctcgcttcgccgtgctgcagtttggaggggagcaggac
ccagaggttcttctggacttctccaataaccacagaaagattagctccctggtctctaat
gcagtctaccgtgacttatcctccactctgggcagcgctattctctacgcaactgagaac
ctcgtcaataaccctggaggtcggttcagaggggtacgtccagacgcagagctcacgttt
gtgttcattacagacggagtgacctcagacaagaactttgctgagggtattagagccatg
agaagggccaacgcagtgggtgttgctatcacagtgggatcagatattgacagggagcgg
ttgctgcaactcactctcagggacaaagctcttatctttaacctgatgagtttcaatgac
ttggccctccctggggttgttaaacacatggctcattgccttggttaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112237840
Entry
112237840         CDS       T05605                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: collagen alpha-5(IV) chain-like
  KO
K06237  collagen type IV alpha
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112237840
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112237840
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112237840
   00536 Glycosaminoglycan binding proteins [BR:otw00536]
    112237840
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   112237840
Glycosaminoglycan binding proteins [BR:otw00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   112237840
SSDB
Motif
Pfam: Collagen C4
Other DBs
NCBI-GeneID: 112237840
NCBI-ProteinID: XP_024262205
LinkDB
Position
Unknown
AA seq 1685 aa
ACLDVQRVRVKGGYQDYRVSWVLPGFPGPEGPIGAKVERRGMSWVQRVNGVTAVAVKGGY
QDYRVSWVLPGFPGPEGPIGVRRVSDGPSGTGGPKGIRGPPGLPGFPGTPGIPGLPGQDG
PPGPKGTAGCNGTKGERGFPGSPGFPGLEGRLGPPGFPGQKGDPGDIIRSERFGQIGDPG
LPGLPGVPGEQGPSGMSGPTGPPGPRGYEGRPGPPGLPGPKGNMGLNFQGPKGDKGNSGL
QGPPGPPGQVGEQTRPSVSSIQKGETGDQGLPGPPGDPGYPGPSGSSGGLKGEKGENGEA
GKRGKPGKDGDPGPAGFPGRKGDPGGPGLPGRDGDRGSKGDRGYPGRPGVQVSNGPPTVG
PKGESGRPGETGRKGDRGQPGLSGPPGQPGTPGIGGGGQPGLPGYPGERGQKGDEGQPGI
SIPGNPGRGGAPGLQGRPGPPGPPGISNGGFNCTGGAPGSPGQQGNIGFQGETGQKGEKG
ETCVNCFSRGNGVPGARGPPGPPGFPGGPGGPGAKGDRGFPGGPGPSGSSGLPGPQGAPG
FPGEKGDPGETTAVNGVSGDKGDTGFPGPAGLPGLDGRPGRDGGPGAPGAKGSSGSLLVK
GERGPPGEPGLQGLPGDRVPPDXPRLGPQGPPRREGVQGVSGRTGTPGAPGGKGEPGQTV
AEKGLPGPRGQDGDPGLPGNPGNPGGPGQPGFPGSPGPKGDPGLSGIGLPGPPGAKGFPG
SPGLPGGPGGPGRPGVDGFPGQPGAPGAKGEPGFGLSGPQGSPGFPGDKGSPGSKGDSGF
PGNPGLPGRSGFDGGPGAKGDSGIPGRTGDRGPQGSPSIGSQGVPGPVGPPGPIGAPGYS
GNNGEKGDPGLPGPGITGLPGDRGSPGFPGSPGGVGPQGNPGGPGRDGIPGLPGGKGNMG
VMGTPGSVGTPGNPGGPGFPGPKGDDGFPGRPGGPGGSGLKGDRGDPGLVGLPGPSNSPP
SIKGAKGDAGEPGLRGQPGQKGISGLPGDAGIPGQDGRPGLPGPQGPKGDMGIPGGSGSP
GSQGLKGNMGEMGFPGPTGAKGTPGQLGRSGVPGSSGAPGFPGAKGDPGSPGFGATGATG
PKGEPGRSGFPGQNGVKGTPGTPGLPGFPGGPGAKGDPGLPGFQGSPGIPGPKGLDGTPG
NPGLAGGPGRPGENGRAGSPGFPGDKGQAGRDGIPGPAGVKGDQGLSGFGGPGSPGLPGS
PGAKGDFGAPGLPGNPGFPGQKGEMGFPGQPGSPGSIGPPGATGVALQGPKGNSGSPGPP
GRGGPPGPEGPRGLGGSGGTKGEKGIPGSSGSPGFPGAKGELGSPGFPGIPGPSGGSGLK
GDIGLPGVPGFPGLKGESGSPGSSGLPGDPGDPGPAGNQGDPGVAASPIMLKGERGPPGP
SGLPGNRGSQGPPGQEGRSGQPGQPGDPGPEGPPGFSGAFGRKGDSGPAGQPGQRGYPGP
TGSDGQQGPPGNPGSASVTHGFLISRHSQAEYVPTCPEGTSLIYDGFSLLYVQGNERAHG
QDLGTAGSCLRRFSTMPFMFCNINNVCNFASRNDYSYWLSTPMPMPMSMAPITGEGIKPF
ISRCAVCEAPAMVIAVHSQTIQIPTCPSYWEPLWIGYSFMMHTSAGAEGSGQALASPGSC
LEEFRSSPFIECHGRGTCNYYGNTYSFWLATVDQSEMFRKPQSETLKAGNLSTRISRCVV
CMKRT
NT seq 5058 nt   +upstreamnt  +downstreamnt
gcatgtctggatgtgcagcgggtcagggtgaaagggggttaccaggactacagggtcagc
tgggtgttaccggggttccccggacctgaggggccaatcggtgcgaaggtggagagaaga
ggcatgtcatgggtgcagcgggtcaacggtgtgactgcagtggcggtgaaagggggttac
caggactacagggtcagctgggtgttaccggggttccccggacctgaggggccaatcggt
gtgcgaagggttagtgacggaccttcagggactggaggtccaaaagggataagaggacct
cccggactgcctggattccccggaacaccaggaattccaggtctcccgggacaggatggc
cccccaggccccaaaggaactgcaggctgcaatgggactaagggtgagcgaggattccca
ggaagtccaggcttccccggactggagggtcgattgggtccacctggttttccaggacaa
aagggagacccaggtgacatcatcagatctgaacgtttcggacagataggagatccaggt
ctgcctggcctgcctggagttcctggtgaacaaggcccctcgggaatgtccggtcctacc
ggccctcccggccccagaggttatgagggtcgtcccgggcctcctggtcttcctggtcca
aagggaaacatggggttgaacttccaaggtcccaaaggagataagggtaattcaggtctg
cagggacctcccggaccaccaggacaagttggggagcaaacaagaccctcagtgtcgagt
attcagaaaggagaaacgggtgatcaaggtttacctggtccacctggtgatcctggttat
cctggaccctctggttcgtctggtggtttgaagggagagaaaggagaaaacggagaagca
ggcaaaaggggcaaaccggggaaagatggagacccaggtcctgctggattccctggtcgt
aagggagacccaggtgggccaggtctgccaggtcgggatggtgacaggggttccaaaggt
gaccgtggatatcctggacgcccaggcgtgcaggtgagcaatggcccacctacagttggt
cctaaaggagaatctggacgtcctggggagacgggaaggaaaggagacagaggacagcct
ggtctttcgggtcctccaggtcaaccagggaccccaggtatcggaggtggaggccagccc
ggtttaccaggctacccaggagagaggggccagaagggagacgagggccagccaggcatc
tccatccccgggaacccaggacgaggtggcgcccctggtctgcagggacgtccaggacct
cctgggcccccagggatctccaatgggggttttaactgtacaggaggggcccccgggtca
ccaggacaacaaggcaatataggattccaaggagagaccggacagaaaggtgagaaggga
gaaacctgtgttaactgtttctccagaggcaacggtgtccctggagcacgaggccctccc
ggacctcctgggttcccaggtggacctgggggaccaggggctaaaggtgacagaggattc
ccaggcggcccagggccctcaggttcttctggtttgcccggtccccagggtgctcctggt
ttcccaggagagaagggtgacccaggtgagactaccgctgtgaatggggtgagcggagac
aagggagacacagggtttccaggacccgctggcctgcctggtctggacggaagacctggt
cgcgatggaggtcctggagctcctggagccaaaggatcatctggatctctattagtgaag
ggtgagcgaggacctccaggtgagcccggtttgcagggtctcccaggtgacagggtgcca
ccggatnnccccaggctcggcccccaggggcccccccggagagaaggtgtccaaggtgtc
tcagggagaacgggaacacctggagcaccaggaggtaaaggggagccgggtcagacggta
gcagagaagggcctcccaggaccccgaggacaggatggagaccccggtctacctggaaac
ccaggtaaccccggcgggccaggacagcccggtttccccgggtcaccaggtcccaagggt
gatcccggcctctctggcatcggactgccaggaccccccggagctaaaggattccctggc
tcacctggtttgccaggtggtcccggaggtccaggtagaccaggtgtggacgggttccca
ggacagccaggtgcacctggagctaagggagagccaggcttcgggctgtcaggtccccag
ggctcaccaggcttccccggagataaaggatcacctggatccaaaggagactctggtttc
cctggcaaccccggcttgccaggacgatctggctttgacggcggccctggtgccaaaggt
gactctggtatccctggtagaaccggagatcgtggccctcaaggatcaccctccatcggc
tctcagggtgtccccggccctgtcggacccccaggacctattggtgctccaggatactca
ggcaacaatggagagaagggagaccccggtcttcctggcccgggcattacagggttgcca
ggagacagaggaagtcccggtttccccggcagccccgggggagttggacctcagggtaac
cccggtggccctggccgcgatggaatacctggcctgcctggtggtaaaggaaacatgggt
gtaatgggaactcctggatctgtgggaacccctggcaaccccggagggcccggcttccct
ggacctaaaggtgacgatggtttcccagggcgaccaggtggtcccggcggttcaggtctg
aagggagacaggggagaccccggtctcgtaggactccccgggcccagcaactctccccct
tcaatcaagggagccaaaggagatgcaggagaaccaggtttgcgaggtcagccgggtcag
aagggtatttccggtctccctggagacgctggtataccaggacaggatggaagacctggg
ttacctggacctcaaggtcccaaaggagacatgggtatccctggaggatcaggctcacca
ggaagccaaggacttaaaggcaacatgggagagatgggcttcccaggacccacaggagcg
aaaggaactccaggtcagctaggtcggtcgggcgtgcccggtagttcaggagcacctggg
ttccccggagctaaaggagacccaggttcccccggatttggtgccacaggagctacaggt
cccaagggtgagcctggtcggtcgggattccccggacaaaatggagtgaaaggaactccc
ggaacaccagggcttccagggtttcccggtggccccggagccaaaggcgaccccggcctc
ccaggattccaaggttctcccggtattcccgggcctaagggtctggacggtacccctggt
aaccccggtctcgccggaggccctgggcgaccgggagagaatggccgtgccggatcacct
gggttcccaggcgacaagggtcaggcaggtcgcgacggaatccctggaccagcgggagtc
aaaggagaccaaggtctttctggtttcggcggcccaggttctcctggtctcccagggtca
ccaggtgctaagggagattttggcgcccctggtcttccaggtaaccctgggttccctggt
cagaagggagagatgggcttccccggccaacctgggtcccccgggagcatcgggccccct
ggtgccacaggtgtggccctccaggggcccaagggtaacagtggatcccccggcccccct
ggaagaggaggtcctcctggcccggagggtcctcgtggccttgggggcagcggagggacc
aaaggtgagaagggaatccctggatcttccggatcccctggtttccccggagcgaaggga
gaattgggatcacccggattcccaggtattcctggcccttctggtggcagcgggctgaag
ggagacattggacttcccggcgttcccggattcccaggactaaagggagaatctggaagc
ccaggatcatccggtctccctggagatcctggagatcctggtcctgctggaaaccaaggt
gacccaggtgtcgctgcgagccccatcatgctgaagggagaacgtggcccccctggccct
tcaggtctgccaggcaaccgtggctcccaaggaccccccggacaggagggacgctcaggt
cagcccggtcaaccaggggaccccggtcctgaaggacccccaggattcagtggagccttc
ggccgcaagggagactctggacccgccggacagccaggtcagcgtgggtacccaggtccc
actggttcagatggtcagcagggccccccaggtaaccccggctcagcctctgtgacccat
ggcttcctgatctcgagacacagccaggctgaatatgtccctacctgccccgaagggacc
agcctcatctacgacgggttctctctgctctacgtacagggcaacgagagggcacacgga
caggacctaggtactgctggtagttgcctgcgtcggttcagcaccatgccattcatgttc
tgtaacatcaacaacgtgtgtaacttcgcctcccgtaacgactactcctattggctgtct
acacccatgcccatgcccatgagtatggcccccatcaccggagaaggcatcaaacctttc
atcagcaggtgtgcagtgtgtgaggcccctgccatggtgatcgctgtacacagtcaaacc
attcagatccccacctgccccagctactgggaaccactgtggatcggatactccttcatg
atgcacaccagtgcaggtgctgagggctctggtcaggctctggcctctcctggctcctgt
ctagaggagttccggagctctcccttcatcgagtgtcacggccgagggacctgcaactac
tatggcaacacatacagcttctggctggccactgtcgaccaatcagaaatgttcaggaag
ccacagtcagagacgctgaaggcaggtaacctatcgacgcgcattagccgctgtgtggtc
tgtatgaagaggacgtaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112238339
Entry
112238339         CDS       T05605                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: collagen alpha-1(II) chain-like
  KO
K19719  collagen type II alpha
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112238339
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112238339
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:otw00536]
    112238339
Glycosaminoglycan binding proteins [BR:otw00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   112238339
SSDB
Motif
Pfam: COLFI Collagen
Other DBs
NCBI-GeneID: 112238339
NCBI-ProteinID: XP_024262683
LinkDB
Position
Unknown
AA seq 988 aa
MVSLPALNVQSGAPGNRGFPGQDGLAGPKGAPGERGVGGVSGPKGAGGDPGRPGEPGLPG
ARGLTGRPGDTGPQGKVGPGGAAGEDGRPGPPGPMGARGQPGVMGFPGPKGANGEPGKGG
EKGLLGAPGLRVSLPGKDGETGAAGPPGPAGPAGERGEQGQPGPSGFQGLPXTPGPPGEG
GKPWXHGVPGEGGAAGATGPRXAVFPGERGGAGPQGLQGPRGSAXDPGTDGPKGAIGPGG
ASGAQGPPGLHGMPGERGASGIPGPKGDRGDNGEKGPEGASGKDGSRGLTGPIGPPGPAG
PNGEKGESGPSGPSGAAGARGAPGDRGETGPPGPAGFAGPPGSDGQPGAKGEQGEGGQKG
DAGAPGPQGPSGAPGPSGPTGVSGPKGARGAQGPPGATGFPGAAGRVGPPGPNGNPGAAG
PSGPAGKDGPKGVRGDGGPPGRQGDAGLRGAAGSPGEKGDAGEDGPSGPDGPSGPSGLAG
QRGIVGLPGQRGERGFPGLPGPSGEPGKQGAPGGSGDRGPPGPVGPPGLTGPAGEPGREG
NAGSDGPPGRDGSTGIKGDRGNTGPAGAPGSPGANGSPGPVGPTGKQGDRGEAGAQGPAG
PAGPAGARGMAGPQGPRGDKGEAGEGGERGQKGHRGFTGLQGLPGPPGQSGDQGASGPAG
PSGSRGPPGPIGPSGKDGSNGMPGPIGPPGPRGRSGETGPSGPPETPXSPGPPGPPGPGI
DTCCLRGLSQPEKSPDPXVHEGPDQAPGNLRTHDAEVDATLKSLNNQIESIRPEGSKKNL
HVTCRDLKLCHPDWKAGEYWIDPNQGCTIDAIKVYCNMETGESCVYPKPASIPKKNWWSS
KSKAAKHIWFGETMNGGFHFSYGDESLAANTASIQMTFLRLLSTEANQNLTYHCKNSVAY
MDGATGNLKKAVLLQGSNDVEIRAEGNSRFTYTVMEDGCTKHKGTWGKTVIEYRSQKTSR
LPIVDIAPVDIGGADQEFGVDVGAVCFL
NT seq 2967 nt   +upstreamnt  +downstreamnt
atggtctcactcccagcgttaaatgttcaatcgggcgcccccggtaaccgtggtttccca
ggtcaggatggtctggctggtcccaagggagcccctggcgagcgtggagtcggcggcgtg
tccggccctaagggagccggcggtgaccctggtcgccctggcgagcccggtcttcctggc
gcaagaggtcttactggtcgtcctggagatactggtcctcaaggcaaagttggacctggt
ggtgctgctggtgaggatggtcgccccgggccccctggccctatgggagcccgcggtcag
cctggcgtgatgggattccccggacccaagggagccaatggtgagcctgggaagggaggc
gaaaaggggcttcttggtgccccaggtctgagggtaagtcttcctggaaaggatggtgag
actggagctgctggaccacctggccctgctggccctgctggagaaagaggagagcaagga
cagcctggaccttctggcttccagggtctgccgnngactcccggcccacctggtgagggg
ggcaagccctggtgacatggtgttccaggagagggtggagctgctggtgccactggaccc
agatgagcggtgttcccaggagagagaggaggtgctgggcctcaggggctgcagggacct
cgtgggtctgccntggaccctggaactgacggacccaagggagcgatcggaccaggtggc
gcatcgggtgcccagggaccccccggtctgcayggtatgcccggagagagaggggcctca
ggcatccccggacctaagggagacagaggtgacaacggagagaagggacccgagggtgct
tctggcaaagacggctcaagaggtttgactggtcccattggtcctcccggcccagctggt
cccaacggagagaagggtgaatctggtccatctggaccttccggtgctgccggtgcccgt
ggtgctcctggagacaggggtgagaccggacctcctgggcctgctggcttcgctgggcct
cctggatctgatggtcagcccggagccaaaggagagcagggagagggtggtcagaaggga
gacgctggtgcccctggaccccagggaccctctggagctcctggaccttccggaccaact
ggcgtttctggacctaaaggtgctcgcggtgctcagggaccccctggtgccactggtttc
cctggtgctgccggtagagtcgggccacctggtcccaacggtaaccctggtgctgctggg
ccctctggccctgctggtaaagatggccccaagggtgtgcgtggagacggtggaccccca
ggcagacagggagacgctgggctgcgtggagctgctggatcccctggagagaagggagat
gctggagaggatggtccctctggtcccgatggtccttcaggcccttcaggtctggctgga
cagcgtggtattgttggtcttccaggacagcgtggagagagaggtttccctggcctgcca
ggaccctctggagagcctggtaaacaaggagctcctggtggaagcggagaccgtgggccc
cctggcccagtgggaccccctggactgactggacccgctggagagcccgggagagagggc
aacgctggttctgatggaccacctggtagagatggatccactggaatcaagggtgaccgt
ggtaacaccggtcctgctggtgctcctggctccccaggtgctaatggttcccccggcccc
gtcggccccaccggcaagcagggagacaggggagaggctggagctcaagggcccgctgga
cctgccgggcctgctggagccagaggaatggctggacctcaaggaccccgtggagacaag
ggtgaggctggagaaggtggagagagaggacagaaaggacacagaggattcactggtctg
cagggtctgcccggacctcccggtcaatctggagaccagggtgcctctggacctgccgga
ccaagtggatcaaggggacctcccggacccattggtccctctggaaaggatggttccaat
ggtatgcccggccccatcggaccccccggaccccgtggtcgctctggagagactggtcct
tctggtccacctgaaactccgnngtcccctggtcctcctggtcctcccggccctggtatc
gacacatgttgccttcgtggtctgtctcagcctgagaaatcccccgatccctgagtacat
gagggcccggaccaggctcccggaaacctgaggacgcacgatgccgaggtggacgccacg
ctcaagtctctcaacaaccagattgagagcatccgccccgagggctccaagaagaacctg
cacgtaacttgcagagacctgaagctgtgccacccagactggaaggcaggagagtactgg
atcgaccctaaccagggctgcaccatagacgccatcaaggtctactgtaacatggagacc
ggagagtcctgtgtctaccccaagcccgccagcatccccaagaagaactggtggtccagc
aagagcaaggctgccaaacacatctggtttggagagaccatgaacggaggattccacttc
agctatggcgatgagagtctggcagccaacacggccagcatccagatgaccttcctacgg
ctgctgtccaccgaggctaatcagaacctcacctaccactgcaagaacagcgtggcctat
atggacggggccacggggaacctgaagaaggccgtgctgctccagggctccaacgacgtg
gagatcagagctgagggcaacagccgcttcacctacaccgttatggaggacggctgcacg
aaacataaagggacgtggggaaagacagtgattgagtacagatcccagaagaccagccgg
ctgcccatcgtggacatcgctcctgtggatattggaggagcggaccaagagtttggtgtt
gacgtcggcgcagtttgcttcttgtaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112239140
Entry
112239140         CDS       T05605                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: fibronectin-like
  KO
K05717  fibronectin 1
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112239140
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112239140
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112239140
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112239140
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112239140
   00536 Glycosaminoglycan binding proteins [BR:otw00536]
    112239140
   04990 Domain-containing proteins not elsewhere classified [BR:otw04990]
    112239140
Membrane trafficking [BR:otw04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    112239140
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   112239140
Glycosaminoglycan binding proteins [BR:otw00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   112239140
Domain-containing proteins not elsewhere classified [BR:otw04990]
 Fibronectin (FN) domain-containing proteins
  Fibronectin type I domain-containing proteins
   112239140
SSDB
Motif
Pfam: fn3 fn1 fn2 Pur_ac_phosph_N DUF2369 Interfer-bind Arylsulfotran_N
Other DBs
NCBI-GeneID: 112239140
NCBI-ProteinID: XP_024263406
LinkDB
Position
Unknown
AA seq 2499 aa
MTGSPVTGLLVALCVSSAVHCMPKNQGKNKRQVQEQVYXELADTVPLAQGCDENGHPYRL
NDQWEKAYRGSTLLCTCNGAAGIKCKTKPQGEETCYDKYNDQTYPVGATYERAKDGMMWD
CTCIGSARGKISCTIGNRCHEGGRSYKIGDTWRRPHETGDYMLDCVCLGNGKGEWTCKPV
SERCYDNTGGASYVVGQTWEKPYQGWMMIDCTCLGEGNGRITCTSRNRCNDQDTKTSYRI
GDTWTKTDANRHQLQCLCTGNGRGEWKCERHSATTGTGVSTGTGLGTGTGSTHVTIQTEL
HQPSTLPEPPQEGACRTDSGATFHVGMRWIRTQGSKQMLCTCQGTGAVSCEEKEGQSQVY
GGNSEGQACVFPFVFMDKTYYSCTSEGRTDGQLWCSTTSDYHRDQQYSYCTEKNSLVSTR
GGNSNGALCQFPFLYNGRNYTDCTADGRRDGMRWCGTTTNYEGEQRYGFCPMAGECEAAP
PTTGSCTVVGDQWDKRHXVLGHMMQCTCLGNNRGEWXCIAYSQLKDQCIVDGLTYEVSQT
FTSAMTRANDELHCYGQGRGRWKCDAIDQCQEPESRAFYQIGETWDKTIHQVLYRCYCYG
NGIGEMSCEPQQTFPGGHRPVQVIITEAGKQPDSHPIQWNAPASSHITQYILKWRVVKKH
PAPWREAXIPGNLNSYXSSWLRPGITYEGQLISTALWSREVTRXDFTTTYGSLGVTSEGE
TTQPPPVVDTSESVTEITSSSFIISWVSASDTVSGFRVEYELSEDGAKPQVLDLPRTTTS
VSISDLLPGRRYNVNVYEVSPQGEPTLILTTSQTTAPDAPAEHQINQVGETSISISWSKP
QAPITGYRLVFTPSVEGSSTELILPDTETSVTLVDLRPGLLYNISIYAVEENQESEPIFV
QVNTAGEPAPEEVHSPTDLQFYEVSDAKIIITWTGPPSEVSGYRVTFAPVTPGDTPQRPL
QLPMMANAYAEITHLQPGTLYRFNIYAINGGVESEPLTGERATKPDAPTNLRFTDIGEDS
VIVIWEAPRASISGYRLFLSVEGSSPTQKRIPGGQTQFPLRGLRPDTDYTVKLHSEQDNV
LSEEVNGIFTTSPKMGNAPRFTTDVTDTSIIISWTPVSRFSFRLSVRPSQGGESPRDVTS
DSGSIFVSGLTPGTEYTYSVQPIINGRDRGNPITKNVVTQLSPPTDLSTQSNADTGELTV
LWGGANTPDITGYRVTCTPTNGQRGNSLEELVQPVQNRNPGKPESRSGVNVSVYTVKDNL
EGVPVSTTVTQDVPKLNDLDFVDVTDTTVGLRWTALVNVTAVTSYRVTVMASGESLPIIM
DTVDSSTGHYTVRGLEPGVDYDISVTTITEEGESEPATRRTQTQTPPPTNLNFGGVGPDH
MRVSWTVPTAPRPVTSQRFVIRFPPSSNDDDVKELNVGGVTTSVFLSSLLQTCCPKTEYR
VSVVCVYEERESAPVTGTQRTTLDSPTGLDFADVLTNSFTIHWLAPGAVITGYRIHYQMT
SGGRAKDERLPPTRSHFTLTGLAPETEYSVEVYAVSGNQESLPLTGTQATISDAPTDLEV
TSTSPTSITIRWDAPSVTVRYYRITHGETGGESPAKEFTVPGSQSEATISNLNPGTDYTI
TVYAVTGRGDSPASSTPIYISHKTDVEGPTNMDVTDVKDNTITVRWSAAQGPIKGYRVTS
VPKNGQGPSFSEVVAPDQTEITFTGLMPTVEYVLSVTALGTDGEPSTPLVENAITAMDRP
KALSFSEVDSTSLRITWDSPDGTVTSYRVLYSSPEEGERELRPAPRGTDDTVVLRNLRPG
TEYTVKVIALHGRTPSTPLVGTQATAIPAPTNLDISEVGDTSFIVSWRSPSSGLSGYRVV
VNPKNNNGPTKEMTIAPDTTRAVVPGLMVATLYTVHVYALKNSVTSRPLEGEVTTLDNIS
PPRRVRISDVKDSAITLTWRAKVETITGYXIEAQPLGGSRPTIKKTIPGEQRTYTITGLE
PGTSYTIHIYTINGDARSAPFTLTATTAKPAVHSPTNLQFTSLTPNSISFSWEPPATRIT
GYYITYEEAGRAQPRELTPRPHAGQNYATISGLRPGTEYIIKIIALQNVQRSTPLVGTAR
TQRESLLTLPLPNRPGGYDHLDVPEEKESRVPTVVGNNGLDTLGGQGQNVEYTEYNNQKP
QTPYGNGQTPYGNGQTPYGNGQTPLVFVPLPDAEGRRVPVVSVNVPGGSPFGFPEKDTGI
PQEAQTQTTIAWKPYKQSSEYLVSCNPLTHVNEKMFQMRLPGTSTSATLIGLTSGASYNV
IVEALKGALKHKILEEIVTAGNTLTEGSTGTDKDSCYDTFTATYHDVGTEWERMSETGFK
LWCRCLGLGSGHFRCDSSKWCHDGGNNYRIGEKWERQEEKGPMMSCTCLGNGKGEFKCEP
HESTCYDDGKMYQIGNQWQKEYLGAICTCTCYGGQQGWRCENCRRPGAEVDSSLLQPVRY
RDPTNTLRKVNIQCPIECLRPELLADALAEGHIPQNPLE
NT seq 7500 nt   +upstreamnt  +downstreamnt
atgactggtagcccagtgacagggctgctggttgcgctgtgcgtaagcagcgcggtccac
tgtatgccaaagaaccaagggaaaaacaagagacaagttcaggaacaagtttacckcgaa
ctcgcagacacagtaccccttgctcaaggctgcgatgagaacggacatccttacagacta
aacgatcaatgggagaaggcttaccgcgggagtacactgctttgtacctgcaacggagcg
gcagggatcaaatgtaaaacaaaaccccaaggggaggagacctgctatgacaaatacaac
gaccagacgtaccctgtgggtgcgacctacgagagggcgaaggacggcatgatgtgggac
tgcacctgcatcggttccgcccgcggcaaaatcagctgcacaatcggaaaccgctgccac
gagggaggcagatcctacaaaatcggggacacttggagaaggccccacgagaccggagac
tacatgctggattgcgtctgtctgggaaacggcaagggagagtggacctgcaaacccgtg
tcggagcgttgctatgacaacactgggggagcatcctacgtggtggggcagacctgggag
aagccgtaccaaggctggatgatgatcgactgcacctgtctgggggagggcaacggacgc
atcacctgtacctctaggaaccgttgtaatgaccaggacaccaagacrtcctaccgcatc
ggagacacatggaccaagacagatgctaacaggcaccaactccagtgtctgtgtacagga
aatggcagaggagagtggaagtgtgagagacactctgccactactggcacaggtgttagt
acaggaacaggtttaggaacaggtacaggaagtactcatgtgaccatccagacggagctc
caccagccctccaccctccccgaacccccccaggagggggcttgccgcacggactcgggc
gccaccttccacgtgggcatgcgctggatcaggacccagggcagcaagcagatgctgtgt
acctgccagggtactggtgccgtcagctgtgaggagaaggagggccagagccaggtgtac
ggtgggaactcagaaggccaggcctgtgtgttcccctttgtgttcatggataagacctac
tactcctgtacctcagagggacgtactgatggacagctgtggtgcagcaccacctctgac
taccatagagaccagcagtactcctactgtaccgagaagaactccctggtgtcgacccga
gggggtaactccaatggtgccctgtgccagttccccttcctctacaacgggcgtaactac
actgactgtaccgccgatgggcgccgrgacggcatgaggtggtgcggtaccacaaccaac
tacgaaggagagcagcgctacggattctgccccatggctggtgagtgtgaggctgcccca
ccaacgacggggtcatgtaccgttgtgggagaccagtgggacaaacgccacngtgtcctg
ggtcacatgatgcagtgtacctgcttgggcaacaaccgcggagagtggngctgcatcgcc
tactcccaactcaaagaccagtgcattgtggatgggctgacctatgaggtgagccagacc
ttcaccagcgccatgaccagggctaatgatgaattgcactgctatggacagggacgcggg
cgctggaagtgcgacgccatcgaccagtgccaggagcctgagagcagggcgttctatcag
attggagaaacctgggacaaaaccatccaccaagtcctctaccgctgctattgctacggc
aacggtattggtgagatgagctgcgagccacagcagaccttcccaggtggccaccgtcca
gtccaggtgataatcacagaggcagggaagcagcctgactcccaccccatccagtggaac
gccccagcctcctcacacatcacccagtatatcctcaagtggagagtggtaaaaaaacac
cctgccccctggagagaggcanccatcccaggtaacctgaactcgtacncatcctcgtgg
ctgcggccaggtattacctatgagggtcagctgatcagcactgcgctttggagccgcgag
gtcacccgcnttgacttcaccaccacctacggctcccttggggtgacctctgagggtgag
acgacccagcctcctcccgtggtggacacgtctgagtcggtgacagagatcacgtccagt
agcttcatcatctcctgggtgtcagcctccgacaccgtgtcaggcttcagagtggagtat
gagctgagtgaggacggagccaaacctcaggtcctggacctgccccgtaccaccacctct
gtgagcatcagtgacctcctgcctggccgtagatacaacgtcaacgtgtatgaggtttcc
cctcagggagaacccaccctcatcctcaccacctctcagaccacagctcctgatgcccct
gctgaacatcagatcaaccaggtgggagaaacctctatctctatcagctggtccaagccc
caggcccccatcacaggctaccgtttggtcttcaccccgtcagtagagggcagcagcacc
gagctcatcctcccagacactgagacctccgtgaccctggttgaccttcgacctggcctg
ctctacaacatcagcatttacgctgtggaagagaaccaggagagcgagcccatcttcgtc
caggtcaacacggccggagagccagcaccagaggaagtccactccccgaccgaccttcag
ttctacgaggtgtctgacgcgaaaatcatcatcacctggaccggccctcccagcgaggtg
tcgggttaccgcgtgaccttcgcccccgttacccccggtgacacgccccagaggcccctg
cagctgcccatgatggccaacgcgtacgcagagatcacccacctgcagcccggaaccctg
taccgcttcaacatctacgccatcaacggaggagtggagagcgagccgctgacgggagag
agagccaccaagcccgacgcccccaccaacctgcgtttcactgacatcggcgaggacagt
gtgatagtgatctgggaggctcccagggctagcatcagcggctaccgtctgttcctgagc
gtggaaggctccagcccaacccagaagagaatccccggcggtcagacccagttccctctg
cgaggcctccgccccgacacagactacaccgtcaaactgcactctgagcaggacaacgtg
ttgagtgaggaagtcaatggcatcttcaccacctccccaaagatgggtaatgcccctcgc
ttcaccactgatgtgaccgacacctccatcatcatctcctggacccctgtcagcaggttc
agcttcaggctgtctgtgaggcccagtcagggaggagagtcacccagggatgtgacctct
gactcaggaagtatctttgtgtcaggcctgacccctgggactgagtacacttacagtgta
cagcccattatcaacggacgtgaccgcggcaaccccatcactaaaaacgttgtcactcaa
ctgtctccccccactgacctcagtacgcagtccaacgcggacacgggtgagctgactgtc
ctgtggggcggcgccaacacgccagacatcacaggctacagagtgacatgcaccccgacc
aatgggcagcgaggaaactccctggaggagttagtccagccggtccagaaccgtaatcct
gggaaacctgagtccaggagtggagtaaacgtctctgtctacactgtcaaagacaacctg
gagggtgtccctgtgtccaccactgtcacccaagacgtgcccaagctaaacgacctggac
tttgtcgacgtcaccgacaccactgtgggcctgcgctggaccgccctggtaaacgttacc
gccgtcaccagttaccgggtaacggttatggcgtcgggcgagagtttgcccatcatcatg
gatacggtggactcgtcgacgggccattatacggtgcgcgggctggagcccggtgtggat
tatgacatcagtgtcactacgataacggaggaaggggagagcgagccggccacacgcaga
acgcaaacccagaccccgccccccaccaacctgaacttcggaggggtgggccccgatcac
atgagggtcagctggaccgtccccactgccccacgcccagtgacatcacaacgcttcgtc
atccgcttcccacccagcagcaatgacgacgatgtcaaggagctcaacgtgggcggagta
actacaagtgttttcctgtcatctctcctccagacctgctgcccaaaaacagagtacagg
gtgagcgtggtgtgtgtttacgaggagagagaaagcgcaccagtcactggcactcagaga
acaaccctggactctcccactggcctggactttgctgacgtcctgaccaactccttcacc
atccactggctggcccccggcgccgtgatcaccggctaccgtatccattaccagatgacc
agcggaggcagggccaaggacgagagactgcccccgaccaggagccacttcaccctgact
ggcctggctcccgagacagagtacagtgttgaggtctacgctgtcagcgggaaccaggag
agtctgcctctcactggcactcaggctactatctctgacgcccccaccgacctggaagtg
acctcaaccagccccaccagcatcaccatccgctgggacgccccctctgtcaccgtgagg
tactacaggatcacccacggagagacaggtggagaaagccctgctaaggagttcactgtc
cccggctcccagtccgaggccacratctctaacctgaacccagggacagactacaccatc
accgtctacgctgtgacagggagaggggacagcccggcctccagcacacccatctacatc
agtcacaagactgacgtggagggccccaccaacatggacgtgacagatgtgaaggacaac
accatcacagtgcgctggtccgcggcccagggccccatcaagggctacagggtcaccagc
gtccccaagaatggacagggcccctctttctctgaggtggtggcccctgatcagaccgag
attacgtttactggcttgatgcccacggtggagtacgttctgagtgtgaccgctctggga
accgatggagaaccttccacacctctggtagagaacgccatcacagcaatggaccgtccc
aaggccctgtccttctctgaggtggactccacctccctgaggatcacatgggacagtccg
gacggcacggtgacatcataccgtgtgctgtactccagccctgaggagggcgagagagag
ctgcgcccggcgcccagagggacagacgataccgtggtactgaggaatctccgccccggc
acagagtacactgttaaggtcatcgctctgcacggacgcacccccagcaccccactggtg
ggcacacaggccacagctatccctgctcccaccaatctggacatctctgaggttggtgac
acctccttcattgtctcgtggcgctcccccagctccgggctgtctgggtaccgtgtggtt
gtcaaccccaagaacaacaatggacccaccaaggagatgaccatcgccccagacaccacg
cgcgccgtggtcccaggactcatggtggccactctgtacacagtgcacgtttacgccctg
aagaactctgtgaccagccgacccctggagggagaggtcaccacgctggacaacatcagt
cctcctcggcgtgtgcgtatctctgacgtgaaggactcggccatcacgctgacctggcgt
gctaaggttgagaccatcaccgggtacrtcattgaagctcagcccctcggtggcagccgc
cccaccatcaagaagacaatccccggagagcagcgcacctacaccatcactggtctggag
ccaggcacctcctacactatccacatctacaccatcaacggcgatgcacgcagcgccccc
ttcaccctcacggccaccacagccaaaccagcggtgcattctcccaccaacctccagttc
acctccctgacccccaactccatctccttcagctgggaaccccccgccacgcgtatcaca
ggatattacatcacctacgaggaggcaggcagggcgcagccccgtgagcttaccccccgc
ccccacgctggccagaactacgccaccatctctggtttgagaccaggtaccgagtacatc
atcaagattatcgctcttcagaatgtccagagaagcaccccattggtgggcacggccagg
actcaacgtgaatccctgcttacactgccactccccaaccgccccggaggctacgaccac
ctggacgtgcctgaagaaaaggagagccgtgtcccaacagtagtaggtaacaacggccta
gacaccctggggggccagggccagaacgtggagtacactgagtacaacaaccagaaaccc
cagacaccctatgggaacggccagactccctatgggaacggccagacaccctatgggaat
ggccagacacccctggtgtttgtgccccttccggacgcggaggggcgcagggtgccggtg
gtgagcgtgaacgtgcctggtggctctccctttggttttccagagaaggacacaggaatc
cctcaggaggcccagacccagaccaccatcgcctggaagccttacaagcagagttcagag
tacctggtgtcctgcaaccctctgacacacgtcaacgagaagatgttccaaatgcgtctg
cctggtacctccaccagtgccactctgatcggcctgaccagcggagcctcctacaacgtt
atcgtagaggccctgaagggggcactcaaacacaagatcctggaggagattgtcaccgcc
ggcaacaccctgacagagggttccaccggcacagataaggactcgtgctacgacaccttc
acagcaacctaccatgacgttgggaccgagtgggagcgcatgtctgagacgggcttcaag
ctgtggtgcagatgtctgggactaggcagtggacacttccgatgtgactcctctaagtgg
tgtcatgatggaggtaacaactaccgtattggggagaaatgggagcgtcaggaggagaag
ggccccatgatgagctgcacctgcctgggcaacgggaagggagagttcaagtgtgaacca
catgagtccacctgctatgacgatgggaagatgtaccagattggtaaccagtggcagaaa
gaatacctgggagccatctgtacctgcacctgctacggaggacaacagggctggcgttgt
gagaactgtcgtagaccaggtgctgaggttgactctagtctgctgcagcccgtccgatac
agggaccccaccaacacactacgcaaagtgaacatccagtgccccatcgaatgccttcga
cctgaactactggcagacgcactggcagaaggacacatcccccagaatcccctggagtaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112239893
Entry
112239893         CDS       T05605                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: collagen alpha-6(VI) chain-like
  KO
K06238  collagen type VI alpha
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112239893
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112239893
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112239893
   00536 Glycosaminoglycan binding proteins [BR:otw00536]
    112239893
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   112239893
Glycosaminoglycan binding proteins [BR:otw00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   112239893
 Hyaluronan
  Extracellular matrix or blood plasma proteins
   112239893
SSDB
Motif
Pfam: VWA VWA_2 Collagen VWA_CoxE Integrin_beta
Other DBs
NCBI-GeneID: 112239893
NCBI-ProteinID: XP_024264046
LinkDB
Position
Unknown
AA seq 1726 aa
MALIPKFSDIFFLVDSNMMQADFQLVRXLLMRLVNQLNPSTKTMRLGLAQFAQDTKVEFL
LNTHNTKEEYLAALRKFRLPLRPNRSRHLGNALEYARAHFFTTASGGRNEQGYRQFLVTV
TGGDSKDNVMKVARTIKSEGTTIVSIGLGESTLPELKLMATSPFFYQTTSITSVLKTVFE
TEEVVTVTDDCSEASLADIVFIVDESSSNXTANFQLVRGFIXKIVDGLDIDFNRVRVGIV
LYSNXASAQVYLNSFXEKTNILQFIKILPYRRGLTYTGEALEYAREKMFIKERGSRKEQG
VQQVAIVITGKSQDNVTSHAAALRRAGVTVYAVGIKXADENELRQIASDPPNKHVLHVDS
FAKLKTLEKSLKKSVCYNILKKAVKDNARTYTAKQSEIKMTAVQTDEADMFFLIDHQGKA
VDGIMQLGGGTKTGLALNSMXSPLDRAKATRSNKVREYLIVITDGESEDSVKDQAAKLRA
QGITIYAIGVKLANDTQLLEIAGSQEKKFFVNNFDSLKPIKNDIITDICSPXXRASLLGT
SAFLIDSSGSINNPDFQKMKVFMQSIINKSDIGLDKVHVGIIQFSTSQQVIFPLNKHNDK
EGMLQDLQTMQQIGGGTHTGKALSYTSQFFDPPKGGRTNVKQFLIVVTDGEAQDEVMSPA
KKLQDKGVIIYAIGVVNANNTQLLEISGAQERVYSERDFDALKALDSQLALAICDPEREC
VRTEIADIIFLVDGSTSISSDNFDIMKNFMMSVVNETSVGEKQTRYGLIVFSDNPESKFT
LNEYKSKRDVNSAIAKLREPSGDTYTGKALKYSLGYFGAQYGGRKALNVPQWLMVITDGE
ATDPYSLAGPAKELRDNGIIVYSIGVVGANKQELELMAGDTNKVFFVDDFHKLDTLHKNI
SFEFCQTSKPVCEKTQGDLVLLIDSSGSISTTDFTIMKKFATDLVSSFNIAEQSFRVGVA
QFSSDPKKEFFLNEYYTEAEVNNQINNMMQIRYTTNIGKALDYVRTEYFQPARGSRINAK
VSQNLVVITDGRSDDDVVDAAEKLKAMNIEVFAIGIGKDHKPVELGQITLNPERVFSVQD
FASLDKIKKKVVDTICSSKVPDTQAXCTIDIAMGFDITRRATHPGSSMAKPSQAFLPQII
RYVSNLKGLCCVAGDGKGINALLTVALEGXPNANLLQKVEFGRGFGYKQPLHIGMHIWET
PVDTNMAERECCNVMCKCTGHEGIRGTEDTRDKGQPGLKGHPGFPGEDGGIGERGPPGPT
AHRDYRAVLGGEASRAQAYRGDRGDDGDHGLDGXDGEQGLIGTAGAAGERGNPGRPVNTI
SLFYIYFANYYSRQQLGLIGEPGVKGQRGLRGDPGDSGVDSIVXGPKGGRGNPGLPGDSG
EEGSRAESGIVGNPGTPGDPGDVGLQGIPGPSGPQGIRGDLGQPGPRGLQGLPGPQGQPG
DLGVTEPLEHLGQEGGKGLDGSDGHGPPGPQGMKGEPGFHGYPGLRVKVVILESKEVQAP
KETEAEGALEADQEREPSCSQGQAACPAYPTELVFALDMSQDVEPATFERMRSALLSILD
DVAIXREQLPDGARVAVVSYSANTKYLIRFQDYQRKPELLEAIQNIALERTSNQHHLGEA
MRFVGRHVFKRTRKALTMRKVAVFFTNGXSVDSTAIITAAMEFKALNIAPAVIAMRNSPD
VQRAFEADDTGSFILVRLVDRSQDQNAVLTRIKTCVICYGKHTGPK
NT seq 5181 nt   +upstreamnt  +downstreamnt
atggctctaatcccaaagttctctgatatcttcttcctggtggacagcaatatgatgcag
gcagacttccagctggtcagaayccttctgatgcgactggtcaaccaactcaacccgagc
actaaaacgatgcgcctgggtctggcccagtttgcccaggacaccaaggtggagttctta
ctgaacacccacaacaccaaggaagagtacttggcagctcttaggaaattcaggctgccg
ctgcgtcccaacaggtctcgtcacctgggcaatgccctggaatacgcccgtgcacacttc
ttcaccacagcgtctggtggccgtaatgaacaaggctaccggcagtttctagtcacggtg
acagggggggattcgaaggataacgtgatgaaggtggcacgtactatcaaatctgaaggg
acaaccattgtgtctatcgggttgggtgaatctacacttccagagctaaagttaatggcc
acctcgccattcttttaccagactacatccatcacctctgtgctaaagactgtctttgag
actgaagaggtggtcactgtgactgacgattgcagtgaagcttcactggctgacattgtg
tttatagttgatgagtcktcgagcaatagwactgcaaacttccagctggttcgtggattc
atcyayaagatagtagacggcctagatatagacttcaacagggtgagggtgggcatcgtc
ctctatagcaacaakgcctcggcccaggtctacctcaactccttccragaaaaaacaaat
atccttcagttcatcaagatcctgccctaccgtcgcggtctcacatacactggcgaggcc
ctggagtatgccagggagaagatgtttatcaaggagaggggcagccggaaagaacagggg
gtgcagcaggtggcgatagtcatcaccggaaagtcccaggacaacgtaacttctcatgcc
gctgcactgcgcagagctggtgtcactgtctatgcagtggggatcaaggrtgctgacgag
aacgagctgagacagatcgcttcagatccccctaacaagcacgtattgcatgtggacagc
tttgccaagctcaagaccctggagaagagcctgaagaagagtgtgtgctacaatatcctt
aaaaaagcagtcaaagacaacgcaaggacatacactgccaagcaaagtgagatcaaaatg
actgctgtgcagacagatgaagcagacatgttcttcctgatcgaccaccagggaaaagca
gtggatggtatcatgcaacttggaggcgggacaaagaccggattagcgctgaactctatg
nggtccccacttgatcgggctaaggccacccgtagtaacaaagttcgtgagtacctcatt
gtcatcacagacggagagtctgaagacagcgtgaaggatcaagcagcaaagctgagggcg
cagggaatcaccatatatgccattggcgtgaagctagctaacgatacacagctgctggag
attgctggcagccaagagaagaagttctttgtcaacaactttgactctctgaaaccaata
aaaaatgacatcatcacagatatctgctccccttgatagagggcatctctattggggacg
tccgctttcttgatcgacagctcaggtagcatcaacaacccagacttccagaagatgaag
gtcttcatgcaatccatcatcaacaaatctgacataggcctggataaagtgcacgtgggc
atcatacagttcagcaccagccaacaggtsatcttccctctcaacaagcataacgataag
gaaggcatgttgcaggatttacaaacgatgcaacagataggcgggggcacacacaccggc
aaagccctgtcctacacatcgcagttctttgacccaccraaaggagggcgcactaacgtg
aagcagttcctgattgtcgtaaccgatggtgaggcgcaggatgaggtcatgtctcctgcc
aagaaacttcaagacaagggtgtgatcatctacgctattggggtggtcaatgccaacaat
acacagttactggagatcagtggcgcacaggagagggtctactccgagagggactttgat
gcactcaaggctttggatagccaactggcattggcaatctgtgatccggagagagagtgt
gtgaggacggagatcgcagacattatyttcttggtggacggctccaccagcatcagctca
gataattttgacataatgaaaaacttcatgatgtccgtggtcaatgaaacctctgttggg
gagaagcagacacgctatggtctgattgtcttttcagacaaccccgagtctaaattcaca
ctcaacgaatacaaatctaagcgagacgtcaatagtgccatcgcaaagcttagagagccc
agtggagacacctacactggaaaggcactcaagtattccttgggttattttggtgcacag
tacggcgggcgaaaggccctaaatgttccccagtggttgatggtgatcacagatggtgag
gctactgacccctatagcctagctgggccagccaaggagctacgggacaatgggatcatw
gtctatagcatcggagtggttggagcaaataagcaagagcttgagctcatggcaggggac
acgaataaggttttctttgtggatgacttccataaactagacacactgcacaaaaatatt
tcctttgaattctgccaaacgagcaaaccagtctgtgaaaaaacgcagggggatctggtc
ctgttgattgacagctcagggagcatcagcaccaccgacttcactatcatgaagaagttt
gccacagaccttgtttccagcttcaacattgcagagcagtccttccgggtgggagtcgcc
cagttcagcagtgatcctaaaaaggagttcttcttgaatgagtattacacagaagcagag
gtgaacaaccagataaacaatatgatgcagattaggtacacaacgaacatcggaaaggcc
ctggactacgtccgtacagagtacttccaaccagctagagggagccgtatcaatgccaag
gtctctcagaacctggttgtgatcactgacggacgttcagatgacgatgttgttgatgca
gcagagaagctcaaggccatgaacattgaggtgtttgccatcggtatcgggaaagaccac
aaacctgttgagcttgggcaaatcactctcaacccggaaagggtcttctctgtgcaggac
tttgccagcctggacaagatcaaaaagaaggtggtggatactatatgctcctccaaggta
ccagacactcaagcgkgctgcaccatagacattgccatggggttcgatattacacgcagg
gccacccacccgggctcttcgatggccaagcccagccaggccttcctgccacagatcatc
cgctatgtgtccaacctgaagggcctgtgctgcgtggcgggagatggaaaaggtatcaac
gccctgcttacagtcgccctagaagggnatccaaatgccaaccttcttcagaaggtggag
tttgggcgaggatttggctacaagcagccgctccacattggcatgcacatttgggaaaca
cctgttgacacaaatatggctgagagggagtgctgcaatgtgatgtgtaagtgcaccgga
catgagggtatccgtggcacagaggacacccgggacaagggtcagccaggactgaaagga
caccctggcttccctggcgaggatggggggattggcgagagaggtccaccaggtcccact
gcccacagggactacagggctgttctgggaggagaggcgtcaagggctcaagcctacaga
ggggacaggggtgatgatggagaccatggccttgatgggnttgatggtgaacagggtctg
attggaacagctggagctgcaggagagagaggaaacccaggaagaccagtaaacacaatt
tctctattctacatatatttcgccaattactactctaggcaacagctcggcctcatagga
gagccaggagtgaaggggcagcgtggacttagaggtgaccctggagactctggagtggac
agcattgtcgrgggtcccaaaggaggaaggggaaacccaggactaccgggagactcagga
gaagagggcagtcgagcagaaagtggaatcgttggaaacccaggaacaccaggggatcca
ggagatgtaggcctccaaggaattcctggcccttctggaccacagggtataagaggagac
ttgggccagcccggacccaggggcctgcagggtttacctggacctcagggccaacctggg
gacctcggagtcacggagcccttggaacacttgggccaagagggcggtaagggtcttgat
ggcagtgacggccatgggcctcccggaccccagggaatgaagggagagcctggtttccat
ggttaccctggattacgggtgaaagtggtgattttggagtcaaaggaggtccaggcccca
aaggaaaccgaggcagagggggctctagaggcagaccaggagagagagccatcatgctct
caaggccaggcagcgtgcccagcctaccccacagagctggtctttgctctggatatgtca
caggatgtggagcctgccacgtttgagaggatgcgctccgctctcctctccatattggat
gacgttgccatcnnccgagagcaactgcccgacggtgcacgtgttgccgtggtatcctat
agtgccaacaccaagtacctgatccgattccaggactaccaacgcaagccggagttgttg
gaggccatccaaaacattgcactggaacgaacgtccaaccagcaccatcttggggaggcc
atgcgctttgtggggcgccatgtcttcaagcgaacccgtaaagcattgacgatgaggaag
gtggcagtgttcttcaccaacggcncctctgtggacagcactgccatcatcacggccgcc
atggagttcaaggccctgaacatcgctcctgctgtcatcgccatgaggaactcccccgat
gttcaacgggcttttgaggctgatgacacyggcagcttcatcctcgttcggctggtggat
aggtcacaggaccaaaatgctgtgctgacaagaatcaaaacttgcgtcatctgctatggt
aagcacacagggccaaaataa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112240032
Entry
112240032         CDS       T05605                                 

Definition
(RefSeq) collagen alpha-1(II) chain-like
  KO
K19719  collagen type II alpha
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112240032
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112240032
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:otw00536]
    112240032
Glycosaminoglycan binding proteins [BR:otw00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   112240032
SSDB
Motif
Pfam: COLFI Collagen
Other DBs
NCBI-GeneID: 112240032
NCBI-ProteinID: XP_024264174
LinkDB
Position
Unknown
AA seq 760 aa
GTFPRRQDYLYPHMFPLFLGPYPRRPGALVPSMFPFFLVPSPPPGRFTQFHCFMDLPRQP
GLTGPIGPPGPAGPNGEKGESGPSGPSGAAGARGAPGDRGETGPPGPAGFAGPPGSDGQP
GVKGEQGEGGQKGDAGAPGPQGPSGAPGPSGPTGVSGPKGARGAQGPSGATGFPGAAGRV
GPPGPNGNPGAAGPSGPAGKDGPKGVRGDGGPPGRQGDAGLRGAAGSPGEKGDAGEDGPS
GPDGPSGPSGLAGQRGIVGLPGQRGERGFPGLPGPSGEPGKQGSPGGSGDRGPPGPVGPP
GLTGPAGEPGREGNAGSDGPPGRDGATGIKGDRGNTGPAGAPGSPGANGSPGPVGPTGKQ
GDRGEAGAQGPAGPAGPAGARGMAGPQGPRGDKGEAGEGGGPERTEDSLVCRGLPGPPGQ
AGDQGASGPAGPSGSRGPPGPIGPHGKDGSNGMPGPIGPPGPRGRSGETGPSGPPGNSGP
PGPPGPPGPGIDMSAFAGLSQPEKSPDPLRYMRADQASGNLRTHEAEVDATLKSLNNQIE
NIRSPEGSKKNPARTCRDLKLCHPDWKSGEYWIDPNQGCTIDAIKVYCNMETGESCVYPK
PASIPKKNWWSSKSKAAKHVWFGETMNGGFHFSYGDDSLAANTASIQMTFLRLLSTEASQ
NLTYHCKNSVAYMDGATGNLKKAVLLQGSNDVEIRAEGNSRFTYTVMQDGCTKHTGAWGK
TVIDYRSQKTSRLPIVDIAPMDIGGADQEFGVDVGAVCFL
NT seq 2284 nt   +upstreamnt  +downstreamnt
ggggacattcccccgcagacaggactatctgtacccccacatgttccccttgttccttgg
accttacccccgcaggccgggcgcgcttgtcccctccatgttcccctttttcctggtccc
ttccccgccgcccgggcgctttacccagttccattgtttcatggaccttccccgtcagcc
tggtttgactggtccaattggtcctcctggcccagctggtcccaatggagagaagggtga
atctggtccctctggaccttccggtgctgctggtgcccgaggtgctcctggtgacagggg
tgagactggacctcctgggcctgctggcttcgctgggcctcctggatctgatggtcagcc
cggagtcaagggagagcaaggagagggtggacagaagggagatgctggtgcccctggacc
acagggaccctccggagctcctggaccttccggacctactggcgtttctggacctaaagg
tgctcgcggtgctcagggaccctctggagccactggtttccctggagctgccggcagagt
cgggccccctggtcccaatggtaaccctggtgctgctgggccctctggccctgctggtaa
agatggccctaaaggtgtgcgtggagacggtggacccccaggcagacagggagatgctgg
gctgcgtggagctgctggctcccctggagagaagggagatgctggagaggatggtccctc
tggtcccgatggtccttcaggcccttcaggtctggctggacagcgtggcattgttggtct
tccaggacaacgtggagagagaggtttccctggcctgccaggaccctctggtgagcctgg
taaacaaggatctcctggtggaagcggagaccgtgggccccctggccctgtggggccccc
tggactgactggacccgcaggagagcccggtagagagggcaacgctggttctgatggacc
ccctggtagagatggagccactggaatcaagggtgaccgtggtaacaccggtcctgctgg
tgctcctggctccccaggtgctaatggttcccccggccctgtcggccccaccggcaagca
gggagacaggggagaggctggagctcaaggaccagctggacctgccgggcctgctggagc
cagaggaatggctggaccccaaggaccccgtggagacaagggtgaggctggagagggtgg
tggaccagaaaggacagaggattcactggtctgcaggggtctgcctggacctcctggtca
agctggagaccagggtgcatctggacctgccggaccaagtggatcaagaggacctcccgg
acctattggtccacatggaaaggatggttccaacggtatgcccggccccatcggaccccc
cggaccccgtggtcgctctggagagactggtccctctggtccccctggaaactccggtcc
ccctggtcctcctggtcctcccggccctggtatcgacatgtctgccttcgctggcctgtc
tcagcctgagaaatcccccgatcccctgaggtacatgagggccgaccaggcctccggaaa
cctgaggacgcacgargccgaggtggacgccacgctcaagtctctcaacaaccagattga
gaacatccgctcccccgagggctccaagaagaaccctgcacgtacttgcagagacctgaa
gctgtgccacccagactggaagagcggagagtactggatcgaccctaaccagggctgcac
catagacgctatcaaggtctactgtaacatggagaccggagagtcctgcgtctaccccaa
gcccgccagcatccccaagaagaactggtggtccagcaagagcaaggctgccaaacacgt
ctggttcggagagaccatgaacggaggattccacttcagctatggcgatgacagcctggc
tgccaacacggccagcatccagatgaccttcctgcggctgctttccaccgaggctagcca
gaacctcacctaccactgcaagaacagtgtggcttacatggacggagccacgggcaacct
gaagaaggccgtgctcctccagggctccaacgatgtggagatcagggccgagggaaacag
ccgcttcacctacaccgttatgcaggacggctgcacgaaacacacaggagcatggggcaa
gacagtgattgactacagatctcagaagaccagccggctgcccatcgtggacattgctcc
catggatattggaggagcggaccaagagtttggagtcgacgtcggtgcagtctgcttctt
gtaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112240769
Entry
112240769         CDS       T05605                                 

Definition
(RefSeq) collagen alpha-1(VI) chain-like
  KO
K06238  collagen type VI alpha
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112240769
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112240769
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112240769
   00536 Glycosaminoglycan binding proteins [BR:otw00536]
    112240769
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   112240769
Glycosaminoglycan binding proteins [BR:otw00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   112240769
 Hyaluronan
  Extracellular matrix or blood plasma proteins
   112240769
SSDB
Motif
Pfam: VWA Collagen VWA_2 DUF1194 VWA_3
Other DBs
NCBI-GeneID: 112240769
NCBI-ProteinID: XP_024264777
LinkDB
Position
Unknown
AA seq 718 aa
MPGEKGDIGVEGNLGDPGPVGYRGMKGDRGGIGNKGERGHKGYKGDKGRQGTDGVDGRKG
DPGFPGLAGCKGSPGPDGSQGDGGPKGDPGPYGTKGAKGDRGKNGEPGRPGNYGPPGTKG
TLGPKGANGDKGQRGDDGAPGPDGLRGDKGTPGEKGEQGTRGNRGPRGDLGDPGPRGDQG
REGSSGANGEPGDIGRAGSPGYRGDEGAPGPEGPKGPRGIKGAPGDRGQIGNRGEDGAPG
NGTEGCHGFQGYPGPRGGIGEPGGKGTPGPKGDDGEPGNPGLDNDSPGLPGNKGAKGHRG
PEGNPGPVGPPGPAGVDDCEILDIIMKLCSCCECKCGPLDLAFIVDSSESIGSTNFALAK
DFIITVIDRLIKDQQVRFGFNESRVGVVQYSGDGAQEAVRLGDPNINTLTELKQAVRDLR
WLAEATYTGEALQFSLTNMIDRLQQENRVVLVLTDGRSDITRDKTPLNTLCGKGIKVGGL
GVKDYSGRQPNHEQLSAVVCTSDPKPGFSFVLENFAELLDDSFLQNLTTRICEDKKCPNY
KCPINFSGDTDIVLMMDSSASVGQRNFDSSKTFVKRLAERFLSAERSGRAAVRVAVGQYS
RERRMEAELTSNLTLLTSKIEAATFQNDGTDVTKAMAFAMEKFQMSGGGNRKRKLVLFSD
GRSQGVTEAMLEKRVRLVSEEGVELYVITVGNQVSEANLRSLVSRGRSYDVTYAQRHL
NT seq 2153 nt   +upstreamnt  +downstreamnt
atgccaggcgagaagggagacatcggggtagaggggaacttgggagaccccggtcccgta
ggataccgtggaatgaagggcgaccgaggtggaataggcaacaagggcgagagaggccat
aaaggctacaagggagacaaaggacgacaggggacagatggagttgatggacgtaagggt
gatccagggtttcctggtctagccggctgtaaaggttccccaggacctgacggctcacag
ggagacggaggtcctaagggagatcctggtccatacggaaccaaaggagctaagggtgat
cgggggaaaaacggagaaccaggacgacccggtaactacggaccgcccggaaccaagggt
acactgggcccaaaaggagccaatggggacaaaggacagcggggtgatgatggagcacct
ggaccggacggcctccgaggagacaaaggaaccccaggagagaaaggagaacaaggaacc
cgtggaaacagaggaccaagaggagatttgggtgacccaggacctcgtggagatcagggc
agagagggttcatctggagccaatggagagcctggtgacattggcagggcggggtctcca
ggatacagaggagatgagggcgcccccgggccagagggccccaaaggaccaagaggaatc
aaaggagctcctggagacagaggccagatcggaaacaggggagaagatggggcaccagga
aatggaactgaaggttgccatggtttccagggttaccccggcccacgagggggcattgga
gagccgggcgggaagggaaccccaggacccaaaggagatgacggagagcctggaaaccct
ggcctggacaacgactccccaggtctcccagggaacaaaggagccaaaggtcaccgagga
cctgaaggaaacccgggaccagttgggcctcccggacctgcaggagttgatgattgtgag
attctggatatcatcatgaagctttgctcgtgctgtgagtgtaagtgtgggcccctggac
ctggccttcatcgtggacagttctgagagtatcggctccactaacttcgctctagctaaa
gacttcatcatcaccgtcatagaccgccttattaaggaccagcaagttcgttttggtttt
aatgagtccagggtaggcgtggtgcagtacagtggggatggagcccaggaggctgtcaga
ctgggagaccccaacattaacacactgactgagctcaaacaggcggtgcgggacctgcgc
tggctggctgaggccacctatacaggggaggctctgcagttctctctgaccaacatgatt
gaccgtctgcagcaggagaaccgcgtggtcctagtgctcactgacggacgctctgatatc
accagagataaaacaccactcaacacactctgtgggaagggcatcaaggtgggtggtctg
ggagtgaaggactactctggccgtcagcccaaccatgaacagctcagtgctgtggtctgt
acgagcgaccctaaaccaggcttctccttcgtactggagaacttcgctgagctgctggat
gacagcttcttacagaacctcaccacacgcatctgtgaagataagaagtgtcctaactac
aaatgtcccatcaacttctcaggggacacagacattgtattgatgatggacagttcagcc
agtgtgggacaaaggaactttgactccagcaagaccttcgtcaagcgtctggctgagcgc
ttcctgtctgccgagaggtccggccgtgctgccgtgcgtgtcgccgtgggccagtacagc
cgtgaacgccgcatggaggcggagctgacctctaacctcaccctgctgaccagtaagatt
gaggccgccaccttccagaatgatgggactgacgttaccaaggcgatggcctttgccatg
gagaaattccagatgtcagggggcgggaacaggaagaggaagctagtgctgttctctgac
gggagatctcagggcgttaccgaggcgatgctggagaagcgcgtacggctggtgtcagag
gagggagtggagctgtatgttatcaccgtgggcaaccaggtgagcgaggccaacctgcgc
tcgctggtcagcagggggaggagttacgacgtcacctacgcccagcgccacct

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112241524
Entry
112241524         CDS       T05605                                 

Definition
(RefSeq) collagen alpha-2(IV) chain-like isoform X1
  KO
K06237  collagen type IV alpha
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112241524
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112241524
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112241524
   00536 Glycosaminoglycan binding proteins [BR:otw00536]
    112241524
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   112241524
Glycosaminoglycan binding proteins [BR:otw00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   112241524
SSDB
Motif
Pfam: Collagen C4
Other DBs
NCBI-GeneID: 112241524
NCBI-ProteinID: XP_024265375
LinkDB
Position
3
AA seq 1681 aa
MSGAMQATHQRQLKNLRFLILCFSVAILASGVDAGGKKHSGPCGGRDCSGGCQCFPEKGA
RGQPGLLGSQGPQGPPGRLGDPGVQGVQGEKGDRGRGGFIGPKGSVGMTGVPGFSGLDGI
PGHPGQAGPRGKPGADGCNGTHGDSGSAGQPGYDGQPGYNGQMGRKGQKGDTLELSVFME
RFRGDSGQPGYPGLVGPQGYPGRSGYRGLPGPQGPQGYPGLPGPKGTMTKVLKGVKGEPG
DAGKPGPQGNSTHSQTGPITGPNGIKGEKGLKGDTGPEADNKGETGVIGMPGQRGIPGRD
GEQGLRGDLGEPGLRGRDGQKGARGEPGELIYHDGPSGGQDRVGPPGPPGQLGPQGQRGL
EGEKGLPGRAGPPARKDHDQQQVVDLWGPFGEPGVKGEMGEPGELGIPALSPGPPGINGL
PGLGGPPGPPGSWADFYKGFSGPRGRPGSAGRKGLKGDHGLCECNIVHSPPGLPGPAGSQ
GDTGKSGEVGQQGESGEPGPRGVIGLPGFPGATGQPGPKGRKGEFVQAKEKGYAGDPGDP
GATGDPGMQGFPGPSGINGFPGNRGPSGDAPAGLTGEKGYQGRPGLPGLLGQMGEPGRVL
GTTKGVRGLQGDDGEQGHAGIKGRAGDPGVSGCSPKGDGEQNDITGDCDAIPGPPGIPGP
PGPHGLEGFLGLPGQKGSTGVLGDNGAKGEIGDQGRGGSPGYPGFRGLHGDLGQPGSKGN
SGTQGLPGQQGRNGEPGEKGPHGEIWGASTGQRGEVGLPGEQGPKGLSGEPGNEGYPGMG
GMPGMIGFKGVVGPSGLQGEQGGPGAAGKYGWPGVPGTAGVPGPTGSTGQPGLSGNRGDQ
GDPGTPGPIGLKGTLGEFGSQGAEGNTGDQGDPGVPGPTGHSGLPGFKGIKGSRGMSGFG
GMPGVSGLKGFSGQKGETGNPGEFGQKGNMGDYGSKGDRGLRGPTGEKPHIPRQIIKDMK
GTKGEDGTTGQIGFTGPRGPKGFPGVPGMEGYHGVPGDPSDEKGFQGNPGAQGLPGPKGM
PGLTGSNGISGFPGMSGHRGDKGNPGAYGSSGDPGVKGVKGEGGAVIDMPGSTGLRGEDG
FPGLPGQKGYIGNLGDRGGGGFHGIEGMKGVPGEPGTGGPVGSDGQQGFPGNQGTKGWPG
VPGESGTHGQPGFPGQRGFPGLKGIFGLDGLKGQKGIPGLPGQDNFGTPGDPGAKGARGE
TGIPNSEVGTPGSLGLKGVQGQPGDQGQVGPPGFQGPQGPQGTSDRPGPSGEPGFPGPKG
LPGFPGPRGLPGEPSQYGEKGLTGQYGVTGFPGLKGKQGDQGPSGYQGQSGVSGKKGVKG
GQGMMGFPGRSGFQGDRGPSGPKGSTGLTGYPGFPGNQGPAPLPTRMPGERGAPGPQGIR
GPEGVRGESGPKGPPGDPGYFGPQGQKGMPGVGGTPGTPGYRGNVGGRGHLGLQGMEGHH
GNPGTTGLHGMPGRSVSVGYLLVKHSQSEQTPMCPVGMSKLWDGYSLLYFEGQEKAHNQD
LGLAGSCLPRFNTMPFLYCNPGDVCYYASRNDKSYWLSTTAPLPMMPVEEGDIKPYISRC
SVCEAPSVAIAVHSQDITIPQCPAGWRSLWIGYSFLMHTAAGDEGGGQSLSSPGSCLEDF
RTTPFIECNGAKGTCHYFANKHSFWLTSIEQSFHAEPASETLKAGQLLSRISRCQVCMKN
L
NT seq 5046 nt   +upstreamnt  +downstreamnt
atgagtggggcaatgcaggcaacacaccagagacaactgaagaacctgaggtttctgatt
ctatgtttttcggtggccatcctagcgtcgggagttgacgcaggtggaaagaagcacagt
gggccatgtggagggagagactgcagcggagggtgtcaatgcttccctgagaaaggtgcc
agaggccagcctggtcttcttggttctcagggcccccaggggcctccaggacgtctaggg
gacccaggagtccagggagtccagggagagaagggcgacaggggcagaggaggcttcatc
ggccccaagggttctgtggggatgactggtgttcctgggttttccgggttggatggtatt
cctggccacccaggacaggctgggcctcgtgggaaacctggagcagacgggtgcaacgga
acacacggagactcagggtcggcagggcaaccaggctacgatggccagcccgggtataat
ggccagatgggcaggaagggacagaagggagacactctggagctgagtgtgttcatggag
cgcttcaggggagattcagggcagcccggatatcctggattagttggtcctcagggttac
ccaggtcggtctggctacagaggactcccgggaccacagggcccacaagggtatcctggt
cttcctgggccaaagggcaccatgaccaaagtgttgaaaggggtcaaaggagaacctggt
gacgctggaaagcctggtccccaagggaactccacccattcccagaccggtccaattact
ggacccaatggcataaagggcgagaaagggttgaaaggtgatactggtcctgaggctgac
aacaaaggagagactggtgttatagggatgcctggacaacggggcatccctggtcgggat
ggagagcaaggactgaggggggacttgggagaaccaggactgaggggcagagatggtcaa
aagggtgccagaggagaaccaggggagctgatttatcatgatggtccctcaggagggcag
gacagagttggtccccctggtcctcctggacagctgggtccccagggccagaggggtctg
gagggggagaaaggtcttccaggccgcgctggacctcctgccaggaaggatcatgatcaa
caacaagtggtggatctgtggggtccattcggagagccgggggtaaagggagagatgggc
gaacctggagagctaggtatccctgccctcagccccggacccccgggtatcaatggcctg
cctgggctcgggggcccacccggaccaccaggatcgtgggcggacttctacaagggattt
tcagggccgagagggcggccaggctctgcgggaagaaaaggactgaaaggtgatcacggg
ttgtgcgagtgcaacattgtccattcccctccgggcctgcccggccctgctggtagccaa
ggcgacactggaaagagtggcgaggttggtcagcagggagagtcaggagagccaggaccc
cgaggtgtcatcggactgcctgggttccctggtgccacaggacaaccgggtccaaagggc
aggaagggcgagttcgttcaggccaaagagaaaggatatgccggggacccaggagaccca
ggtgcgacaggtgacccaggaatgcagggcttccctgggcccagtgggatcaatggattc
cctgggaatcgtggtccttcaggagatgcacctgctggtctcactggagaaaaaggttat
cagggccggccgggtctgcctgggttgttgggacagatgggagaaccaggacgggttcta
ggtacaactaaaggggttcgagggttgcaaggcgatgatggggagcagggtcatgctggt
atcaaaggtcgagctggcgatccaggagtgtctggctgtagtccgaaaggagatggagaa
cagaatgacatcacaggtgattgcgatgccatacctggaccacccggtataccaggacca
ccaggaccccacgggttagaaggtttcctaggtctcccaggtcaaaaaggatcaacaggt
gtacttggagataacggggccaaaggagagataggagatcaaggcagaggagggtcacct
ggatatccaggttttaggggcctccatggagacttgggtcagcctggctcaaagggtaat
tctggaacccaaggtctgccaggtcaacagggtcggaacggggagccaggagagaaggga
cctcacggggagatctggggagcgtcaaccggacaacgtggagaagtgggtcttcctgga
gagcagggacctaaagggctcagcggagagcctggaaacgagggttacccagggatgggt
ggcatgcctggtatgattgggttcaagggcgtcgtaggtccttcaggtctgcaaggggag
caaggaggaccgggagctgctgggaagtatggctggccaggtgtacccggaacggctggt
gtccctggaccaacaggaagcaccggacaaccaggtttgagcggaaacaggggtgatcag
ggggaccctggcacaccagggcccataggactaaaggggacactgggggagtttggtagt
cagggcgctgagggaaacaccggagaccagggtgaccccggagtgccaggacctacagga
cactctggcctgccagggttcaagggtatcaaagggtctcgtggcatgtcagggtttgga
ggaatgcctggtgtgtcgggcctgaagggcttctctggacagaaaggagagactggcaat
cccggcgaatttggacagaaaggaaacatgggcgactatggttcaaagggtgaccgtggt
ctgaggggtccaactggcgagaaaccccacatccctcgtcagatcatcaaagacatgaag
gggacaaagggagaagatggaaccacaggacagattggattcactggacccagaggtcct
aaaggttttcccggtgttccgggaatggagggctaccacggcgttcccggagaccccagc
gatgagaagggtttccaaggcaacccaggcgcacagggacttccggggccaaaaggaatg
cctggtctgacaggatcaaatggaatcagcggctttcccgggatgtctggtcacaggggg
gataaaggtaaccccggtgcctacggatcctcaggagatccaggagtgaagggtgtcaaa
ggtgaggggggtgccgtaatcgacatgcccggatccacaggactgaggggggaggatggt
ttccctgggcttccaggtcagaagggctacattgggaatctgggagacaggggaggtgga
ggtttccatggtattgagggcatgaagggcgtgccaggtgaacctggcacaggaggacct
gtaggatctgatggtcaacaagggtttccaggcaaccagggtacgaagggatggcctggg
gtccccggagaatcaggcacacatggacaaccaggcttccccggacagagaggtttcccg
ggactaaagggtatattcggactggatgggctgaagggtcagaagggaatccctggactt
ccaggtcaggataactttggaaccccaggtgaccccggtgctaagggagcgaggggagag
acaggtatacccaactccgaggttgggacacccggatcgctgggtttgaagggagttcaa
ggacaaccaggtgaccagggccaggtgggacccccagggtttcagggcccccaagggcca
cagggcacctcagacagacccggaccgtcaggagaacctggcttccctggacccaaagga
ctgccaggtttccctgggccccgtggtttacctggtgagccctctcaatatggagagaag
ggtttaactggccagtatggcgtcactggattccctggtctgaaaggaaagcagggggat
cagggaccatcaggataccaaggacagagcggagtgtctgggaagaaaggtgtgaaggga
ggtcaagggatgatgggatttcctggtaggtctggtttccaaggagaccgaggtccttcc
ggcccaaaaggaagtactggactcacaggttatccaggattcccaggtaaccagggccca
gccccactacccaccaggatgccaggagagaggggtgctccaggtcctcagggtatccga
ggaccggagggggtacgaggggagagcggccctaaaggaccccctggagatccaggctac
tttgggccccaggggcagaaggggatgccaggggtgggtggcacaccaggtacccctggg
taccgtgggaatgttggagggaggggccatcttggtctgcagggcatggaaggtcaccat
ggtaacccaggaactacagggttgcatggcatgccgggccgcagtgtgagcgtgggatac
ctgctggtgaagcacagccaatcagagcagacccccatgtgccccgtgggcatgtcgaag
ctgtgggacggctacagtctgctgtacttcgagggccaggagaaggcccacaaccaggac
ctaggtctggcgggctcctgcctccctcgtttcaacaccatgcccttcctgtactgcaac
cccggagacgtctgctactacgccagccgcaacgacaaatcctattggctgtccaccacc
gcgccccttcccatgatgcccgtggaggaaggtgatatcaaaccctacatcagccgctgc
tctgtgtgcgaagctccgtccgtcgccatcgccgtgcacagccaggatattaccatccca
caatgccctgctggctggcgcagcttgtggattggttactccttcctcatgcacacggca
gcaggtgatgagggtgggggtcagtctctgtcatctcctggttcctgtctggaggacttc
cgtaccacacccttcatcgagtgtaacggggccaagggcacctgccactacttcgccaac
aaacacagcttctggctcacctccatcgaacagtccttccatgcagaacctgcctcagag
accctgaaagcaggccagctcctctcacgcatcagccgttgtcaggtctgcatgaagaac
ctgtga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112241545