KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112214510
Entry
112214510         CDS       T05605                                 

Definition
(RefSeq) insulin receptor substrate 2-B-like isoform X1
  KO
K07187  insulin receptor substrate 2
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04140  Autophagy - animal
otw04910  Insulin signaling pathway
otw04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112214510
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112214510
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112214510
   04920 Adipocytokine signaling pathway
    112214510
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:otw04990]
    112214510
Domain-containing proteins not elsewhere classified [BR:otw04990]
 Phosphotyrosine binding (PTB) domain-containing proteins
  IRS related family proteins
   112214510
SSDB
Motif
Pfam: IRS PH PH_11 PH_8
Other DBs
NCBI-GeneID: 112214510
NCBI-ProteinID: XP_024229067
LinkDB
Position
15
AA seq 1340 aa
MANLMNYQENKAAMLLVETQQRGIGTTPAATAANGYTSIGEPPSPLLNICGGSGARFHQH
MPPSNHHSHHHYPQSSLPKEQRPLLHHYPAATQQHTLSGENIPGSPVRKASLSSLNLVHE
DPSASHHALAASVNAASAAIQLAANANVSVATSGVMDDIRKCGYLRKQKHGHKRFFVLRV
ASHLGLSRLEYYDSDKKFRSSLRSSAAAPKRVIYLYQCFTVNKRADSKNKHLIALYTKDE
YFAIVAENEQEQEDWYVALSELMSEGKKGHLDSDELDDGYGTVTPGTVFKEVWQVNVKPK
GLGQTKNLTGVYRLCLSSKTIHLVKLNSETPYVNLQLMNIRRCGHSESFFFIEVGRSSSI
GPGEIWMQVDDSVVAQNMHETILETMKALKAFAEIRPRSKSQSSGSNPMAFITTRRHLGN
LPPSQTGLQRRSRTESAVGTPPSSKSSGASGYRFRTSSEGEGTMNRPFRSVTGSLIHLNT
ARIHLGRQEGGGGAGNTGGGGRYARALPGSNCHTRSASLPVSHFSSTTSPVSVSSSSGHG
SVSDTLTRPSSSSICGSPSDGGFNSSDEYGSSPGDFRYFRVRSNTPDSLGNTPPIREENC
LSDYMAMGWHREVFGAGGVSSSGGAEAPHRDESTSTDEDRSLRRRTHSFTRPGSQGGVAG
GSSCVAVYQKMTQTTFSQDELVSVEEALSLGRTGSSNQPSSTSSSLRSDYSSCSEHSQGR
PPLSSYPSAKEDSGYMPMLCGVAASPRDTPDYMPMQPSSHSHPHHHSLSHPPQPSHSPQA
SSPALAPRSVHQLQPHQPTDPQGYMMMLPGGPSSSSPVQASPSPHSSSSNMGLGVGSSGS
IVERPETGEYMDMSYSSGKGGNATGGRKLSNEGGYYTLSNPEGTPKSYSPYFSLPRSYKA
PVARDGEQRKWEHEEYVPMSSPAKPIYSQVTGVTTKGFSSGGSDAHHPPPYGAHHQAARG
DRRTTAVRPNRLPLGRHSFHGSLRVSEPAAAEGPSSPGEYINIEFGDPYGPLTSCPLSDQ
YVSPSMGSAEQRHSPPQNQDYMSVVVGGGRDDGCRLTKNQSPRPSLVAPWNPPSYIRPLT
ANSSLSGALGSSGAHWRTGTDDYTDMTFNLSKDEGSRGSQSSPTAMLQHLCVMEGRYPPT
LLPHTISPPSSFSPQPEPPKVVRADPQGRRRHSSETFSSTPGGGRTTSSSTGTNPPSSSA
NPSAINGALLTEGSKWASSGSFDSVWMCVEGIGVDLAAQPGPSDLGMDSASSGGPPGGHM
CRNVSVGYQNGLNYIALELREDQESNTLPIPQQQGGTGPTPNAPSAGNVTVPVAENNGAY
ASIDFTKSDGMTATFTDRKR
NT seq 4023 nt   +upstreamnt  +downstreamnt
atggccaatttgatgaattaccaagaaaacaaagccgctatgttgttggtggagacgcaa
cagaggggcatcgggacaacaccagcggctacggcagccaacggctacacctcaattggg
gaacccccttccccgttattgaatatctgcggtggcagtggagctcgttttcatcagcac
atgccgccctccaaccaccacagccaccatcactacccccagagctcgctgcccaaagaa
caacgcccgctgttgcaccactatccggcggcgacacagcagcatactctctctggtgaa
aacatcccagggtccccggtaaggaaagcctcgttgtcgtctttgaacctggtacatgag
gacccctctgctagccaccacgcactcgctgcatcggtgaacgcagcgtcggctgcaatt
cagttggctgcgaatgctaacgttagcgtcgctacctcaggggtcatggacgacattcgg
aagtgtggctacctacggaaacagaagcatggacacaagcggtttttcgttctgagggtg
gccagccacctaggcctcagccggctggagtactatgacagcgataaaaaattccgcagt
agcctgcggtcttcagctgcagccccgaaacgggtgatctatctgtatcagtgcttcacc
gtcaacaaaagagcggattccaagaacaaacacctcatagccctctacactaaggatgag
tactttgccattgtggctgaaaacgagcaggagcaagaggactggtatgtagccctgagt
gaactaatgagtgaggggaaaaaggggcatctagactctgacgagttggatgatggctat
ggtacagtcacaccaggtacggttttcaaagaggtgtggcaggtgaatgtgaaacccaaa
ggtctgggtcagaccaagaacctcacaggtgtgtatcgtttatgcctctcttctaaaact
atccatctggtcaaactaaactctgagacaccgtatgtcaacctccagctaatgaacatc
agacgatgtggacactcagaaagcttcttcttcatcgaggtgggtcggtcatcctccata
ggaccaggggagatatggatgcaggtagatgactctgtcgtggctcagaacatgcacgag
accatcttagagaccatgaaggctctgaaggccttcgcagagatccgccctaggagtaaa
agccaatcatcgggctccaaccccatggcgttcatcaccacccgccgtcacctaggcaac
ctgccgccgagccagacaggtctccagcgccgctcccggaccgagtcggcggtcggtacg
ccaccatcgagtaagagctccggtgccagtggctaccgcttcaggacatcaagtgaaggt
gaagggacgatgaaccggccattccggtctgttaccggcagcctgatccacctgaacact
gcccggatacacctagggcgccaagagggtgggggaggggcagggaacaccgggggagga
gggcgctatgccagggcgctaccgggctccaattgccacacccgctccgcctcgctccca
gtctcccacttctcctccaccacctcccccgttagtgtgtccagcagcagcggtcacggc
tcagtctctgacaccctcacccggccctccagctcgtccatatgcggctccccctctgac
ggcggcttcaactcctcagacgagtacggctcaagccccggagactttcgctacttccga
gtccgtagcaacacacccgattctctgggcaacaccccaccaatcagagaagagaactgc
ctgagtgactacatggccatgggctggcaccgcgaggtgtttggagcgggcggcgtgagt
agctctggtggtgccgaggccccccaccgggacgagagcacgtcgacggacgaagaccgg
tctctgaggcggcggacacactcgttcacgcggcccgggagtcagggtggtgttgccggc
ggtagcagctgcgtggctgtgtaccagaagatgacccagaccaccttctcacaggacgag
ttggtgtctgtggaagaggctctgtctctgggccgcaccggcagcagcaaccaaccttcc
tccacctcgtcctccctccgctccgactacagctcctgctccgagcacagccagggcaga
ccccctctttcctcctatccctcggccaaggaggacagtggctatatgcccatgttgtgt
ggggtggcagcctcaccccgtgacaccccggattacatgcctatgcaacctagctcccac
tctcatccccatcaccactctctctcacaccctccccagccctcccactccccccaggcc
tctagcccagccctggccccacgctcggtccaccagctccaaccccaccagcctacagac
ccccagggctacatgatgatgctaccagggggaccgagctcctcttctccagtccaggcc
tccccaagtccccacagcagtagcagtaacatgggtctgggtgtcggtagttctggtagt
atagtggagcggcctgagactggagagtacatggacatgtcgtacagcagtggaaaagga
gggaatgcaacaggaggacggaagctctccaacgaaggaggatactacacactgagcaac
cctgaaggtacccctaaatcatacagtccctacttctccctgcctcgctcctacaaggcc
cctgtcgccagagatggtgaacagagaaaatgggagcatgaggaatatgtgcctatgagc
tccccggctaaacccatctactcccaggtcactggcgttacaacaaagggtttcagtagt
ggggggtcagacgcccaccaccccccgccctacggtgcccaccaccaagcagctcgaggt
gaccgacgaacgactgcggttcggcccaaccgcctccccttgggccgccacagcttccat
gggtcgctgagggttagtgagccagctgctgccgagggaccctccagccccggcgagtac
atcaacatcgagtttggggatccctacggacccctcacatcctgccctctctctgaccag
tacgtctcaccctcgatgggctctgccgagcagcgtcactcccctccccagaaccaggac
tatatgagtgtagtggttggaggtgggcgtgatgatggttgccgcctgactaagaaccag
tcccccagaccctctctggtggccccatggaacccacccagctacattcgaccgctgacc
gccaattcctccctgagcggggctcttggctcttctggcgctcactggcggacgggaaca
gatgactacacagatatgacctttaaccttagcaaggatgaggggtcgcgggggtcacag
agtagccccacagctatgctgcagcacctgtgtgtgatggagggccggtacccccctacc
ttactcccccacaccatcagccctccctcatccttcagcccccagcctgagccccccaaa
gtggtacgtgctgacccccaggggcgacgcagacacagctctgaaaccttctcctccacc
cccggaggaggcagaaccacaagctccagcaccggcaccaatccaccctcgagctcagcc
aacccctctgccatcaacggagctctcctgaccgagggctccaagtgggccagctctggc
tcctttgatagcgtgtggatgtgtgtggaggggataggggtagatttggctgcccagcca
gggccctctgatctgggcatggactcagcctcctctgggggccctcctggaggacatatg
tgcagaaatgtgtctgtgggatatcagaacggcctcaactacattgccctggagctgaga
gaggaccaggaatctaacacactccccataccgcagcagcaggggggaaccgggccgacc
cccaatgccccctcagctggtaatgtgactgtgccggtagcggagaacaacggcgcctat
gccagtatagacttcaccaagtcagacgggatgactgccacgttcacggacagaaagcgt
tag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112216688
Entry
112216688         CDS       T05605                                 

Gene name
irs1
Definition
(RefSeq) insulin receptor substrate 1 isoform X1
  KO
K16172  insulin receptor substrate 1
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04140  Autophagy - animal
otw04150  mTOR signaling pathway
otw04910  Insulin signaling pathway
otw04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112216688 (irs1)
   04150 mTOR signaling pathway
    112216688 (irs1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112216688 (irs1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112216688 (irs1)
   04920 Adipocytokine signaling pathway
    112216688 (irs1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:otw04990]
    112216688 (irs1)
Domain-containing proteins not elsewhere classified [BR:otw04990]
 Phosphotyrosine binding (PTB) domain-containing proteins
  IRS related family proteins
   112216688 (irs1)
SSDB
Motif
Pfam: IRS PH PH_11
Other DBs
NCBI-GeneID: 112216688
NCBI-ProteinID: XP_024232437
LinkDB
Position
17
AA seq 1111 aa
MASPTTEEQGCFSDVRKVGYLRKPKSMHKRFFVLRAASAAGPSRLEYYENEKKWRHKSGL
PKRSILLESCFNINKRTDSKNKYLVALYTKDEYFSIAADSEQEQDRWHQALVDLHNKGKV
HDAAVGGSGMAEENYGEETMPGPAFKEVWQVILKPKGLGHTKNFIGIYRLCLTNKTISFV
KLNSDAAAVVLQLMNIRRCGHSENFFFIEVGRSAVTGPGEFWMQVDDSVVAQNMHETILE
AMKAMSEEFRPRSKSHSSSNCSNPISVPLRRHHHNNLPPSQVGLGRRSRTESVTATSPAG
PGKHSHSFRMRASSDGEGTMSRPASVDGSPCAARTQSHRHRGASRLHPPLNHSRSIPMPS
SCCSPSAISPVSLSSSSTSGHGSTSDCLYPCRSSASISGSPIDGGFISSDEYGSSPCDFR
SSFRSVTPDSLGHTPPAREEELNNYICMAKPATLLRGHCGCSPHPHGTPSHLDEPELEKC
FRKRTHSSSTSPLTVCHQKAPSQSSTVSLEEYTVMQPAYSSCSRASSYRHSAFMPTHSFP
EEGIDIPLEGNRVSQKDDGYMPMTPGVAPATGKSADYMPMSPKSVSVPQQINSHQHPKMD
SNGYMMMSPSGSCSPDTTNYGQIWTNGVNPKLSVESTEEKLLSHGDYMNMSPASCSMTST
PPDCYINLVEDPPKSIYAYFSLPRCFEHSHRKLDQNPLHLSLSSGHLAFRDSLASSTSSD
SLMGQGYSSQPLVKSKRADVDSRLARPTRLSLEGNKASTLPRTHECPFPTDPKSPGEYVN
IEFNDKAFSAGLATHFSPVFPGSGPEKPAEISSDYMNMHLGAQGRGIPNWEAKPLASCTD
CYAIVAPVAPSSSVIPCENLCRRDYSSTQTDYSDTHMILNAPMSTIDVIPFSVSPPSQDL
SVLGAGPSAVPLGLMGPLSELSAFTRVNSSFIWNQGAKLIRADQQGRRRHSSETFSSTGV
PVSAAAPSVEEVKRHSSASFENVWLKPGELPLSANGRRESPSGPSSNGQNQNRLNYIDLD
LAQDQNLPEWSSLPARAMDTQGGSAPEDLRAYASISFQKAGESRMNPAHREDPDSPGKLR
EGERLSGCTLFLNEDGCSPVNLDFLVIEQTS
NT seq 3336 nt   +upstreamnt  +downstreamnt
atggctagcccaactacagaggagcagggttgtttttcagatgtaagaaaggtgggttat
ttaaggaaacctaaaagcatgcacaagaggttttttgtcctgcgggctgctagtgctgca
ggaccctccaggttggagtactacgaaaatgaaaaaaaatggagacacaagtccgggctg
cctaaaaggtcaatcctactggagagctgcttcaacataaataaaaggacagattccaaa
aacaaatacctggtggctctttacaccaaggatgagtatttctctattgcagcggacagt
gagcaggaacaagacaggtggcaccaagcgctagtggacctacacaacaaaggtaaagtt
catgatgctgctgttggtggcagtgggatggcagaggagaattatggagaagaaaccatg
ccaggacctgcctttaaagaagtctggcaagttattttgaaaccaaagggcttgggacac
accaaaaattttattgggatttacagattgtgcctaacaaataaaaccatcagctttgtg
aaattgaactcggacgcagcggcggtcgtcctgcaattaatgaatatacggagatgcggt
cattcagagaatttctttttcattgaagtgggaagatccgcagtcacaggaccgggggaa
ttttggatgcaagtggacgactctgttgttgctcaaaatatgcatgaaaccatcctggag
gcgatgaaagcgatgagtgaggaatttcgtccccggagcaaaagccattcctcgtcaaac
tgctccaacccaatctctgtgcctttgagaaggcatcaccacaacaacctgccacctagc
caagtgggactgggaaggaggtcccggactgagagtgtgacggccacctcgcctgctggc
ccgggaaagcacagtcattcattcagaatgagggcctctagtgatggggaaggaaccatg
tccagacctgcctcagtggatgggagcccctgtgctgccaggacacaatctcacagacac
agaggggcctcccgcctccaccctcccctcaaccacagcaggtctatccccatgccctct
tcgtgctgctccccctcagcaatcagcccagttagcctgtcctccagcagtacgagcggg
cacggctccacttcagactgtctctacccctgccgctccagtgcctccatatctggctct
cctattgacgggggattcatttcctctgatgagtatggatccagcccctgtgacttcagg
agctccttccgcagtgtcacacctgactccttgggtcacacaccgcccgccagggaggaa
gaactcaacaactacatctgcatggcaaagcctgcaactcttctgaggggccactgtggc
tgcagcccccacccccatggtacgccatcccacctggacgagcctgagctggagaagtgc
ttcaggaaacggacacactcctcgagcacatctcccctgacagtgtgccaccagaaggcc
ccctctcagtcctccacagtatcgctggaggagtacacagtaatgcagcctgcatactcg
tcatgcagccgagcatccagctacaggcactctgccttcatgcccacacactcattccca
gaggagggcatagacatccccttagagggcaacagggtgagccaaaaagatgatggctac
atgcccatgaccccaggtgtggcacctgccacaggtaaaagtgccgactacatgcccatg
agccccaaaagtgtgtcggtgccacagcagattaactcccaccagcaccccaaaatggac
tccaatgggtacatgatgatgtcacccagcgggagctgctcaccagacaccacaaactac
ggtcaaatctggaccaatggggtcaaccctaaactgtctgtcgagagcacagaggagaaa
ttgttgtcgcatggggattacatgaacatgtcaccggcgagctgctccatgactagcaca
ccgccagactgctacatcaacctggtagaggatccacccaagtccatatacgcctacttt
tccttgcctcgctgttttgaacacagccacaggaagctggaccagaaccccctgcacctt
tcgctcagctctggacacctggccttcagggactctttagcctcctccacgagcagcgac
agtctgatgggacagggctacagtagtcagcccctggtcaagtccaagagagctgatgtg
gacagcaggctggccaggcccacgcgcctctctctggagggcaacaaagccagcaccctg
cctcgcacccatgagtgccccttccctacagatcccaaaagccccggggagtatgtcaac
atagagttcaacgacaaggccttctcagctggcttggccactcacttctcccctgtgttc
ccagggagtggcccagagaagccagcagagatttcctcagactacatgaacatgcacctg
ggtgctcagggcaggggcattcccaactgggaagccaaacccctagcctcctgcacagat
tgctatgctatagtggcacctgtggctccctcctcctctgtaatcccctgtgagaacctc
tgtagacgggactacagcagcacacagacggactactctgacacgcacatgattctgaac
gctccgatgtcgaccattgatgtcatccccttctctgtgtcccctccaagccaggacctg
tctgtgcttggtgcgggtcccagtgccgtgcccttaggactaatgggccctctctctgag
ctgagtgctttcaccagggttaactccagttttatctggaaccagggagctaaattgatc
cgtgccgaccagcagggccggcgccggcacagctcagagaccttctcctccacaggagtc
ccggtcagcgccgccgcgccctccgtggaggaagtgaaacgtcacagctccgcctctttc
gagaatgtgtggctgaagccgggagaattgccattatctgccaacgggaggagagaaagc
ccatcggggcccagctctaacggacagaaccagaacaggctgaactacatcgacctggac
ctggctcaggaccagaacctcccagagtggagttccctcccggccagagccatggacacg
caaggtgggagtgccccagaggacctgcgcgcctatgccagcattagttttcagaaagca
ggcgagtcgaggatgaaccccgctcacagagaagacccagacagcccaggaaagttgagg
gagggagagagactgtctgggtgcacactgttcctgaatgaagatgggtgctctccagtg
aatttagacttccttgtcatagaacagacatcatag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112220193
Entry
112220193         CDS       T05605                                 

Definition
(RefSeq) insulin receptor substrate 2-like
  KO
K07187  insulin receptor substrate 2
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04140  Autophagy - animal
otw04910  Insulin signaling pathway
otw04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112220193
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112220193
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112220193
   04920 Adipocytokine signaling pathway
    112220193
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:otw04990]
    112220193
Domain-containing proteins not elsewhere classified [BR:otw04990]
 Phosphotyrosine binding (PTB) domain-containing proteins
  IRS related family proteins
   112220193
SSDB
Motif
Pfam: IRS PH PH_11 Mcp5_PH
Other DBs
NCBI-GeneID: 112220193
NCBI-ProteinID: XP_024237656
LinkDB
Position
20
AA seq 1070 aa
MASPQTNGGHLLSNVTNNIKKCGYLKKQKHGHRRFFVLREPSESFPARLEYYESEKKWKN
KSAAKRVILLDSCLCINKRADSKHKHLIAFYTKDEYFAVAAENEQEQESWFRVLSDLVEE
GKVYDSPASNSTSLFCFEEANYSMITPATAFCREIWQVNLKSRGLGQTKHLTGVFRLCLS
SRTISFVKLNSEVAAVSLQLMNIRRCGHSDSFFFIEVGRSAVTGPGELWMQADDSVVAQN
IHETILEAMKAMKELSESRPRSKSQSASTNPISVPTRRNLNNLPPSQTGLVRRSRTNSIV
ATSPMSKFTSCRIRTASEGDGNMVKPVSMSISMSGSPTSPLSNRNPLSRSNTLSTGRTCR
ILESSLQHSRSMPVSNSPPSVCSSICLSPMSGTLPTPDPVHRPFSCSASISGSLSDASFM
LCNEHSSSPGDTSILLPITRSDTHDSLSSTPPSREANDLCGYMIMDRTNDQRQACQEEDL
TSEKAYRKRTYSLTTPRHQRVPAQLSSASLDEYTLMRAAHHTNSGHHSGRSSISASPNVS
YPKSNGNQVGDDGYMPMMVGVAAPPRGNNSKADAYMPMSPMCVSAPKQIINPLAQNHRYE
AGDQTNSPSSGGSLEDSGYMRMWCGSKSSVESPDSRSTYMNMSPRNAAYTTSQTPPDYFL
DQLPGRGPPITPIYSTDSLPRSIKLHQASKEAGDTGDQYVLMSPQGNQSLGRESDDDYYS
VMTNPAPPNSSVPSPIRQSRGTESLTSHRGRMGRHNRLSLDSCRILPSMNKHLLPGEPRS
PGEYINIDFSEGTKYSPPSASNESQESSLGSSGGQPRSPFSDYMNLHHVVSHSPKAGDTP
DRRLDTVPESSLCPCPDGEGVYRLRSKRDSKCPQRGKDEYTEMTFGLGMANMPPQFLPQT
STSPSAREKRLSLGEQGLPGGMGVFLLGAATPVDPDRAAKVIRADPHGRRRHSSETFSST
ATVTPVFPSFAHGDAKHHSSVENLSVRSSESSDEECGSPMSREISGGFQNGLNYIALNLM
EDRDLEGPCCEDLTTVSFKPASSCKGALHGLHVAPYVCLGFKEAVTSVKD
NT seq 3213 nt   +upstreamnt  +downstreamnt
atggcgagtcctcaaactaatggaggacacttgttgtctaatgtgaccaataacattaag
aaatgtggatatctaaagaaacagaagcatggacacagacgttttttcgtgttgagagaa
cccagcgagagctttcctgcccgcctggaatactacgagagcgagaagaagtggaaaaac
aagtcggctgctaaaagggtgatactgctggactcctgtctttgcataaacaagcgagcg
gactccaagcacaaacatctcatcgccttttacaccaaggacgaatactttgcagtggca
gccgaaaacgagcaggagcaggagagctggtttcgagtgttgtcggatttggtcgaagag
gggaaagtctatgacagccccgcgtctaattccacctctcttttctgttttgaggaggcg
aattacagtatgatcacgccggccactgccttttgcagggagatttggcaagtgaatttg
aaatccagaggactgggtcaaacaaaacatttgacaggggtgtttaggctgtgtttatcc
agtcggactatcagctttgtgaaactgaactcggaggttgcagctgtcagtttacagctc
atgaatatccggagatgtggccactccgacagctttttcttcatcgaggttggtaggtcg
gctgtcactggccctggtgagctctggatgcaggcggatgattcggtggttgcgcaaaac
atccacgagaccatcctggaggcgatgaaagccatgaaagagctgtcagaatcaagacca
cgcagcaagagtcagtcggctagcaccaaccccatttccgtgcccacaagacgcaacttg
aacaatctgcctccaagtcagacagggttggtgaggaggtcgagaacaaacagcatagtg
gccacatccccaatgagcaagttcacatcctgtcggataaggacagctagtgagggggat
ggcaacatggtcaagccagtgtctatgtcaatatctatgagcgggagccccaccagtccc
ctctccaaccggaaccctctgagcaggtccaatacgctctccactgggcgcacctgccgg
atactggagtccagcctccagcacagccgctccatgcccgtctccaactcccctccctca
gtctgcagttccatctgcctctcccccatgagcgggaccctccccacccctgatccggtc
caccgccccttcagctgcagcgcctctatctcaggctccctcagcgacgcaagcttcatg
ctatgcaatgagcacagctccagcccaggcgacacctccattctcctacccatcactagg
agtgacacccacgactccctctccagcactcctccctcccgggaggccaacgatctgtgt
ggctacatgattatggacaggaccaatgaccaacggcaggcgtgccaggaggaggacttg
acatcggagaaggcgtacaggaagagaacatactccctcaccacaccacgccatcagcgg
gtgcctgcccagctgtcctctgcctcgttggatgagtacaccctaatgcgggctgcccac
cacaccaacagcgggcaccactccgggcgcagctccatctccgcctccccaaatgtgtcc
taccccaaatccaatggtaatcaagtaggggatgatggctatatgcctatgatggtgggc
gtggcagcaccgcccaggggcaacaacagcaaggcagatgcttacatgcccatgagcccc
atgtgtgtttcggctcccaagcagatcattaaccccttggcccaaaaccaccggtacgag
gctggcgaccagaccaactcacccagcagcggaggctccttggaggacagtggttacatg
aggatgtggtgcggctccaagtcgtccgttgaaagcccagacagccgctcgacctacatg
aacatgtcccctcgcaacgccgcttacaccacctcgcagacccccccggactacttccta
gaccagcttccgggtcgtgggcctcccatcacacccatctactccacagactccctgcca
cgctccatcaaactccaccaggcttccaaggaggcgggggacactggtgaccagtacgtc
ctgatgagcccgcaaggcaatcagtcgctaggtagggagtcagacgacgactactactca
gtgatgaccaatccggccccgcccaactcctcggtgccctcgcccatcagacagagccgg
gggactgagagcctgacatcccaccgggggagaatggggcgacacaaccggctatctctg
gacagctgtaggatcctacccagcatgaacaagcacctcttgcccggggaacccaggagc
ccgggcgagtatatcaacatagacttcagtgagggcaccaagtactccccgccgtcagca
tccaatgagagccaggagtcgtctctgggctccagcggcggccagccgaggtcccctttc
tccgactacatgaacctgcaccacgtcgtctcacactcacccaaggccggagacacccct
gatcgacggttggacacggtccctgagtcatccctgtgcccttgtccggatggggaggga
gtgtaccgtctcagatcgaagagggattccaagtgcccccagagaggcaaggatgagtac
acagagatgacatttggacttggaatggccaacatgcctccccagttcctccctcagacc
tcaacaagccccagtgccagagagaagaggctatccctgggtgagcagggcctcccgggg
ggcatgggggtgttcctccttggtgcggccacccccgtggatcctgacagggccgccaag
gtgatccgggccgacccccatggccgcaggcggcacagctctgaaaccttctcctctacg
gctaccgtcacccccgtgttcccctcgttcgcccatggggatgccaaacaccacagctcg
gtggagaacctgtcggtgcggagcagcgagagctcagacgaggagtgtggcagccccatg
agtagagagatctctgggggcttccagaatggactgaactatattgccctgaacctgatg
gaggacagggacctggagggaccttgttgcgaagacctgaccacggtcagctttaagccg
gccagcagctgcaagggagccctccatggattacatgtcgcgccgtacgtctgtttgggg
ttcaaggaggcggtcacctctgttaaagactga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112225416
Entry
112225416         CDS       T05605                                 

Definition
(RefSeq) insulin receptor substrate 2-like
  KO
K07187  insulin receptor substrate 2
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04140  Autophagy - animal
otw04910  Insulin signaling pathway
otw04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112225416
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112225416
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112225416
   04920 Adipocytokine signaling pathway
    112225416
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:otw04990]
    112225416
Domain-containing proteins not elsewhere classified [BR:otw04990]
 Phosphotyrosine binding (PTB) domain-containing proteins
  IRS related family proteins
   112225416
SSDB
Motif
Pfam: IRS PH PH_11 PH_8 Mcp5_PH
Other DBs
NCBI-GeneID: 112225416
NCBI-ProteinID: XP_024245145
LinkDB
Position
26
AA seq 1113 aa
MANPPNTGGHLLSNANINNNKIKKCGYLKKQKHGHKRFFVLKEPSEGFPARLEYYESEKK
WKNKSAAKRVIPLDCCLNINKRADSKHKHLIALYTKDEYFAVAAENEQEQENWYRVLTDL
MSEGKVYSDGSASNSASSLVGFDEGNYGMITPVTAVYKEVWQVNLKSKGLGQSRNLTGVY
RLCLSSRTISFVKLNSDVASVSLQLMNIRRCGHSESFFFIEVGRSAATGPGELWMQADDS
VVAQNIHETILEAMKAMKELSEFRPRSKSQSSGTNPISVPTRRHHNNLPPSQTGLQRRSR
TDSMAKKSPMSKFTSCRIRTASEGDGTMARTLPVNGSPLSPDIHRTLLGSSNTITAQHCR
TFESSSLQHSKSMSMPLSHSPPTATPSPVSLSSCSESSAPRPSSCNASVSGSPSDGGFIS
CDEYGSSPAALYLTRSSNTPESLRADTPPSRDSSDLHGYMVMERQNQNGFRRLPELDKAY
RKRTYSLTTPPQHRAPPQVSSTSLDEYTLMRATYTSSGQSGRSSHTASPKVTYPEDYGDV
QIGSNGHLGDCGYMPMTPGIAAQTGWVKGDAYMPMSPMCVSAPKQIINPRSHPSPAGLCS
HTDSPGSVSLEDSGYMRMFCGAKMSVDSSDGKLTNGEYLNMSPVDPVVSLTPPDYILTDT
TPQLHPHHRQPYFISSLPRSLKAQPQRKGVTDTDQYVVMSLQKKRIEEESNYCPISPVCS
ATPPTSTLSSAPSPLRAGTVTQEGGLVHKGRVSRPTRLALDSLRTLPCMIEHPLPSEPKS
PGEYINIDFGNTTRYPPISAMTERSRSSLGSVDGLMKSSPPLSDYVNIDVRSHSPKHGDS
PSSIGCLEPSPALPLCPSQPPSAEQRESEEQEKIIVVEYPLQKLASPVYLVGDVKDDYTE
MTFSPTNPPPSAPLPATLCPSDATTPLPTSPSACVQRLTLRGEGTVGSPPVPVETFFLGC
PSLSISPVNPDRGAKVIRADPQGRRRHSSETFSSTTMVTPVCPSFAPDANKRHSSASVEN
VSRPVRSSEGSDEEYGNSNSPMCRETSAGYQNGLNYIALNLMEGSLGGCSTLGGSEGLLR
FKAACGCKGGMNGFNTSPYATMGFKETATAVKD
NT seq 3342 nt   +upstreamnt  +downstreamnt
atggcaaatccaccaaatactggaggacacttgttatccaacgcgaatattaacaacaac
aaaattaagaaatgtggatacctcaagaagcagaagcacggacacaagcgatttttcgtt
ctgaaggagccgagcgagggcttccctgcccggctggagtactacgagagcgagaagaaa
tggaaaaacaagtcggcagcaaagagagttattccgctggactgctgcctcaatatcaac
aagagagcggactccaaacacaaacaccttatcgccctctacaccaaggacgaatatttt
gctgtggcagcagagaatgaacaggagcaggagaattggtacagagtcttaactgattta
atgagcgaggggaaagtgtactcagacggctccgcatccaattccgcgtcctcgctggtg
gggtttgatgaggggaactacgggatgattacgccggtaacggctgtgtataaggaggta
tggcaagttaacctaaaatccaaagggctgggacagagccggaatcttaccggggtgtac
aggctgtgcttatccagccggactatcagctttgtgaagctcaactcggatgttgcgtcc
gtcagtttacagctgatgaacattaggagatgcgggcactcggagagctttttcttcatc
gaagtcggccggtcagcagccacaggacccggcgagctgtggatgcaggctgacgactcc
gttgtggcgcaaaacatccacgagactattctggaggcgatgaaagccatgaaggagctg
tcagagttccggccgcgcagcaagagccagtcatcgggcactaaccccatttccgtgccc
acccggcggcaccacaacaaccttcccccaagccagaccgggctccagcgacggtcgcgc
actgacagcatggccaaaaagtcccccatgagtaaattcacctcctgtcggatacgcact
gccagtgagggagatggcaccatggcgcgcaccttgcctgtgaacgggagtcccctcagc
cctgatattcaccggaccctattaggaagctcaaacaccatcacagcccagcactgccgg
acatttgaatcctcttccctccagcacagtaagtccatgtccatgcctctgtcccactcc
ccacccacagccactcccagccctgtcagcctgtcctcttgctctgaaagcagtgctcct
cgcccctccagctgcaatgcatctgtctctggctcccccagtgatggcggcttcatctcc
tgtgatgagtatggctccagtcctgcagccctgtacctcactcgcagcagtaacactcca
gagtccctaagggcagacacacccccctcccgggatagcagcgacttgcatggctacatg
gtgatggagaggcagaaccagaacggtttccgccggttaccagagctggacaaggcatac
cggaaacgcacatactcccttaccaccccgccccagcacagggcgccgccccaggtctcc
tccacctcattggacgagtacacgcttatgagggccacctataccagtagcggccaatcg
ggtcgcagctctcacaccgcctccccgaaagttacatatcctgaggactatggcgatgtc
cagataggctccaatggtcacctaggtgactgtggctacatgcccatgactccgggcatt
gccgctcagacagggtgggtcaaaggtgatgcttatatgcccatgagccccatgtgtgtg
tcggcccccaagcagatcatcaacccccgctctcacccctctccagctgggctctgctcc
cataccgactcccctggaagcgtgtctctggaggacagcggctacatgagaatgttctgc
ggggccaagatgtctgtggacagctccgacgggaagctcaccaacggggagtacctcaac
atgtcccctgtggaccccgtggtctccctcacacccccagactacatccttacagacact
accccccagcttcaccctcaccacagacagccttacttcatcagttccctgccccgctct
ctcaaagcccagccccagaggaagggggttacagacacagaccagtacgtggtgatgagt
ctacagaagaagaggatagaggaagagtccaactactgtcccatctcacctgtctgctcc
gctacaccccccacctccactctctcctcagccccctcacccctcagagccggcacggtc
actcaggaggggggtctggtccacaaggggagggtgagccggcctacccggctggccctg
gactctctaaggacgctgccctgtatgatcgaacaccccctcccctctgagcccaagagt
cccggggagtacatcaacattgactttggcaacactacacgctacccgcccatctccgcc
atgactgagcgctctcgttcatcactgggctcggtggacgggctgatgaagagttccccg
ccactctccgattacgtcaacattgacgtcagatcgcactctcccaaacacggcgattcc
ccttcttcaatagggtgcctggagccgagtcctgcgcttcccttgtgtcccagccagcct
cccagcgcagagcagagggagagtgaggagcaggagaagataatcgttgtggaatatcct
ctccaaaagcttgcaagccctgtatacctggttggtgatgtaaaagacgactacactgag
atgaccttcagtccaaccaacccacctccctctgcccctctccctgccaccctgtgcccc
tctgatgccaccacccccctgcccaccagcccgtctgcctgtgtccagagactcaccctg
aggggagagggtacagtggggtcccccccggttcctgtcgagaccttcttccttgggtgt
ccgtctctctccatctcccctgtcaacccagacaggggggcaaaggtgatccgggccgac
ccccaggggcgcaggcgccacagctcagagaccttctcctccaccaccatggtaacgcca
gtgtgcccatccttcgctcccgatgccaacaagcggcacagctcggcatcggtggagaac
gtgtcgcggccggtccggagctcggagggttcagatgaagagtacgggaacagcaacagc
cccatgtgccgggagacgtcggcgggctaccagaatggacttaactacattgccttaaac
ctgatggaagggagcctggggggttgcagcactctggggggcagtgagggactgctgagg
ttcaaggcagcgtgtggatgcaaggggggcatgaacggttttaacaccagcccctatgcc
accatgggcttcaaggaaactgcaacagcagtgaaagactga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112229124
Entry
112229124         CDS       T05605                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: insulin receptor substrate 1-B-like
  KO
K16172  insulin receptor substrate 1
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04140  Autophagy - animal
otw04150  mTOR signaling pathway
otw04910  Insulin signaling pathway
otw04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112229124
   04150 mTOR signaling pathway
    112229124
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112229124
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112229124
   04920 Adipocytokine signaling pathway
    112229124
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:otw04990]
    112229124
Domain-containing proteins not elsewhere classified [BR:otw04990]
 Phosphotyrosine binding (PTB) domain-containing proteins
  IRS related family proteins
   112229124
SSDB
Motif
Pfam: IRS PH PH_11 PH_8
Other DBs
NCBI-GeneID: 112229124
NCBI-ProteinID: XP_024250775
LinkDB
Position
30
AA seq 1220 aa
MENHAAELLQQQQSYEDVRKSGYLRKQKSMHRRFFVLREASEEGPARLEYYENEKKFRSK
SPVPKKALNLETCFNINKRADSKNKHMIVMYTRGESFAIAADSEDVQNEWYQAMLDLQWK
CKNPEDCGSGGECGLPSPPGPTFKEVWQVKVWPKGLGQARNLVGIHRLCLTDKTVNFVKL
NSDVAAVVLQLMNVRRCGHSENFFFIEVGRSAMTGPGEFWMQVEDSVVAQNMHETLLEAM
KALSEEFRQRSKSQSVGATSGGGTASNPISVPNRRHHPNLPPSQVGFGRRARTETPGAGG
ANCTSTSPTPRHGLPRARTASIGGRTEEGGGGTRGAWASSSPSLNGSCSTTPTLRPKPTR
APTPAKITLSLARYTPNPATSPAPSLSSSSGHGSECGLVGGAMGXVAXXSYTRVPHRVSV
SGSPSDXGSSDEYGSSPGEHSLLVPSLPGGSXGGMGHXAHGEXSSSYIVMGQRESLPGSH
QRPQGRRMLRRSSSRECEAERRLLSKRASLPLTAHECLAPRRKEEEEDTDQEYAVMSRSV
SRDAIVSRRRGSGGFTAGGLEAGAVVGETQVRVDVVRGEAGGGGGGPVDSGYMSMLPGVT
APPFSLSLSVAVSDISAKPGADDEYMAMTPNSSVSPPQHISLPVSEGYMVMSPNSSCSPD
MHGMAIWGSRGSMESRAGSDYMNMSPISIRSACSTPPSQPEQNPLQHKMVYSYFSLPRSY
KHTLSTRFEDDLDQGKSKEGGHSDQDSAGNRGGQVGYSKRDTATVGPAGGCQLSLSSSSF
SSSSASSESLEDRPMSVAAGGGLRLTRTGPGFRNGGARSKDGSYQQKRVSHGPGGQQRKP
RPLSVSVDMSKANTLPRVKENLFPTEPQSPGEYVSIVFRGGDVGGRRGGQWGPEHGLSVT
HGTQRPRHRPALCHSGSTNLPRSFSAPLATSAALAASTEYVNMDLGLGNSPCPSTGTPVK
SPFCPPPAIAPKPPVVARNRPSPRAAEGNVGGHRAAVPTDLPTSYTNYTEMAFSIVSEPN
PAAPAMHAAQASSMEQESGLDFPSARSYSSPDQNQSSRLARDRVGRGDQLGRRRHRSETF
IITPPPLPLQLSSSGSLFLDSAQAAAPHRQGGLERGSPWENAQSDAVASQASSSGSAKQG
LNYIDLDLTFNKDSSQNELEGGATSPHNIFAPVHNGAGGGVMMGDITGLGNNPGYASIDF
FKSEELRALHQSSRKDGKEC
NT seq 3663 nt   +upstreamnt  +downstreamnt
atggagaaccatgcagcagagctgctacaacagcagcagagctacgaggacgttcggaaa
agcgggtatctccgtaagcagaaatctatgcaccggcgatttttcgttttgagggaagcc
tcggaagagggccctgcccgtctagaatattatgagaacgagaagaaattccgaagcaag
tcacctgtcccaaaaaaagcgctgaatctggagacttgcttcaacatcaacaagcgggcg
gattccaagaacaagcacatgatagtgatgtatacccgcggggagagctttgccattgca
gcagacagtgaggatgtccagaatgaatggtaccaggccatgctggaccttcagtggaaa
tgtaaaaacccagaggactgtggtagtggtggagagtgtggactcccctctcctccaggc
cccaccttcaaggaggtgtggcaggtcaaggtgtggcctaaagggcttggccaggcccga
aacctagtgggcatccaccgtctgtgcctgaccgacaagacggtcaactttgtcaagctc
aactctgacgtggccgccgtggtcctacaactgatgaacgtgcgtcgctgcggccactca
gagaacttcttcttcatcgaggtgggccgctcggccatgacggggcctggggagttctgg
atgcaggtggaggactcggtggtggcccagaacatgcatgagactctgctggaggccatg
aaggcactgagtgaggagttccgccagcgcagtaagtctcagtctgtgggtgctacaagc
ggcgggggcaccgcctccaaccccatcagtgtccccaaccgccgccaccaccccaatctg
ccccccagccaggtgggctttggcagacgagcccggactgagacccctggagcaggtggg
gccaactgcaccagcacttcaccaacgccacgccacgggttacccagggcacgcacagcc
agcatcgggggaaggacagaggagggtggaggtggaaccagaggggcatgggcaagctcc
agtcccagcctgaacggatcttgttccactacacccaccctgagacctaagcccaccaga
gctccaaccccagctaagatcactctcagcctggcccgctacacccccaacccagccacc
tccccagccccaagcctctcctccagctctggtcatggctcagagtgtggactagtrgga
ggggcaatgggaaytgtagcsatrtgrtcttacacccgrgtccctcayagagtktctgtg
tcgggrtcccctagtgactarggctcctcagacgagtatggctccagccctggagagcac
tccctyctwgtccccagtctyccwggagggtcckatggmggyatgggacackatgctcat
ggagagygctcttccagctacatagtgatgggccagagagagagcctccctgggtcccat
cagcgtcctcagggccgcaggatgctgcggcgctcctccagcagggagtgtgaggcagag
cgcagactcctcagcaagagggcctccctgcccctgactgcccacgaatgcctggcccct
cgtaggaaggaggaagaggaggatacggaccaagagtacgccgtcatgtcacggagtgtt
agcagggacgccattgtgtcacggcggcgcggatcaggaggcttcacagcagggggcttg
gaagcaggggccgtcgttggggagacccaggtgagggttgatgtggtccgaggagaggcg
ggaggaggaggagggggaccagtggacagtggctacatgtccatgttacctggagtgacg
gctcctcctttttccctctcgctgtctgtggccgtgtctgacatcagcgccaagcctggg
gctgatgatgagtacatggccatgacccccaacagcagcgtgtcccccccccaacacatc
agtctgcctgtctccgagggctacatggtcatgtcccccaacagcagctgctccccagac
atgcatggaatggccatatgggggagccggggcagcatggagagccgggctggcagtgac
tacatgaacatgtctcctatcagcatccgctcggcttgcagcacacccccctcgcaacct
gaacagaacccgctacaacacaagatggtctactcctacttctctctgccacgatcctac
aaacacacgctctccacacgctttgaggatgacttggatcaagggaaaagcaaggagggg
ggtcatagtgaccaagacagtgctggaaatcggggtggacaagtgggctacagcaagagg
gacacagccacagttggccctgcaggaggctgtcaactctccctctcctcttcctccttc
tcttccagctcagctagcagtgagagcctggaggatcgacccatgtcagtggcagctggg
ggagggctacgactaacaagaacagggccagggttcaggaacgggggagcacgctctaag
gatggatcctatcagcagaaacgtgtatcgcatggcccagggggccagcagaggaagcct
cgtcccctcagtgtgtctgtggacatgtctaaagctaacaccttgcccagggttaaggag
aacctcttccccacagagcctcagagccctggggagtatgtcagcatagtgttcaggggt
ggtgacgtggggggtaggagagggggccagtgggggccagagcacggactgtcagtgacc
catggaacccagaggccccggcaccgtccagccctttgccacagtggctccaccaacctc
ccccgcagcttctctgcaccgctggccacctccgctgccttggctgcctctactgagtac
gtcaacatggatttggggttgggaaactccccttgcccctccactgggacccctgttaaa
tcacctttttgcccgcccccagctattgcccccaagcccccagttgtggcccgtaatagg
ccctctcctagggcagcagagggcaatgtaggtgggcatagggctgcagtgccaacagac
ttacccacttcatatacaaactatacagagatggccttcagcatagtttcagaacctaac
cctgcagcgcccgccatgcatgctgcccaagcttcatcaatggagcaggaatcaggcttg
gacttcccctcagcaaggtcctactcatctcctgaccagaaccagagcagcaggctggcc
agagacagggttggcaggggcgaccaactgggacggagacgccaccgctctgagacattc
atcattactcctccccctcttcccctccagctgtcctcctcaggctccttgttcttggat
agtgcccaagcagcagcacctcatcgacaaggaggactagagaggggttcaccatgggag
aatgcccagtcagatgcagtcgcatcccaggcttcgtcctctgggtctgctaaacaaggc
cttaactacattgatctggacctgacctttaataaggacagctctcagaatgaactggag
gggggagccacttccccccataacatcttcgctccagtccacaatggggctggtggggga
gtcatgatgggagacattactggtttggggaacaaccctggctacgccagtattgatttc
ttcaaatcagaggagctgagggcacttcaccagagcagcaggaaagatggaaaagaatgt
taa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112230587
Entry
112230587         CDS       T05605                                 

Definition
(RefSeq) insulin receptor substrate 2-B-like
  KO
K07187  insulin receptor substrate 2
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04140  Autophagy - animal
otw04910  Insulin signaling pathway
otw04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112230587
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112230587
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112230587
   04920 Adipocytokine signaling pathway
    112230587
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:otw04990]
    112230587
Domain-containing proteins not elsewhere classified [BR:otw04990]
 Phosphotyrosine binding (PTB) domain-containing proteins
  IRS related family proteins
   112230587
SSDB
Motif
Pfam: IRS PH PH_11
Other DBs
NCBI-GeneID: 112230587
NCBI-ProteinID: XP_024252625
LinkDB
Position
33
AA seq 910 aa
MAKTPESSGMDLGDVSHSCNSRALKVTTSTTTTSSSPPPSSSLSNSAHLQLEAASPPPLQ
VLQLKRHHKQYYSHGHDLLPKKNPLDNTVRDLSSSCVYEVPDSGGVSQDPTASASAMALA
VTTTVCSGVEARDVWKSGYLRKMKHSHKRFFVLRGPSDTGPSRLEYYDSEKKFRNGMKSV
CKSPSAVGSPKKVIYLYQCFTVSKRVDSKHKHLIALYTKDEHFVMIAENEKEQEDWYLAL
SDLVIQEKKEYQDAEELDDGYWTVSPGAIFKEVWQVIVKPKGLGQTKNLIGVCRLCLSAK
TIHLVKMCSEMTSVNLPLMNVRRCGHSESFFFMEVGRSSSTGPGEIWMQVESGDPVVAQN
MHETILEAMRALRAIPDFRPRSKSQSFPSNPCAVVTTRRQHHGNLPPSLTGLQRSIRVET
VVSKASPQKDKGDGGHSPNRTSSHGEGTMNQLISPGTGNLALRNVCISKSLEESLSHCAC
ISTTISVSSSSGNDSDTHPWTSDTSVFGSTSDRGSDTHPWTSDTSVFGSSSDRGSVCAED
LCSNPCVFQLSRSNTPDSLFNTTLIDENSLTDYVAMDLQVTAVAGANQGDSCDVETSKPE
HSRQYHQTTSCTPKCEKHLSSKPPFLHIYNQSKLPVGESYMPMTCGPGPHYTDDIPSDYN
VTPTLLQTSSATMLPSDQLGPQGYMMMLPRSCSPAKDSLSDVDHLVCDEYMNMSLGSHMD
GHTHGSPEALKSYSSYSSLPSSNQPPSQWNCEHDDCIFTCHPAAHHCSAVEWNSRNPLCS
SPRHSSHPSSDVLLNLSDVPVLNVTGLSLDQHGVEDSDLPTQTESIQISTDRLNYIALYL
RDDQCATCDVPLPTDEVTSPLPARTSPRESGSGPGHYTGIDLPTSAGQTAATRRWLCSCL
PLCINTDDSE
NT seq 2733 nt   +upstreamnt  +downstreamnt
atggcgaaaacaccagagagcagcggtatggatttaggagatgtttcccatagctgcaat
tcacgagctctgaaagttacaacatcaacaacaacaacatcatcatcaccaccaccatca
tcttccctcagcaacagtgctcaccttcagctagaggcagcatcaccaccgcccctccaa
gttctccagttgaagaggcatcataagcagtactatagccatggccatgatctgttacct
aagaagaaccctctagataatacagtgagagatttgtcatcatcctgtgtctatgaggta
cctgactctggtggtgtttcccaggacccgactgcctctgcatctgccatggccttagct
gtcactaccacagtttgctctggtgttgaggctagagatgtatggaagtctggatacctg
agaaagatgaagcacagccacaagagattttttgtcttgagagggccaagtgacacaggc
cccagccgtttggagtactatgatagtgagaagaaatttagaaatggaatgaaatccgtt
tgtaaatctcccagtgctgtgggttctccaaagaaggtgatttatctgtatcaatgtttt
actgttagtaaaagggtagattctaaacacaagcacctgatagccctgtacactaaggat
gagcactttgtcatgatagcggagaatgagaaggagcaagaggattggtacctggctctg
agtgatctggtgatccaggagaaaaaggagtaccaggacgctgaggagttggatgatgga
tactggaccgtctctcctggagccatcttcaaggaggtgtggcaggtgattgtaaagccc
aaaggtttaggacaaaccaagaacctgataggagtgtgccggctgtgtctctctgccaag
accattcacctggtgaagatgtgctctgagatgacgtctgtgaacctacctctgatgaat
gtgcgtcgctgtggtcactccgagagcttcttctttatggaggtgggccgctcgtcctcc
actgggcccggggagatctggatgcaggtagaatcaggcgaccctgtggtggctcagaac
atgcatgagacaatcctggaggccatgagagccctgagggccatccctgatttcaggccc
cggagcaagagtcagtcattcccatcaaacccctgtgccgtagtcaccacacgacgtcaa
caccatggcaacctcccacccagcctgactgggttacagcgctctataagggtggaaact
gttgtgagcaaagcgtccccacagaaagataaaggagatggaggccacagccccaatcga
acttctagccatggagaggggacaatgaaccaactgatcagcccagggactggcaacttg
gctctccgtaatgtctgcatcagtaaaagccttgaagagagcctcagtcactgtgcatgc
atctccaccaccatcagtgtatccagcagcagtggcaatgactctgatacacacccctgg
acctctgacacttcagtctttggttctaccagcgacagaggctctgatacacacccctgg
acctctgacacttcagtctttggttcttccagcgacagaggctctgtctgcgctgaggat
ttgtgctccaacccatgtgtctttcagttgtccaggagtaacacccctgactcactgttt
aacaccacactcattgacgagaacagcttgactgactacgtggccatggatttgcaggta
acggctgtggccggggctaatcaaggagatagctgtgatgtggaaacgtctaagcctgaa
cattccagacaataccaccaaaccacctcatgcactccaaaatgcgaaaaacacctctca
tccaagccccccttcctccatatctataatcagagtaaactcccagtgggagaaagttat
atgccaatgacttgtggaccaggtcctcattatacagatgacatcccttcagattacaat
gtgacccccactcttcttcaaacatctagtgctaccatgttgccctcagaccagctgggt
ccccagggctacatgatgatgcttccacgtagctgttcaccagcaaaggacagccttagt
gatgttgatcatttagtgtgtgatgaatacatgaacatgtctctcgggagccacatggat
ggtcatacacatggctcaccggaggctcttaagtcctacagctcctattcctctctacca
agctctaaccagcctccttcacagtggaactgtgaacatgatgactgtatcttcacgtgt
catcctgcagctcatcactgctctgcagttgaatggaacagtagaaaccctctctgtagc
tcacctcgtcactcttctcatccaagcagtgatgtgctgctgaacctatcagatgtgcct
gtgttgaatgtcactggtttgtccttggaccagcatggggttgaagatagtgacctgccc
actcaaactgagtctatccagatttcaacagatcgtctcaactacattgctctttacctg
agggatgatcagtgtgccacctgtgatgtccctttgcctaccgatgaggtcacttctcca
cttcctgcacgtaccagtcccagagagagtgggtctggacctggccactacactggcata
gacctccccacatcagcaggacagactgctgccaccagacgttggctgtgttcttgtctc
cccttgtgtatcaatactgatgacagtgagtaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112232322
Entry
112232322         CDS       T05605                                 

Definition
(RefSeq) insulin receptor substrate 2-like
  KO
K07187  insulin receptor substrate 2
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04140  Autophagy - animal
otw04910  Insulin signaling pathway
otw04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112232322
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112232322
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112232322
   04920 Adipocytokine signaling pathway
    112232322
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:otw04990]
    112232322
Domain-containing proteins not elsewhere classified [BR:otw04990]
 Phosphotyrosine binding (PTB) domain-containing proteins
  IRS related family proteins
   112232322
SSDB
Motif
Pfam: IRS PH PH_11 Mcp5_PH
Other DBs
NCBI-GeneID: 112232322
NCBI-ProteinID: XP_024255055
LinkDB
Position
Unknown
AA seq 1070 aa
MASPQTNGGHLLSNVTNNIKKCGYLKKQKHGHRRFFVLREPSESFPARLEYYESEKKWKN
KSAAKRVILLDSCLCINKRADSKHKHLIAFYTKDEYFAVAAENEQEQESWFRVLSDLVEE
GKVYDSPASNSTSLFCFEEANYSMITPATAFCREIWQVNLKSRGLGQTKHLTGVFRLCLS
SRTISFVKLNSEVAAVSLQLMNIRRCGHSDSFFFIEVGRSAVTGPGELWMQADDSVVAQN
IHETILEAMKAMKELSESRPRSKSQSASTNPISVPTRRNLNNLPPSQTGLVRRSRTNSIV
ATSPMSKFTSCRIRTASEGDGNMVKPVSMSISMSGSPTSPLSNRNPLSRSNTLSTGRTCR
ILESSLQHSRSMPVSNSPPSVCSSICLSPMSGTLPTPDPVHRPFSCSASISGSLSDASFM
LCNEHSSSPGDTSILLPITRSDTHDSLSSTPPSREANDLCGYMIMDRTNDQRQACQEEDL
TSEKAYRKRTYSLTTPRHQRVPAQLSSASLDEYTLMRAAHHTNSGHHSGRSSISASPNVS
YPKSNGNQVGDDGYMPMMVGVAAPPRGNNSKADAYMPMSPMCVSAPKQIINPLAQNHRYE
AGDQTNSPSSGGSLEDSGYMRMWCGSKSSVESPDSRSTYMNMSPRNAAYTTSQTPPDYFL
DQLPGRGPPITPIYSTDSLPRSIKLHQASKEAGDTGDQYVLMSPQGNQSLGRESDDDYYS
VMTNPAPPNSSVPSPIRQSRGTESLTSHRGRMGRHNRLSLDSCRILPSMNKHLLPGEPRS
PGEYINIDFSEGTKYSPPSASNESQESSLGSSGGQPRSPFSDYMNLHHVVSHSPKAGDTP
DRRLDTVPESSLCPCPDGEGVYRLRSKRDSKCPQRGKDEYTEMTFGLGMANMPPQFLPQT
STSPSAREKRLSLGEQGLPGGMGVFLLGAATPVDPDRAAKVIRADPHGRRRHSSETFSST
ATVTPVFPSFAHGDAKHHSSVENLSVRSSESSDEECGSPMSREISGGFQNGLNYIALNLM
EDRDLEGPCCEDLTTVSFKPASSCKGALHGLHVAPYVCLGFKEAVTSVKD
NT seq 3213 nt   +upstreamnt  +downstreamnt
atggcgagtcctcaaactaatggaggacacttgttgtctaatgtgaccaataacattaag
aaatgtggatatctaaagaaacagaagcatggacacagacgttttttcgtgttgagagaa
cccagcgagagctttcctgcccgcctggaatactacgagagcgagaagaagtggaaaaac
aagtcggctgctaaaagggtgatactgctggactcctgtctttgcataaacaagcgagcg
gactccaagcacaaacatctcatcgccttttacaccaaggacgaatactttgcagtggca
gccgaaaacgagcaggagcaggagagctggtttcgagtgttgtcggatttggtcgaagag
gggaaagtctatgacagccccgcgtctaattccacctctcttttctgttttgaggaggcg
aattacagtatgatcacgccggccactgccttttgcagggagatttggcaagtgaatttg
aaatccagaggactgggtcaaacaaaacatttgacaggggtgtttaggctgtgtttatcc
agtcggactatcagctttgtgaaactgaactcggaggttgcagctgtcagtttacagctc
atgaatatccggagatgtggccactccgacagctttttcttcatcgaggttggtaggtcg
gctgtcactggccctggtgagctctggatgcaggcggatgattcggtggttgcgcaaaac
atccacgagaccatcctggaggcgatgaaagccatgaaagagctgtcagaatcaagacca
cgcagcaagagtcagtcggctagcaccaaccccatttccgtgcccacaagacgcaacttg
aacaatctgcctccaagtcagacagggttggtgaggaggtcgagaacaaacagcatagtg
gccacatccccaatgagcaagttcacatcctgtcggataaggacagctagtgagggggat
ggcaacatggtcaagccagtgtctatgtcaatatctatgagcgggagccccaccagtccc
ctctccaaccggaaccctctgagcaggtccaatacgctctccactgggcgcacctgccgg
atactggagtccagcctccagcacagccgctccatgcccgtctccaactcccctccctca
gtctgcagttccatctgcctctcccccatgagcgggaccctccccacccctgatccggtc
caccgccccttcagctgcagcgcctctatctcaggctccctcagcgacgcaagcttcatg
ctatgcaatgagcacagctccagcccaggcgacacctccattctcctacccatcactagg
agtgacacccacgactccctctccagcactcctccctcccgggaggccaacgatctgtgt
ggctacatgattatggacaggaccaatgaccaacggcaggcgtgccaggaggaggacttg
acatcggagaaggcgtacaggaagagaacatactccctcaccacaccacgccatcagcgg
gtgcctgcccagctgtcctctgcctcgttggatgagtacaccctaatgcgggctgcccac
cacaccaacagcgggcaccactccgggcgcagctccatctccgcctccccaaatgtgtcc
taccccaaatccaatggtaatcaagtaggggatgatggctatatgcctatgatggtgggc
gtggcagcaccgcccaggggcaacaacagcaaggcagatgcttacatgcccatgagcccc
atgtgtgtttcggctcccaagcagatcattaaccccttggcccaaaaccaccggtacgag
gctggcgaccagaccaactcacccagcagcggaggctccttggaggacagtggttacatg
aggatgtggtgcggctccaagtcgtccgttgaaagcccagacagccgctcgacctacatg
aacatgtcccctcgcaacgccgcttacaccacctcgcagacccccccggactacttccta
gaccagcttccgggtcgtgggcctcccatcacacccatctactccacagactccctgcca
cgctccatcaaactccaccaggcttccaaggaggcgggggacactggtgaccagtacgtc
ctgatgagcccgcaaggcaatcagtcgctaggtagggagtcagacgacgactactactca
gtgatgaccaatccggccccgcccaactcctcggtgccctcgcccatcagacagagccgg
gggactgagagcctgacatcccaccgggggagaatggggcgacacaaccggctatctctg
gacagctgtaggatcctacccagcatgaacaagcacctcttgcccggggaacccaggagc
ccgggcgagtatatcaacatagacttcagtgagggcaccaagtactccccgccgtcagca
tccaatgagagccaggagtcgtctctgggctccagcggcggccagccgaggtcccctttc
tccgactacatgaacctgcaccacgtcgtctcacactcacccaaggccggagacacccct
gatcgacggttggacacggtccctgagtcatccctgtgcccttgtccggatggggaggga
gtgtaccgtctcagatcgaagagggattccaagtgcccccagagaggcaaggatgagtac
acagagatgacatttggacttggaatggccaacatgcctccccagttcctccctcagacc
tcaacaagccccagtgccagagagaagaggctatccctgggtgagcagggcctcccgggg
ggcatgggggtgttcctccttggtgcggccacccccgtggatcctgacagggccgccaag
gtgatccgggccgacccccatggccgcaggcggcacagctctgaaaccttctcctctacg
gctaccgtcacccccgtgttcccctcgttcgcccatggggatgccaaacaccacagctcg
gtggagaacctgtcggtgcggagcagcgagagctcagacgaggagtgtggcagccccatg
agtagagagatctctgggggcttccagaatggactgaactatattgccctgaacctgatg
gaggacagggacctggagggaccttgttgcgaagacctgaccacggtcagctttaagccg
gccagcagctgcaagggagccctccatggattacatgtcgcgccgtacgtctgtttgggg
ttcaaggaggcggtcacctctgttaaagactga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112232492
Entry
112232492         CDS       T05605                                 

Definition
(RefSeq) insulin receptor substrate 2-like
  KO
K07187  insulin receptor substrate 2
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04140  Autophagy - animal
otw04910  Insulin signaling pathway
otw04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112232492
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112232492
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112232492
   04920 Adipocytokine signaling pathway
    112232492
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:otw04990]
    112232492
Domain-containing proteins not elsewhere classified [BR:otw04990]
 Phosphotyrosine binding (PTB) domain-containing proteins
  IRS related family proteins
   112232492
SSDB
Motif
Pfam: IRS PH PH_11 Mcp5_PH
Other DBs
NCBI-GeneID: 112232492
NCBI-ProteinID: XP_024255295
LinkDB
Position
Unknown
AA seq 1070 aa
MASPQTNGGHLLSNVTNNIKKCGYLKKQKHGHRRFFVLREPSESFPARLEYYESEKKWKN
KSAAKRVILLDSCLCINKRADSKHKHLIAFYTKDEYFAVAAENEQEQESWFRVLSDLVEE
GKVYDSPASNSTSLFCFEEANYSMITPATAFCREIWQVNLKSRGLGQTKHLTGVFRLCLS
SRTISFVKLNSEVAAVSLQLMNIRRCGHSDSFFFIEVGRSAVTGPGELWMQADDSVVAQN
IHETILEAMKAMKELSESRPRSKSQSASTNPISVPTRRNLNNLPPSQTGLVRRSRTNSIV
ATSPMSKFTSCRIRTASEGDGNMVKPVSMSISMSGSPTSPLSNRNPLSRSNTLSTGRTCR
ILESSLQHSRSMPVSNSPPSVCSSICLSPMSGTLPTPDPVHRPFSCSASISGSLSDASFM
LCNEHSSSPGDTSILLPITRSDTHDSLSSTPPSREANDLCGYMIMDRTNDQRQACQEEDL
TSEKAYRKRTYSLTTPRHQRVPAQLSSASLDEYTLMRAAHHTNSGHHSGRSSISASPNVS
YPKSNGNQVGDDGYMPMMVGVAAPPRGNNSKADAYMPMSPMCVSAPKQIINPLAQNHRYE
AGDQTNSPSSGGSLEDSGYMRMWCGSKSSVESPDSRSTYMNMSPRNAAYTTSQTPPDYFL
DQLPGRGPPITPIYSTDSLPRSIKLHQASKEAGDTGDQYVLMSPQGNQSLGRESDDDYYS
VMTNPAPPNSSVPSPIRQSRGTESLTSHRGRMGRHNRLSLDSCRILPSMNKHLLPGEPRS
PGEYINIDFSEGTKYSPPSASNESQESSLGSSGGQPRSPFSDYMNLHHVVSHSPKAGDTP
DRRLDTVPESSLCPCPDGEGVYRLRSKRDSKCPQRGKDEYTEMTFGLGMANMPPQFLPQT
STSPSAREKRLSLGEQGLPGGMGVFLLGAATPVDPDRAAKVIRADPHGRRRHSSETFSST
ATVTPVFPSFAHGDAKHHSSVENLSVRSSESSDEECGSPMSREISGGFQNGLNYIALNLM
EDRDLEGPCCEDLTTVSFKPASSCKGALHGLHVAPYVCLGFKEAVTSVKD
NT seq 3213 nt   +upstreamnt  +downstreamnt
atggcgagtcctcaaactaatggaggacacttgttgtctaatgtgaccaataacattaag
aaatgtggatatctaaagaaacagaagcatggacacagacgttttttcgtgttgagagaa
cccagcgagagctttcctgcccgcctggaatactacgagagcgagaagaagtggaaaaac
aagtcggctgctaaaagggtgatactgctggactcctgtctttgcataaacaagcgagcg
gactccaagcacaaacatctcatcgccttttacaccaaggacgaatactttgcagtggca
gccgaaaacgagcaggagcaggagagctggtttcgagtgttgtcggatttggtcgaagag
gggaaagtctatgacagccccgcgtctaattccacctctcttttctgttttgaggaggcg
aattacagtatgatcacgccggccactgccttttgcagggagatttggcaagtgaatttg
aaatccagaggactgggtcaaacaaaacatttgacaggggtgtttaggctgtgtttatcc
agtcggactatcagctttgtgaaactgaactcggaggttgcagctgtcagtttacagctc
atgaatatccggagatgtggccactccgacagctttttcttcatcgaggttggtaggtcg
gctgtcactggccctggtgagctctggatgcaggcggatgattcggtggttgcgcaaaac
atccacgagaccatcctggaggcgatgaaagccatgaaagagctgtcagaatcaagacca
cgcagcaagagtcagtcggctagcaccaaccccatttccgtgcccacaagacgcaacttg
aacaatctgcctccaagtcagacagggttggtgaggaggtcgagaacaaacagcatagtg
gccacatccccaatgagcaagttcacatcctgtcggataaggacagctagtgagggggat
ggcaacatggtcaagccagtgtctatgtcaatatctatgagcgggagccccaccagtccc
ctctccaaccggaaccctctgagcaggtccaatacgctctccactgggcgcacctgccgg
atactggagtccagcctccagcacagccgctccatgcccgtctccaactcccctccctca
gtctgcagttccatctgcctctcccccatgagcgggaccctccccacccctgatccggtc
caccgccccttcagctgcagcgcctctatctcaggctccctcagcgacgcaagcttcatg
ctatgcaatgagcacagctccagcccaggcgacacctccattctcctacccatcactagg
agtgacacccacgactccctctccagcactcctccctcccgggaggccaacgatctgtgt
ggctacatgattatggacaggaccaatgaccaacggcaggcgtgccaggaggaggacttg
acatcggagaaggcgtacaggaagagaacatactccctcaccacaccacgccatcagcgg
gtgcctgcccagctgtcctctgcctcgttggatgagtacaccctaatgcgggctgcccac
cacaccaacagcgggcaccactccgggcgcagctccatctccgcctccccaaatgtgtcc
taccccaaatccaatggtaatcaagtaggggatgatggctatatgcctatgatggtgggc
gtggcagcaccgcccaggggcaacaacagcaaggcagatgcttacatgcccatgagcccc
atgtgtgtttcggctcccaagcagatcattaaccccttggcccaaaaccaccggtacgag
gctggcgaccagaccaactcacccagcagcggaggctccttggaggacagtggttacatg
aggatgtggtgcggctccaagtcgtccgttgaaagcccagacagccgctcgacctacatg
aacatgtcccctcgcaacgccgcttacaccacctcgcagacccccccggactacttccta
gaccagcttccgggtcgtgggcctcccatcacacccatctactccacagactccctgcca
cgctccatcaaactccaccaggcttccaaggaggcgggggacactggtgaccagtacgtc
ctgatgagcccgcaaggcaatcagtcgctaggtagggagtcagacgacgactactactca
gtgatgaccaatccggccccgcccaactcctcggtgccctcgcccatcagacagagccgg
gggactgagagcctgacatcccaccgggggagaatggggcgacacaaccggctatctctg
gacagctgtaggatcctacccagcatgaacaagcacctcttgcccggggaacccaggagc
ccgggcgagtatatcaacatagacttcagtgagggcaccaagtactccccgccgtcagca
tccaatgagagccaggagtcgtctctgggctccagcggcggccagccgaggtcccctttc
tccgactacatgaacctgcaccacgtcgtctcacactcacccaaggccggagacacccct
gatcgacggttggacacggtccctgagtcatccctgtgcccttgtccggatggggaggga
gtgtaccgtctcagatcgaagagggattccaagtgcccccagagaggcaaggatgagtac
acagagatgacatttggacttggaatggccaacatgcctccccagttcctccctcagacc
tcaacaagccccagtgccagagagaagaggctatccctgggtgagcagggcctcccgggg
ggcatgggggtgttcctccttggtgcggccacccccgtggatcctgacagggccgccaag
gtgatccgggccgacccccatggccgcaggcggcacagctctgaaaccttctcctctacg
gctaccgtcacccccgtgttcccctcgttcgcccatggggatgccaaacaccacagctcg
gtggagaacctgtcggtgcggagcagcgagagctcagacgaggagtgtggcagccccatg
agtagagagatctctgggggcttccagaatggactgaactatattgccctgaacctgatg
gaggacagggacctggagggaccttgttgcgaagacctgaccacggtcagctttaagccg
gccagcagctgcaagggagccctccatggattacatgtcgcgccgtacgtctgtttgggg
ttcaaggaggcggtcacctctgttaaagactga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112232751
Entry
112232751         CDS       T05605                                 

Definition
(RefSeq) insulin receptor substrate 1-B-like isoform X1
  KO
K16172  insulin receptor substrate 1
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04140  Autophagy - animal
otw04150  mTOR signaling pathway
otw04910  Insulin signaling pathway
otw04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112232751
   04150 mTOR signaling pathway
    112232751
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112232751
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112232751
   04920 Adipocytokine signaling pathway
    112232751
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:otw04990]
    112232751
Domain-containing proteins not elsewhere classified [BR:otw04990]
 Phosphotyrosine binding (PTB) domain-containing proteins
  IRS related family proteins
   112232751
SSDB
Motif
Pfam: IRS PH PH_11 PH_8 PTCB-BRCT
Other DBs
NCBI-GeneID: 112232751
NCBI-ProteinID: XP_024255732
LinkDB
Position
Unknown
AA seq 1301 aa
MECQPPDPQSYEDVRKNGYLRKQKSMHRRYFVLRTATERGPARLEYYESEKKFRGKTPVP
KKALVLETCFNINKRADAKNKHMIVLYTRAESFAIAAENEADQDEWYQAMVELQCKSKTP
TTDTGAGGDYGVPTPGPAFKEVWQVKVWPKGLGQAKNLVGVYRLCLTDKTVNFVKLNSDA
AAVVLQLMNVRRCGHSENFFFVEVGRSAVTGPGEFWMQVDDSVVAQNMHETLLEAMKALS
EEFRQRSKSQSNSGPGGGATASNPISVPSRRHHPNPPPSQVGFTRRPRTEPPGGSGTGGN
SANASPTPRHSFPRSGTASDGVKGEEGVGGACGGVGQSSSPTTNGSCSTTPILRSKLARS
ASTPTKNNSLSLMRSISTPASSPAPSLSSSSSHCSEFGVVVGATGGGGGATGTGAYSRLH
SHNASVSGSPSDYGSSDEYGSSPGEHSAPSPNMPGGSARSGRYQSLDDEAANYILMGQRG
GGGAPTSGSLPAGASSSAPSHQPQTRRVLRRSSSRECEAERQLLSKRASLPPMALERLAP
QPHRGEEEQDEDVADYAIMSRSTSGDSFTTCISSQRDSEMSPGGGGGGGGYLDVAVELVG
SGGIVRDNGYMSMLPGGVTQPPVSLTHSLSVSDSESKPADDYMAMTPNNSVSPPQQIRPP
PGSGDGYMMMSPNSSCSPDQRGCLGGVAWVDSSSADSRAGSDYMNMSPISIRSANSSPPP
PEQPPQTDHHPSLQAPKMVYSYYSLPRSYKHTPPGGHFEDGPGRGRRPNGSSDVRGVGRA
VVVRQDPNLGAVQGRHLSLSSSSYSSSSASSESLGENEDRALQGAGSSGGGAHSKDMGLL
QQRRAAPKQGQQGGPRTRPVSLFVDVSKANTLPRVRENPLPPEPKSPGEYVSIEFKGDQS
ARGGPGGGGGRGLRHGMSLPHGSSQHPSHRAASCLGGFMPLPRSPSTPQTPIMPLTPPSA
SEYVNMDLRPSPSPSPLSLTPLSFPTFPTPPTPPPMILVPKAHDEYRVALQQQGGTEGAE
AGPRTNRQTTHVVVTQSESPTSCGDYTEMAFSLKNNTVPSSTSNNTFPKAPSPARPDPPV
PVVTLGLDFPLPKPGPNPDHGAKVIRADPQGRRRHCSETFLASPSLPPPSSNSSSAASLF
PEQAQAVARRLGFEGMLWGNGVSAEHLPSQFLHPGPGIPAAQALSMEQGLNYIDLDLANK
ESPHSALDGSSTIQAIPPRLYSSVLNGGGGVGVSGAGIGGSGGSNLNTYASIDFYKSEEL
RTHPNGNKDGTGPPGAGLPSSHHKHTHTRQSGLCYCLFTPK
NT seq 3906 nt   +upstreamnt  +downstreamnt
atggagtgccaaccacccgacccgcaaagctacgaggacgttcgaaagaacggctacctc
cgcaagcagaaatccatgcaccggcgatacttcgtcctccggacggccacggagaggggt
ccggcccggctcgaatactacgagagcgagaagaaattccgcggaaaaacacccgtccca
aagaaagccctggtgctggagacgtgtttcaacatcaataagcgggctgatgcgaagaac
aagcacatgatagtgctgtacacccgagcggagagctttgccatcgcggcagaaaacgag
gcggaccaggacgaatggtatcaggccatggtggagctgcaatgcaaaagtaagacgcct
actactgacacaggtgctggaggggactacggcgtgcccaccccaggccctgccttcaag
gaggtgtggcaggtcaaggtgtggcctaaagggctgggccaggccaagaacctggtgggt
gtctaccggctgtgcctgaccgacaagacggtcaactttgtcaagctcaactcggacgcg
gccgccgtggtcctgcagttgatgaatgtgcgccgctgcggtcactccgaaaacttcttc
tttgtggaggttggtcgctctgcggttacgggccccggggaattctggatgcaggtggat
gactcagtggtggcccagaacatgcatgagaccctactggaagccatgaaagccctgagt
gaggagttccgccaacgcagcaagtcacagtccaattctgggccaggtgggggagccacc
gcctccaaccccatcagcgtcccctcgcgacgccaccatcccaaccctccccccagccag
gtgggcttcacccgtagacctcgcaccgagccgcccggagggtctggaacaggcggcaac
agcgcaaacgcatcacccaccccccgccacagtttccccaggtcaggcacagccagtgat
ggggttaaaggagaagaaggggtggggggagcgtgcggaggtgtaggtcagagttccagt
cctaccaccaatgggtcctgctccaccacgcccatcctcaggtccaagttggcccgttct
gcctccaccccaaccaagaacaactccctgagcctgatgcgctccatctccaccccagct
tcctccccagctcctagcttgtcctccagctccagccactgctctgagtttggggtagtg
gtgggtgcaaccggaggaggtggaggagcaacagggaccggtgcctacagccgcctccac
tcccacaacgcctccgtgtcgggctcccccagcgattatggctcctcggatgagtacggc
tccagccctggggagcactctgccccctcccccaacatgccaggagggtcagccaggtca
ggccgttatcaatccctggacgacgaggctgctaactacatcctaatgggccagcgtggt
ggtggtggagctccaacatctggctctctgcctgccggagcatccagctcagccccttct
caccagccccagaccaggagggtcctgcggcgctcctctagccgggaatgtgaagccgag
aggcagttgctgagcaagcgggcgtccctgcctcccatggccctggagcgcctggccccg
caaccccacaggggggaggaggagcaggatgaagacgtggcggactacgccatcatgtcc
cgcagcaccagcggggattccttcaccacctgcatctcctcacaaagagactctgagatg
agccccggtggaggagggggaggagggggatacctggacgtggctgtagagttggttggt
agtggaggtatagtgcgggataacggctatatgtccatgctaccgggaggagttacccaa
cctccagtctccctcacccactcgctttccgtctctgactcggagtccaagccagcggat
gactacatggccatgacgcctaacaacagcgtgtcccccccgcagcagatccggccccct
cctggctctggcgacggctacatgatgatgtcacccaacagcagctgctctccggaccag
cgtggctgcctgggaggtgtggcctgggtggacagcagcagcgccgacagccgggcgggc
agcgactacatgaacatgtctcccatcagcatccgctcggccaacagcagcccccctccc
cccgagcaaccccctcagacagaccaccacccctcactgcaggcccccaagatggtctac
tcctactactcactgccccgctcctacaaacacacgccacctggtggacacttcgaggac
ggtcccggccgaggcaggaggcccaatgggagcagtgatgttagaggagttggcagggcg
gtggtggttcgtcaggaccccaatttgggtgcagtccaaggtcgccacctgtccctctcc
tcgtcctcatactcctccagctctgccagcagtgagagcctaggggagaacgaggacagg
gctctccagggagcagggtcctcaggtgggggagctcactctaaagacatggggctcctc
cagcagagacgggcagccccaaagcagggccagcaggggggacccaggacccggcctgtc
agcctgtttgtggacgtgtccaaagcaaacaccctccccagggtccgtgagaaccccctc
cccccagagcccaagagcccaggggagtacgtcagcattgaattcaagggagatcaaagc
gccagaggagggccaggaggtgggggagggaggggactcagacacgggatgtccctgcct
cacggctccagccagcacccttcacaccgggctgcctcttgcctgggggggttcatgccc
ctcccccgaagcccctccaccccccagacccccatcatgcccctcacccctccatccgcc
tcagaatatgtcaacatggacctgcggccctcaccgtccccctctcccctctccctgaca
ccactgagcttcccaaccttccccaccccaccaacgcctcctccaatgatcctggtcccc
aaggcccacgacgagtacagggtggcccttcagcagcaaggcgggacagagggtgctgaa
gcgggtcccaggacaaacagacagactacccatgtagtggtgactcaatcagagtcccct
acctcctgcggggactatacagagatggccttcagcctgaaaaacaacaccgtccccagc
tccacgtccaacaacaccttccccaaagccccctccccagccaggcccgatcccccagtc
cctgtcgtcaccctgggcctggacttccccctgcctaaacctgggcccaacccggaccac
ggggctaaagtgatccgggccgacccccagggccgcaggcgccactgctccgaaaccttc
ctcgcctccccctctctccctcccccctcctccaactcctcctctgctgcctctctcttc
ccggagcaagcccaggccgtggctcgccggcttgggtttgagggcatgctgtgggggaat
ggagtgtcggccgagcatctcccctcgcagttcctccaccctgggcctggcatacccgct
gcccaggctttgtccatggagcaaggccttaactacatagacttggacttggccaacaaa
gagagccctcattcagccttagatgggtcctcaaccatacaggctatcccccctcgcctc
tactcatccgtactgaatggggggggcggggtgggggtgtcaggggcgggcatcgggggt
agtggcggctccaacctcaacacctatgccagcattgacttctacaagtcagaagagctg
cggacgcatccgaacggaaacaaagacggtacaggcccacctggtgctggattacccagc
agtcaccacaagcacacacacacacgccaatcaggtctttgttactgtctatttacgcct
aaatga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112233838
Entry
112233838         CDS       T05605                                 

Definition
(RefSeq) insulin receptor substrate 1-B-like isoform X1
  KO
K16172  insulin receptor substrate 1
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04140  Autophagy - animal
otw04150  mTOR signaling pathway
otw04910  Insulin signaling pathway
otw04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112233838
   04150 mTOR signaling pathway
    112233838
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112233838
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112233838
   04920 Adipocytokine signaling pathway
    112233838
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:otw04990]
    112233838
Domain-containing proteins not elsewhere classified [BR:otw04990]
 Phosphotyrosine binding (PTB) domain-containing proteins
  IRS related family proteins
   112233838
SSDB
Motif
Pfam: IRS PH PH_11 PH_8 PTCB-BRCT
Other DBs
NCBI-GeneID: 112233838
NCBI-ProteinID: XP_024257492
LinkDB
Position
Unknown
AA seq 1301 aa
MECQPPDPQSYEDVRKNGYLRKQKSMHRRYFVLRTATERGPARLEYYESEKKFRGKTPVP
KKALVLETCFNINKRADAKNKHMIVLYTRAESFAIAAENEADQDEWYQAMVELQCKSKTP
TTDTGAGGDYGVPTPGPAFKEVWQVKVWPKGLGQAKNLVGVYRLCLTDKTVNFVKLNSDA
AAVVLQLMNVRRCGHSENFFFVEVGRSAVTGPGEFWMQVDDSVVAQNMHETLLEAMKALS
EEFRQRSKSQSNSGPGGGATASNPISVPSRRHHPNPPPSQVGFTRRPRTEPPGGSGTGGN
SANASPTPRHSFPRSGTASDGVKGEEGVGGACGGVGQSSSPTTNGSCSTTPILRSKLARS
ASTPTKNNSLSLMRSISTPASSPAPSLSSSSSHCSEFGVVVGATGGGGGATGTGAYSRLH
SHNASVSGSPSDYGSSDEYGSSPGEHSAPSPNMPGGSARSGRYQSLDDEAANYILMGQRG
GGGAPTSGSLPAGASSSAPSHQPQTRRVLRRSSSRECEAERQLLSKRASLPPMALERLAP
QPHRGEEEQDEDVADYAIMSRSTSGDSFTTCISSQRDSEMSPGGGGGGGGYLDVAVELVG
SGGIVRDNGYMSMLPGGVTQPPVSLTHSLSVSDSESKPADDYMAMTPNNSVSPPQQIRPP
PGSGDGYMMMSPNSSCSPDQRGCLGGVAWVDSSSADSRAGSDYMNMSPISIRSANSSPPP
PEQPPQTDHHPSLQAPKMVYSYYSLPRSYKHTPPGGHFEDGPGRGRRPNGSSDVRGVGRA
VVVRQDPNLGAVQGRHLSLSSSSYSSSSASSESLGENEDRALQGAGSSGGGAHSKDMGLL
QQRRAAPKQGQQGGPRTRPVSLFVDVSKANTLPRVRENPLPPEPKSPGEYVSIEFKGDQS
ARGGPGGGGGRGLRHGMSLPHGSSQHPSHRAASCLGGFMPLPRSPSTPQTPIMPLTPPSA
SEYVNMDLRPSPSPSPLSLTPLSFPTFPTPPTPPPMILVPKAHDEYRVALQQQGGTEGAE
AGPRTNRQTTHVVVTQSESPTSCGDYTEMAFSLKNNTVPSSTSNNTFPKAPSPARPDPPV
PVVTLGLDFPLPKPGPNPDHGAKVIRADPQGRRRHCSETFLASPSLPPPSSNSSSAASLF
PEQAQAVARRLGFEGMLWGNGVSAEHLPSQFLHPGPGIPAAQALSMEQGLNYIDLDLANK
ESPHSALDGSSTIQAIPPRLYSSVLNGGGGVGVSGAGIGGSGGSNLNTYASIDFYKSEEL
RTHPNGNKDGTGPPGAGLPSSHHKHTHTRQSGLCYCLFTPK
NT seq 3906 nt   +upstreamnt  +downstreamnt
atggagtgccaaccacccgacccgcaaagctacgaggacgttcgaaagaacggctacctc
cgcaagcagaaatccatgcaccggcgatacttcgtcctccggacggccacggagaggggt
ccggcccggctcgaatactacgagagcgagaagaaattccgcggaaaaacacccgtccca
aagaaagccctggtgctggagacgtgtttcaacatcaataagcgggctgatgcgaagaac
aagcacatgatagtgctgtacacccgagcggagagctttgccatcgcggcagaaaacgag
gcggaccaggacgaatggtatcaggccatggtggagctgcaatgcaaaagtaagacgcct
actactgacacaggtgctggaggggactacggcgtgcccaccccaggccctgccttcaag
gaggtgtggcaggtcaaggtgtggcctaaagggctgggccaggccaagaacctggtgggt
gtctaccggctgtgcctgaccgacaagacggtcaactttgtcaagctcaactcggacgcg
gccgccgtggtcctgcagttgatgaatgtgcgccgctgcggtcactccgaaaacttcttc
tttgtggaggttggtcgctctgcggttacgggccccggggaattctggatgcaggtggat
gactcagtggtggcccagaacatgcatgagaccctactggaagccatgaaagccctgagt
gaggagttccgccaacgcagcaagtcacagtccaattctgggccaggtgggggagccacc
gcctccaaccccatcagcgtcccctcgcgacgccaccatcccaaccctccccccagccag
gtgggcttcacccgtagacctcgcaccgagccgcccggagggtctggaacaggcggcaac
agcgcaaacgcatcacccaccccccgccacagtttccccaggtcaggcacagccagtgat
ggggttaaaggagaagaaggggtggggggagcgtgcggaggtgtaggtcagagttccagt
cctaccaccaatgggtcctgctccaccacgcccatcctcaggtccaagttggcccgttct
gcctccaccccaaccaagaacaactccctgagcctgatgcgctccatctccaccccagct
tcctccccagctcctagcttgtcctccagctccagccactgctctgagtttggggtagtg
gtgggtgcaaccggaggaggtggaggagcaacagggaccggtgcctacagccgcctccac
tcccacaacgcctccgtgtcgggctcccccagcgattatggctcctcggatgagtacggc
tccagccctggggagcactctgccccctcccccaacatgccaggagggtcagccaggtca
ggccgttatcaatccctggacgacgaggctgctaactacatcctaatgggccagcgtggt
ggtggtggagctccaacatctggctctctgcctgccggagcatccagctcagccccttct
caccagccccagaccaggagggtcctgcggcgctcctctagccgggaatgtgaagccgag
aggcagttgctgagcaagcgggcgtccctgcctcccatggccctggagcgcctggccccg
caaccccacaggggggaggaggagcaggatgaagacgtggcggactacgccatcatgtcc
cgcagcaccagcggggattccttcaccacctgcatctcctcacaaagagactctgagatg
agccccggtggaggagggggaggagggggatacctggacgtggctgtagagttggttggt
agtggaggtatagtgcgggataacggctatatgtccatgctaccgggaggagttacccaa
cctccagtctccctcacccactcgctttccgtctctgactcggagtccaagccagcggat
gactacatggccatgacgcctaacaacagcgtgtcccccccgcagcagatccggccccct
cctggctctggcgacggctacatgatgatgtcacccaacagcagctgctctccggaccag
cgtggctgcctgggaggtgtggcctgggtggacagcagcagcgccgacagccgggcgggc
agcgactacatgaacatgtctcccatcagcatccgctcggccaacagcagcccccctccc
cccgagcaaccccctcagacagaccaccacccctcactgcaggcccccaagatggtctac
tcctactactcactgccccgctcctacaaacacacgccacctggtggacacttcgaggac
ggtcccggccgaggcaggaggcccaatgggagcagtgatgttagaggagttggcagggcg
gtggtggttcgtcaggaccccaatttgggtgcagtccaaggtcgccacctgtccctctcc
tcgtcctcatactcctccagctctgccagcagtgagagcctaggggagaacgaggacagg
gctctccagggagcagggtcctcaggtgggggagctcactctaaagacatggggctcctc
cagcagagacgggcagccccaaagcagggccagcaggggggacccaggacccggcctgtc
agcctgtttgtggacgtgtccaaagcaaacaccctccccagggtccgtgagaaccccctc
cccccagagcccaagagcccaggggagtacgtcagcattgaattcaagggagatcaaagc
gccagaggagggccaggaggtgggggagggaggggactcagacacgggatgtccctgcct
cacggctccagccagcacccttcacaccgggctgcctcttgcctgggggggttcatgccc
ctcccccgaagcccctccaccccccagacccccatcatgcccctcacccctccatccgcc
tcagaatatgtcaacatggacctgcggccctcaccgtccccctctcccctctccctgaca
ccactgagcttcccaaccttccccaccccaccaacgcctcctccaatgatcctggtcccc
aaggcccacgacgagtacagggtggcccttcagcagcaaggcgggacagagggtgctgaa
gcgggtcccaggacaaacagacagactacccatgtagtggtgactcaatcagagtcccct
acctcctgcggggactatacagagatggccttcagcctgaaaaacaacaccgtccccagc
tccacgtccaacaacaccttccccaaagccccctccccagccaggcccgatcccccagtc
cctgtcgtcaccctgggcctggacttccccctgcctaaacctgggcccaacccggaccac
ggggctaaagtgatccgggccgacccccagggccgcaggcgccactgctccgaaaccttc
ctcgcctccccctctctccctcccccctcctccaactcctcctctgctgcctctctcttc
ccggagcaagcccaggccgtggctcgccggcttgggtttgagggcatgctgtgggggaat
ggagtgtcggccgagcatctcccctcgcagttcctccaccctgggcctggcatacccgct
gcccaggctttgtccatggagcaaggccttaactacatagacttggacttggccaacaaa
gagagccctcattcagccttagatgggtcctcaaccatacaggctatcccccctcgcctc
tactcatccgtactgaatggggggggcggggtgggggtgtcaggggcgggcatcgggggt
agtggcggctccaacctcaacacctatgccagcattgacttctacaagtcagaagagctg
cggacgcatccgaacggaaacaaagacggtacaggcccacctggtgctggattacccagc
agtcaccacaagcacacacacacacgccaatcaggtctttgttactgtctatttacgcct
aaatga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112236594
Entry
112236594         CDS       T05605                                 

Definition
(RefSeq) insulin receptor substrate 2-B-like
  KO
K07187  insulin receptor substrate 2
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04140  Autophagy - animal
otw04910  Insulin signaling pathway
otw04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112236594
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112236594
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112236594
   04920 Adipocytokine signaling pathway
    112236594
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:otw04990]
    112236594
Domain-containing proteins not elsewhere classified [BR:otw04990]
 Phosphotyrosine binding (PTB) domain-containing proteins
  IRS related family proteins
   112236594
SSDB
Motif
Pfam: IRS PH PH_11
Other DBs
NCBI-GeneID: 112236594
NCBI-ProteinID: XP_024260960
LinkDB
Position
Unknown
AA seq 1381 aa
MANFTNYQESKAAMLLVETQQRGIGTKPAAANDGDTSVGEPPSPLLNIGGVGASGARFHQ
HLPPSSHHHYPQSSLPKGQQHPLSHHYQAATEHHLSVENITESPVRKASSSSLNLVQQDP
AASHHALAASVNAASAAIQLAANANVSVATSEGVVDDIQKCGYLRKQKHGHKRFFVLRAA
SHLGLSRLEYYDSEKKFRNSLRSAAAAAANGTVAPSPPKRVIYLYQCFTVNKRADSKNKH
LIALYTKDEYFAIVAENEQEQDDWYVALSELMSEGKKGHLDSDELDDGYGTVTPGTVFKE
VWQVNVKPKGLGQTKNLTGVYRLCLSTKTIHLVKLNSETPCVNLQLMNIRRCGHSESFFF
MEVGRSSSIGPGEIWMQVDDSVVAQNMHETILETMKALKAFAEIRPRSKSQSSGSNPIAF
ITTRRHLGNLPPSQTGLQRRSRTESVVGTPPSSKSSGASGYRFRTSSEGEGTMNRPFRSV
TGSLIHLNTARIHLGRQEGGVGAGNTGSTGVVGRYARALPGSTYHARSASLPVSHFPSTT
SPVSVSSSSGHGSVSDTLTRPSSASICGSPSDGGFNSSDEYGSSPGDFRYFRVRSNTPDS
LGNTPPIREENCMSDYMAMGWHREVFGAASGGGSSSGSAETPNRDESTSTDDDRSLRRRT
HSFTRPGGQGGVAGGSSGVTVYQKMTQTTFSLDESVSVGEALSLGRTDSITQPSSSSSSL
RSDYSSCSEHSQGRPPPFSAKEDSGYMPMLCGVAASPCDAPDYMPMQPSSPSLHHHHPQH
SHSPQAPRSAQQHTDPRGYMMMLPGGRNSSSPVQASPSSHSSSSSMGLGGGSVSSSGSIV
ERPENGEYMDMSYSSSGGGGGDAAGGRKFSNEGGYYALSNPEGRDPKSYNYSPYFSLPRS
YKAPAAREREQREREQREREQREREPRAHDEYVPMSSPAKPVYSQVATGNVGERGVTTRG
VGSGGSDTPHVLPHGYPPPPYGVHHQAANGDRRTTPVRPNRLPLGRRSFHGSLRVSEPDA
AEVLSSPGEYINIEFGGRYGPPTACPLSAQDGSPSVGSAEQRHSPPHPYPQNQDYMSVEV
GVGGGGDDGGRLAKNKSPRPSLVAPWNPPSYIRPLATGASVSGAPGSSGARWRTGTDDYT
DMTFNLSSGEESRGLRSSPTAMLQHLCLMESCYPPTLTPTSASPPSSSPQLEPIKVVRAD
PQGRRRHSSETFSSSSTSGGVGATSSSTNPNPSLGSANPSALNVAHLAESSKWTGSGSFD
SVWMCVEGVGGDSAGLPARPGPSDLGIASSVCPPGGRMCRNMSVGYQNGLNYIALELRED
RDSNPLPVPQQQQGGTGHGTGVTPNAPQASNLTVPVAEDNGAYGSIDFIKSDRMTATSKG
E
NT seq 4146 nt   +upstreamnt  +downstreamnt
atggcaaatttcacgaattaccaagaaagcaaagcggctatgttgttagtggagacgcaa
cagaggggcatcgggacgaaaccagcggcagccaatgatggagacacctcggtcggggaa
cccccttccccgttattgaatatcggtggcgtcggggccagcggagctcgtttccatcag
cacttgccgccctccagccaccatcactacccccagagctcgctgcccaaaggacaacaa
cacccgctgtcgcaccactaccaggcggcgacggagcatcatctctctgttgaaaacatc
acggagtccccggtaaggaaagcctcgtcatcgtctttgaacctggtacagcaggacccc
gctgctagccaccacgcactcgctgcgtcggtaaacgcggcgtcggccgcgatacaacta
gccgcgaatgctaatgttagcgtggctacctcagaaggtgtagtggacgacattcagaag
tgtggctatctgcggaaacagaaacacggccacaagaggtttttcgtgctgagggcggcc
agccacctaggcctcagtcggttggagtactatgacagcgagaaaaaattccgtaacagt
ctgcggtctgctgctgcggcagctgcaaacggtacggtcgccccttctcccccgaaaagg
gtgatctatctgtatcagtgcttcactgtcaacaaacgagcagattccaaaaacaaacac
ctcatagccctctacactaaggatgaatactttgctattgtagctgaaaacgagcaggaa
caagatgactggtatgtagcgctgagtgaactgatgagtgaggggaaaaaggggcatcta
gactcggacgagttggatgatggctacggtaccgtcacaccaggtacggttttcaaagag
gtgtggcaggtgaacgtgaaacccaaagggctgggtcagaccaagaacctcacaggtgtg
tatcgtttatgcctctctactaaaactatccacctggtcaaactaaactctgagacgcca
tgtgtcaaccttcagctgatgaacatcagacgctgtggacactcagaaagcttcttcttc
atggaggtgggtcggtcatcctctataggccctggggagatatggatgcaggtagatgac
tctgtagtggctcagaacatgcatgagaccatcctggagaccatgaaggctctgaaggcc
tttgctgagatccgccccaggagcaagagccaatcttctggctccaaccccatcgctttt
atcaccacccgccgtcacctaggtaacctgcctccgagccagacaggtctccagcgccgc
tccaggactgagtcggtggttgggacgccgccgtcgagtaagagctctggcgccagcggc
tatcgcttccgaacatcgagcgagggtgaggggacgatgaaccggccattccgatccgtt
accggcagcctgatccacctgaacactgcccggatacacctggggcgccaggagggcggg
gtaggggcagggaataccgggagcaccggggttgtagggcgctacgccagggcactacca
gggtccacctaccacgcccgctccgcctcgctcccagtctcccactttccctccaccacc
tcccctgtcagcgtgtccagcagcagcgggcatggctccgtctccgatacccttacccgg
ccctcctcagcgtccatctgtggttccccctccgacggaggcttcaactcctcagacgag
tacggctccagccctggggacttccgctacttcagggtccggagcaacactcctgattcc
cttggcaacaccccaccaatcagagaagagaactgcatgagcgactacatggccatgggc
tggcaccgtgaggtgtttggagccgccagcggtggagggagtagctctggcagtgcggag
acgcccaaccgggacgagagcacgtcgacggatgacgacaggtccctgaggagacgtacc
cactcgttcacgcggcccgggggtcaggggggtgttgccggcggcagcagtggtgtgacg
gtgtaccagaagatgacccagaccaccttctcgctggacgagtcggtgtccgtgggagag
gccctgtctctcggccgcaccgacagcatcacccagccttcctcctcttcttcttccctc
cgctctgactacagctcctgctccgagcacagccagggccgaccccctcctttttcggcc
aaggaggacagcggctacatgcccatgttgtgtggggtggcagcctcaccctgtgacgca
ccggactacatgcctatgcaacccagctccccctctcttcaccaccaccatccccagcac
tcccactctccccaggccccccgctcagcccaacagcacacagacccccgtggctacatg
atgatgctaccaggggggcggaactcctcttccccagtccaggcctcccccagctcccac
agcagtagcagtagcatgggtctgggtggaggtagtgtcagtagttctggaagtatagtg
gagcggcccgagaatggagagtacatggacatgtcgtacagcagtagcggaggaggtgga
ggggacgcggcagggggacggaagttctccaacgaggggggatactacgcactgagcaac
cctgaagggagagaccccaaatcatacaactacagcccctacttctccctgcctcgctcc
tacaaggcccccgctgcgagagagagggaacagagagagagggaacagagagagagggaa
cagagagagagggaaccgagagcgcatgatgagtatgtacccatgagctccccggcaaaa
ccagtctactcccaggttgctaccggcaatgtcggcgagaggggcgtgacgacgaggggt
gttggtagtggggggtctgacacccctcacgtcctccctcacggctacccgccccctccc
tacggggtgcaccaccaagcggctaacggtgaccgtcggacgaccccggtccggcccaac
cgcctccccctagggcgccgcagcttccacgggtcactgagggtcagcgagccggacgcc
gccgaggtactctccagccctggagagtacatcaacatcgagtttgggggccgctacgga
cccccaacggcctgccccctctctgcccaggatggctcaccctcggtgggctctgctgag
cagcgccactcccctccccacccctatcctcagaaccaggactatatgagtgtagaggtg
ggggttggaggtgggggtgatgatggaggacgcctggctaagaacaagtctcccagaccc
tcactggtggctccctggaacccacccagctacatccgacctcttgccactggggcctcc
gtgagtggggcccctggttcttctggagctcgatggcggacggggacagatgactacaca
gatatgacctttaacctcagcagtggtgaggagtcgcgggggttacggagtagtcccacg
gccatgctgcagcacctgtgtttgatggagagctgctacccccccaccttaacccccacc
tctgcctcccctccctcctccagcccccagcttgagcccatcaaggtggtacgtgcggac
ccccaggggcgacgccgacacagctctgaaacgttttcctcatcctccacctccggagga
gtcggagccacaagctccagcaccaaccccaacccctccttgggctcagccaacccatcg
gccctcaacgtagctcatctggccgagagctccaagtggaccggctctggctcctttgac
agtgtgtggatgtgtgttgagggggtagggggggactcggctggtctccctgcccgtcca
gggccttctgatctgggcattgcctcttctgtgtgtcctcctgggggtcggatgtgcagg
aacatgtctgtggggtatcagaacggactcaactacatcgccctggagctgagagaggac
cgggactctaaccctctacccgtaccccagcagcagcagggaggcaccgggcatggtacc
ggggtgacccccaacgccccccaagccagtaacctgactgtgccagtagcagaggacaac
ggagcctatggcagtatagacttcatcaagtcagacaggatgactgccacgtccaagggt
gagtga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112241326
Entry
112241326         CDS       T05605                                 

Definition
(RefSeq) insulin receptor substrate 2-like
  KO
K07187  insulin receptor substrate 2
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04140  Autophagy - animal
otw04910  Insulin signaling pathway
otw04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112241326
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112241326
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112241326
   04920 Adipocytokine signaling pathway
    112241326
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:otw04990]
    112241326
Domain-containing proteins not elsewhere classified [BR:otw04990]
 Phosphotyrosine binding (PTB) domain-containing proteins
  IRS related family proteins
   112241326
SSDB
Motif
Pfam: IRS PH PH_11 Mcp5_PH
Other DBs
NCBI-GeneID: 112241326
NCBI-ProteinID: XP_024265216
LinkDB
Position
3
AA seq 1112 aa
MASPPNTGGEHLLSNANISNTKIKKCGYLKKQKHGHKRFFVLKEPGEGFPARLEYYESEK
KWKNKSAAKRVIPLDCCLNINKRADAKHKHLIALYTKDEYFAVAADNEKEQENWYRVLTD
LMSEGKVYSDGSASNSASSLVGFDEANYGMITPVNAAYKEVWQVNLKSKGLGQSRNLTGV
YRLCLSSRTISFVKLNSDVASVSLQLMNIRRCGHSESFFFIEVGRSAATGPGELWMQADD
SVVAQNIHETILEAMKAMKELSEFRPRSKSQSSGTNPISVPTRRHLNNLPPSQTGLQRRS
RTDSMATTSPVNKFTSCRIRTASEGEGTMVRPMSVNGSPLSPGIQPNLLGRSNTITARPS
RTFESSSLQHSKSMSMPLSHSPPTATPSPVSLSSCSESSAPCPSSCSASVSPSDGGFISC
DDYGSSPAGLHLTLRSNTPESLREDTPPSREGSNLHGYMVMERQNGYRRLPELDKAYRKR
TYSLTTPRQHRAPPQVSSASLDEYTLMRATYTSGCQSGRSSHMASPKVTYPEDYGDVQIG
SNGHLGDSGYMPMTPGVAPQTAGVKGNAYMPMSPMCVSAPKQIINPRSHPSPAGMGPHTD
SPGSVSLEDSGYMRMFYGAKMSVDSSDEKLTNGEYLNMSPVDPLVSFTPSDYFLTDTTPQ
PHPHHRQPYSISSLPRSLKAQPQRNGVTDTDQYVVMSLQRQRIEEESNYCPISPVSIGTP
PTNTLSSAPLILRAGRVTQEGGLVHRGRVSRPTRLALDSLRTLPCMSEHPLPSEPRSPGE
YINIDFGNATRYPPVSTTTESSASSLGSVDGPARSSPPLSEYVNINISSCSSKHRDSHSS
IGCMEPSPVLLVCPSQPHREDPREREEEYQREREEERVVVEYPLQKHVSPVCPVGAVKDD
YTEMTFSPTNPSATLPASLCPSDSSTPLPTSPSSCIQRLTLGGEGVVVVPPAPVESFLLG
GPSTPPVNPDRGAKVIRADPQGRRRHSSETFSSTTTVTPVSPSFAHDANKRHSSASVENV
SRLVRSSEGSDEEYGNSNSPMCRETSAGYQNGLNYIALNLMEGSLGGCTSLGGCEGLLRF
KAACGCKGGMNGFNASPYATMGFKETATAVKD
NT seq 3339 nt   +upstreamnt  +downstreamnt
atggcgagtcctccaaatactgggggagaacacttgttatccaacgcgaacattagtaac
accaagattaagaaatgtggatacctcaagaagcagaagcacggacacaagcgcttcttc
gttctgaaggaaccgggcgagggcttccctgcccggctggagtactacgagagcgagaag
aaatggaaaaacaagtcagcggcaaagagggttatacctcttgactgctgcctcaatatc
aacaagagagctgacgccaaacacaaacaccttatcgccctctataccaaggacgaatat
tttgccgtggcggcagataatgaaaaagagcaggagaattggtaccgagtcttaacggat
ttaatgagcgaggggaaagtgtactccgacggctccgcttccaattccgcgtcttcgctg
gtggggtttgatgaggcgaactacgggatgattacgccggtaaatgccgcgtataaggag
gtatggcaagtgaacctgaaatccaaagggctggggcagagccggaatctgaccggggtg
tacagactgtgtttatccagccggactatcagctttgtaaagctcaactcggatgtcgcg
tccgtcagtttacagctgatgaacattcggagatgcgggcactccgagagctttttcttc
atcgaggtcggacggtcagcagccacgggaccaggcgagctgtggatgcaggctgacgac
tcagtggtggcgcaaaacatccacgagactatattggaggccatgaaagccatgaaggag
ctgtcagagtttcggccgcgcagcaagagccagtcttcaggcactaaccccatctccgtg
ccgacccggcggcacctcaacaaccttcctccaagccagaccgggctccagcggcggtcg
cgcactgacagcatggccacaacttccccggttaataaatttacctcctgccggatacgc
actgccagcgagggagaaggcaccatggtgcgccccatgtctgtgaacgggagtcccctc
agccccggtattcaaccgaacctattagggagatcaaacaccattacagcccggcccagc
aggacatttgaatcctcttccctccagcacagtaagtccatgtccatgcctctgtctcac
tctccacccacagccacccccagccctgtcagcctgtcctcctgctcggagagcagtgct
ccttgcccctccagctgcagtgcctcggtctcccccagtgatgggggcttcatctcctgt
gatgattatggctccagccctgcaggcctgcacctcaccctccgcagtaacaccccagag
tccctgagggaagacacacccccttcccgggaaggcagcaacctgcacggctacatggtg
atggaaagacagaacggttaccgtcggttaccagagctggacaaggcataccggaaacgc
acatactccctcaccaccccgcgccagcacagggcaccgccccaggtctcctctgcctca
ttggacgaatacacgctcatgagggccacctacaccagtggttgccaatcgggtcgcagc
tctcacatggcttccccaaaagtgacctatcccgaggactatggcgatgtccagataggc
tccaacggtcacctaggcgacagtggctacatgcccatgactccaggtgtggcccctcag
acagcgggggtcaaaggtaatgcttacatgcccatgagccccatgtgtgtgtcggcccca
aagcagatcatcaacccccgctctcacccctctccagctgggatgggtccccatacagat
tcccctggcagtgtgtctctggaggacagcggctacatgaggatgttctacggggccaag
atgtctgtggacagctcagatgagaaactcaccaatggggagtacctcaacatgtcccct
gtggaccctctggtgtccttcaccccctcagactacttcctcacagacactaccccccag
cctcaccctcaccacagacagccttactccatcagttccctgccccgctctctcaaagcc
cagccccagaggaacggtgtcacagacacagaccagtacgtggtgatgagtctacagagg
cagaggatagaagaggagtccaactactgtcccatctcaccagtctccattggtacgccc
cccaccaacaccctctcctcagcccccttgatcctcagagccggcagggtgacccaggag
gggggtctggtccacagggggagggtgagtcgacctacccggctcgcccttgactctctg
aggacactgccctgtatgagcgaacaccctctcccctctgagcccaggagtcccggggag
tacatcaacatagactttggcaacgccacacgatacccgcctgtctctaccacgactgaa
agctctgcttcatcgctgggctcggtggacgggccggcgaggagttccccgccactctcc
gaatacgtcaacatcaacatcagctcatgctcttccaaacacagggattcccattcttca
atagggtgcatggagccgagtcctgtgctcctcgtgtgtcccagccagcctcacagagag
gatccgagggagagagaggaggagtaccagagggagagagaggaggagagagtcgtagtg
gaatatcctctccaaaagcatgtgagccctgtgtgcccggttggagctgtaaaagacgac
tacactgagatgaccttcagtcctaccaacccctctgccactctccctgcctctctgtgc
ccctctgactcctccacccccctgcctaccagcccctcgtcctgcatccagagactcacc
ctggggggagagggcgtagtggtggtcccccctgcccctgtggagtccttcctcctgggg
ggtccctccaccccacccgtcaacccagacaggggggctaaggtgatccgggctgacccc
cagggtcgcaggcgccacagctccgagaccttctcctccacaaccacagtaacgccagtg
tctccatcgttcgcccacgatgccaacaagcggcacagctcggcgtcggtggaaaacgtg
tcgcggctggtccggagctcggagggctcagacgaggagtatgggaacagcaacagcccc
atgtgccgggagacgtcggcaggctaccaaaacggactcaactacattgccttaaacctg
atggaagggagcctggggggttgcaccagtctggggggctgtgagggactgctgaggttc
aaggcagcgtgtggatgcaaggggggcatgaacggtttcaacgccagcccctatgccacc
atgggcttcaaggagactgcaacagcagtgaaagactga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112254030
Entry
112254030         CDS       T05605                                 

Definition
(RefSeq) insulin receptor substrate 2-like
  KO
K07187  insulin receptor substrate 2
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04140  Autophagy - animal
otw04910  Insulin signaling pathway
otw04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112254030
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112254030
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112254030
   04920 Adipocytokine signaling pathway
    112254030
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:otw04990]
    112254030
Domain-containing proteins not elsewhere classified [BR:otw04990]
 Phosphotyrosine binding (PTB) domain-containing proteins
  IRS related family proteins
   112254030
SSDB
Motif
Pfam: IRS PH PH_11 Mcp5_PH
Other DBs
NCBI-GeneID: 112254030
NCBI-ProteinID: XP_024282006
LinkDB
Position
7
AA seq 1070 aa
MASPQTNGGHLLSNVTNNIKKCGYLKKQKHGHRRFFVLREPSESFPARLEYYESEKKWKN
KSAAKRVILLDSCLCINKRADSKHKHLIAFYTKDEYFAVAAENEQEQESWFRVLSDLVEE
GKVYDSPASNSTSLFCFEEANYSMITPATAFCREIWQVNLKSRGLGQTKHLTGVFRLCLS
SRTISFVKLNSEVAAVSLQLMNIRRCGHSDSFFFIEVGRSAVTGPGELWMQADDSVVAQN
IHETILEAMKAMKELSESRPRSKSQSASTNPISVPTRRNLNNLPPSQTGLVRRSRTNSIV
ATSPMSKFTSCRIRTASEGDGNMVKPVSMSISMSGSPTSPLSNRNPLSRSNTLSTGRTCR
ILESSLQHSRSMPVSNSPPSVCSSICLSPMSGTLPTPDPVHRPFSCSASISGSLSDASFM
LCNEHSSSPGDTSILLPITRSDTHDSLSSTPPSREANDLCGYMIMDRTNDQRQACQEEDL
TSEKAYRKRTYSLTTPRHQRVPAQLSSASLDEYTLMRAAHHTNSGHHSGRSSISASPNVS
YPKSNGNQVGDDGYMPMMVGVAAPPRGNNSKADAYMPMSPMCVSAPKQIINPLAQNHRYE
AGDQTNSPSSGGSLEDSGYMRMWCGSKSSVESPDSRSTYMNMSPRNAAYTTSQTPPDYFL
DQLPGRGPPITPIYSTDSLPRSIKLHQASKEAGDTGDQYVLMSPQGNQSLGRESDDDYYS
VMTNPAPPNSSVPSPIRQSRGTESLTSHRGRMGRHNRLSLDSCRILPSMNKHLLPGEPRS
PGEYINIDFSEGTKYSPPSASNESQESSLGSSGGQPRSPFSDYMNLHHVVSHSPKAGDTP
DRRLDTVPESSLCPCPDGEGVYRLRSKRDSKCPQRGKDEYTEMTFGLGMANMPPQFLPQT
STSPSAREKRLSLGEQGLPGGMGVFLLGAATPVDPDRAAKVIRADPHGRRRHSSETFSST
ATVTPVFPSFAHGDAKHHSSVENLSVRSSESSDEECGSPMSREISGGFQNGLNYIALNLM
EDRDLEGPCCEDLTTVSFKPASSCKGALHGLHVAPYVCLGFKEAVTSVKD
NT seq 3213 nt   +upstreamnt  +downstreamnt
atggcgagtcctcaaactaatggaggacacttgttgtctaatgtgaccaataacattaag
aaatgtggatatctaaagaaacagaagcatggacacagacgttttttcgtgttgagagaa
cccagcgagagctttcctgcccgcctggaatactacgagagcgagaagaagtggaaaaac
aagtcggctgctaaaagggtgatactgctggactcctgtctttgcataaacaagcgagcg
gactccaagcacaaacatctcatcgccttttacaccaaggacgaatactttgcagtggca
gccgaaaacgagcaggagcaggagagctggtttcgagtgttgtcggatttggtcgaagag
gggaaagtctatgacagccccgcgtctaattccacctctcttttctgttttgaggaggcg
aattacagtatgatcacgccggccactgccttttgcagggagatttggcaagtgaatttg
aaatccagaggactgggtcaaacaaaacatttgacaggggtgtttaggctgtgtttatcc
agtcggactatcagctttgtgaaactgaactcggaggttgcagctgtcagtttacagctc
atgaatatccggagatgtggccactccgacagctttttcttcatcgaggttggtaggtcg
gctgtcactggccctggtgagctctggatgcaggcggatgattcggtggttgcgcaaaac
atccacgagaccatcctggaggcgatgaaagccatgaaagagctgtcagaatcaagacca
cgcagcaagagtcagtcggctagcaccaaccccatttccgtgcccacaagacgcaacttg
aacaatctgcctccaagtcagacagggttggtgaggaggtcgagaacaaacagcatagtg
gccacatccccaatgagcaagttcacatcctgtcggataaggacagctagtgagggggat
ggcaacatggtcaagccagtgtctatgtcaatatctatgagcgggagccccaccagtccc
ctctccaaccggaaccctctgagcaggtccaatacgctctccactgggcgcacctgccgg
atactggagtccagcctccagcacagccgctccatgcccgtctccaactcccctccctca
gtctgcagttccatctgcctctcccccatgagcgggaccctccccacccctgatccggtc
caccgccccttcagctgcagcgcctctatctcaggctccctcagcgacgcaagcttcatg
ctatgcaatgagcacagctccagcccaggcgacacctccattctcctacccatcactagg
agtgacacccacgactccctctccagcactcctccctcccgggaggccaacgatctgtgt
ggctacatgattatggacaggaccaatgaccaacggcaggcgtgccaggaggaggacttg
acatcggagaaggcgtacaggaagagaacatactccctcaccacaccacgccatcagcgg
gtgcctgcccagctgtcctctgcctcgttggatgagtacaccctaatgcgggctgcccac
cacaccaacagcgggcaccactccgggcgcagctccatctccgcctccccaaatgtgtcc
taccccaaatccaatggtaatcaagtaggggatgatggctatatgcctatgatggtgggc
gtggcagcaccgcccaggggcaacaacagcaaggcagatgcttacatgcccatgagcccc
atgtgtgtttcggctcccaagcagatcattaaccccttggcccaaaaccaccggtacgag
gctggcgaccagaccaactcacccagcagcggaggctccttggaggacagtggttacatg
aggatgtggtgcggctccaagtcgtccgttgaaagcccagacagccgctcgacctacatg
aacatgtcccctcgcaacgccgcttacaccacctcgcagacccccccggactacttccta
gaccagcttccgggtcgtgggcctcccatcacacccatctactccacagactccctgcca
cgctccatcaaactccaccaggcttccaaggaggcgggggacactggtgaccagtacgtc
ctgatgagcccgcaaggcaatcagtcgctaggtagggagtcagacgacgactactactca
gtgatgaccaatccggccccgcccaactcctcggtgccctcgcccatcagacagagccgg
gggactgagagcctgacatcccaccgggggagaatggggcgacacaaccggctatctctg
gacagctgtaggatcctacccagcatgaacaagcacctcttgcccggggaacccaggagc
ccgggcgagtatatcaacatagacttcagtgagggcaccaagtactccccgccgtcagca
tccaatgagagccaggagtcgtctctgggctccagcggcggccagccgaggtcccctttc
tccgactacatgaacctgcaccacgtcgtctcacactcacccaaggccggagacacccct
gatcgacggttggacacggtccctgagtcatccctgtgcccttgtccggatggggaggga
gtgtaccgtctcagatcgaagagggattccaagtgcccccagagaggcaaggatgagtac
acagagatgacatttggacttggaatggccaacatgcctccccagttcctccctcagacc
tcaacaagccccagtgccagagagaagaggctatccctgggtgagcagggcctcccgggg
ggcatgggggtgttcctccttggtgcggccacccccgtggatcctgacagggccgccaag
gtgatccgggccgacccccatggccgcaggcggcacagctctgaaaccttctcctctacg
gctaccgtcacccccgtgttcccctcgttcgcccatggggatgccaaacaccacagctcg
gtggagaacctgtcggtgcggagcagcgagagctcagacgaggagtgtggcagccccatg
agtagagagatctctgggggcttccagaatggactgaactatattgccctgaacctgatg
gaggacagggacctggagggaccttgttgcgaagacctgaccacggtcagctttaagccg
gccagcagctgcaagggagccctccatggattacatgtcgcgccgtacgtctgtttgggg
ttcaaggaggcggtcacctctgttaaagactga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112254054
Entry
112254054         CDS       T05605                                 

Definition
(RefSeq) insulin receptor substrate 2-like
  KO
K07187  insulin receptor substrate 2
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04140  Autophagy - animal
otw04910  Insulin signaling pathway
otw04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112254054
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112254054
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112254054
   04920 Adipocytokine signaling pathway
    112254054
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:otw04990]
    112254054
Domain-containing proteins not elsewhere classified [BR:otw04990]
 Phosphotyrosine binding (PTB) domain-containing proteins
  IRS related family proteins
   112254054
SSDB
Motif
Pfam: IRS PH PH_11 Mcp5_PH
Other DBs
NCBI-GeneID: 112254054
NCBI-ProteinID: XP_024282044
LinkDB
Position
7
AA seq 1070 aa
MASPQTNGGHLLSNVTNNIKKCGYLKKQKHGHRRFFVLREPSESFPARLEYYESEKKWKN
KSAAKRVILLDSCLCINKRADSKHKHLIAFYTKDEYFAVAAENEQEQESWFRVLSDLVEE
GKVYDSPASNSTSLFCFEEANYSMITPATAFCREIWQVNLKSRGLGQTKHLTGVFRLCLS
SRTISFVKLNSEVAAVSLQLMNIRRCGHSDSFFFIEVGRSAVTGPGELWMQADDSVVAQN
IHETILEAMKAMKELSESRPRSKSQSASTNPISVPTRRNLNNLPPSQTGLVRRSRTNSIV
ATSPMSKFTSCRIRTASEGDGNMVKPVSMSISMSGSPTSPLSNRNPLSRSNTLSTGRTCR
ILESSLQHSRSMPVSNSPPSVCSSICLSPMSGTLPTPDPVHRPFSCSASISGSLSDASFM
LCNEHSSSPGDTSILLPITRSDTHDSLSSTPPSREANDLCGYMIMDRTNDQRQACQEEDL
TSEKAYRKRTYSLTTPRHQRVPAQLSSASLDEYTLMRAAHHTNSGHHSGRSSISASPNVS
YPKSNGNQVGDDGYMPMMVGVAAPPRGNNSKADAYMPMSPMCVSAPKQIINPLAQNHRYE
AGDQTNSPSSGGSLEDSGYMRMWCGSKSSVESPDSRSTYMNMSPRNAAYTTSQTPPDYFL
DQLPGRGPPITPIYSTDSLPRSIKLHQASKEAGDTGDQYVLMSPQGNQSLGRESDDDYYS
VMTNPAPPNSSVPSPIRQSRGTESLTSHRGRMGRHNRLSLDSCRILPSMNKHLLPGEPRS
PGEYINIDFSEGTKYSPPSASNESQESSLGSSGGQPRSPFSDYMNLHHVVSHSPKAGDTP
DRRLDTVPESSLCPCPDGEGVYRLRSKRDSKCPQRGKDEYTEMTFGLGMANMPPQFLPQT
STSPSAREKRLSLGEQGLPGGMGVFLLGAATPVDPDRAAKVIRADPHGRRRHSSETFSST
ATVTPVFPSFAHGDAKHHSSVENLSVRSSESSDEECGSPMSREISGGFQNGLNYIALNLM
EDRDLEGPCCEDLTTVSFKPASSCKGALHGLHVAPYVCLGFKEAVTSVKD
NT seq 3213 nt   +upstreamnt  +downstreamnt
atggcgagtcctcaaactaatggaggacacttgttgtctaatgtgaccaataacattaag
aaatgtggatatctaaagaaacagaagcatggacacagacgttttttcgtgttgagagaa
cccagcgagagctttcctgcccgcctggaatactacgagagcgagaagaagtggaaaaac
aagtcggctgctaaaagggtgatactgctggactcctgtctttgcataaacaagcgagcg
gactccaagcacaaacatctcatcgccttttacaccaaggacgaatactttgcagtggca
gccgaaaacgagcaggagcaggagagctggtttcgagtgttgtcggatttggtcgaagag
gggaaagtctatgacagccccgcgtctaattccacctctcttttctgttttgaggaggcg
aattacagtatgatcacgccggccactgccttttgcagggagatttggcaagtgaatttg
aaatccagaggactgggtcaaacaaaacatttgacaggggtgtttaggctgtgtttatcc
agtcggactatcagctttgtgaaactgaactcggaggttgcagctgtcagtttacagctc
atgaatatccggagatgtggccactccgacagctttttcttcatcgaggttggtaggtcg
gctgtcactggccctggtgagctctggatgcaggcggatgattcggtggttgcgcaaaac
atccacgagaccatcctggaggcgatgaaagccatgaaagagctgtcagaatcaagacca
cgcagcaagagtcagtcggctagcaccaaccccatttccgtgcccacaagacgcaacttg
aacaatctgcctccaagtcagacagggttggtgaggaggtcgagaacaaacagcatagtg
gccacatccccaatgagcaagttcacatcctgtcggataaggacagctagtgagggggat
ggcaacatggtcaagccagtgtctatgtcaatatctatgagcgggagccccaccagtccc
ctctccaaccggaaccctctgagcaggtccaatacgctctccactgggcgcacctgccgg
atactggagtccagcctccagcacagccgctccatgcccgtctccaactcccctccctca
gtctgcagttccatctgcctctcccccatgagcgggaccctccccacccctgatccggtc
caccgccccttcagctgcagcgcctctatctcaggctccctcagcgacgcaagcttcatg
ctatgcaatgagcacagctccagcccaggcgacacctccattctcctacccatcactagg
agtgacacccacgactccctctccagcactcctccctcccgggaggccaacgatctgtgt
ggctacatgattatggacaggaccaatgaccaacggcaggcgtgccaggaggaggacttg
acatcggagaaggcgtacaggaagagaacatactccctcaccacaccacgccatcagcgg
gtgcctgcccagctgtcctctgcctcgttggatgagtacaccctaatgcgggctgcccac
cacaccaacagcgggcaccactccgggcgcagctccatctccgcctccccaaatgtgtcc
taccccaaatccaatggtaatcaagtaggggatgatggctatatgcctatgatggtgggc
gtggcagcaccgcccaggggcaacaacagcaaggcagatgcttacatgcccatgagcccc
atgtgtgtttcggctcccaagcagatcattaaccccttggcccaaaaccaccggtacgag
gctggcgaccagaccaactcacccagcagcggaggctccttggaggacagtggttacatg
aggatgtggtgcggctccaagtcgtccgttgaaagcccagacagccgctcgacctacatg
aacatgtcccctcgcaacgccgcttacaccacctcgcagacccccccggactacttccta
gaccagcttccgggtcgtgggcctcccatcacacccatctactccacagactccctgcca
cgctccatcaaactccaccaggcttccaaggaggcgggggacactggtgaccagtacgtc
ctgatgagcccgcaaggcaatcagtcgctaggtagggagtcagacgacgactactactca
gtgatgaccaatccggccccgcccaactcctcggtgccctcgcccatcagacagagccgg
gggactgagagcctgacatcccaccgggggagaatggggcgacacaaccggctatctctg
gacagctgtaggatcctacccagcatgaacaagcacctcttgcccggggaacccaggagc
ccgggcgagtatatcaacatagacttcagtgagggcaccaagtactccccgccgtcagca
tccaatgagagccaggagtcgtctctgggctccagcggcggccagccgaggtcccctttc
tccgactacatgaacctgcaccacgtcgtctcacactcacccaaggccggagacacccct
gatcgacggttggacacggtccctgagtcatccctgtgcccttgtccggatggggaggga
gtgtaccgtctcagatcgaagagggattccaagtgcccccagagaggcaaggatgagtac
acagagatgacatttggacttggaatggccaacatgcctccccagttcctccctcagacc
tcaacaagccccagtgccagagagaagaggctatccctgggtgagcagggcctcccgggg
ggcatgggggtgttcctccttggtgcggccacccccgtggatcctgacagggccgccaag
gtgatccgggccgacccccatggccgcaggcggcacagctctgaaaccttctcctctacg
gctaccgtcacccccgtgttcccctcgttcgcccatggggatgccaaacaccacagctcg
gtggagaacctgtcggtgcggagcagcgagagctcagacgaggagtgtggcagccccatg
agtagagagatctctgggggcttccagaatggactgaactatattgccctgaacctgatg
gaggacagggacctggagggaccttgttgcgaagacctgaccacggtcagctttaagccg
gccagcagctgcaagggagccctccatggattacatgtcgcgccgtacgtctgtttgggg
ttcaaggaggcggtcacctctgttaaagactga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112257780
Entry
112257780         CDS       T05605                                 

Definition
(RefSeq) insulin receptor substrate 1-B-like
  KO
K16172  insulin receptor substrate 1
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04140  Autophagy - animal
otw04150  mTOR signaling pathway
otw04910  Insulin signaling pathway
otw04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112257780
   04150 mTOR signaling pathway
    112257780
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112257780
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112257780
   04920 Adipocytokine signaling pathway
    112257780
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:otw04990]
    112257780
Domain-containing proteins not elsewhere classified [BR:otw04990]
 Phosphotyrosine binding (PTB) domain-containing proteins
  IRS related family proteins
   112257780
SSDB
Motif
Pfam: IRS PH PH_11
Other DBs
NCBI-GeneID: 112257780
NCBI-ProteinID: XP_024287383
LinkDB
Position
9
AA seq 1223 aa
MENEAAELLQQQQSYEDVRKSGYLRKQKSMHRRFFVLREATEQGPARLEYYENEKKFQSK
SPVPKKALDLETCFNINKRADSKNKHMIVMYTRGESFAIAADNEEVQNEWYQAMLDLQWK
CKSPENCGSGGECGLPSPPGPAFKEVWQVKVWPKGLGQARNLVGIYRLCLTDKTVNFVKL
NSDMATVVLQLMNVRRCGHSENFFFIEVGRSAMTGPGEFWMQVEDSVVAQNMHETLLEAM
KALSEEFRQRSKSQSVGATAGGGTASNPISVPTRRHHPNLPPSQVGFGRRSRTETPGAGG
ASCTSTSPTPRNGFPRARTASIGGRMEEGGGGPRGAWASSSPSLNGSCSTTPTLRPKPTR
APTPAKITLSLARYTPNPATSPAPSLSSSSGHGSECGLVGGAMGXVAICSYTRVPQRVSV
SGSPSDYGSSDEYGSSPGEHSLLVPSLPGGSXGGMGHXAHGEXSSSYIVMGQRESLPGSH
QRPQGRRMLRRSSSRECEAERRLLSKRASLPLAAHERLAPRRKEEEDEDEEYTVMSQSIS
RDAFVSQRGSGGSAAGGSAVAVVVGETRARADGVRGEVGGGGGAPVDSGYMAMLPGVTAS
PVSLSLSVAVSDVGAKPGTDDEYMAMTPNNSVSPPQHICLPVSEGYMVMSPNSSCSPDLH
GMAMWGSRGSMESRAGSDYMNMSPISIRSACSTPPSQPEQNQLQPKMVYSYFSLPRSYKH
TLSTRFEDDLDQGKRKEGGHHDHDGPGNRGGQVGYSKRDTATVGPAGGCQLSLSSSSFSS
SSASSESLDDRPKSVATGGGLRLTRTGTGFRNGGFRNGGARLKDGSYQQKRASHGPGGQQ
MKPRPLSVSVDMSKANTLPRVKENLLPTVPQSPGDYVSIVFRGGDMGCRRRDQWGPEHGL
SVIHGTQRPLDRPALCHSGATNLPRSFSVPLATSAASAEYVNMDLGMGKSPCPCPRSPVK
SPFSLPPAIAPKPRVLARSRPSPRAAEGNVGGHRAAVPTDLPTSYTDYTEMAFSMGSGPN
PAAPAMHAAQRTSMEQEPGLVFPSEKSYSSPAQKQSSRLARDRVDRGDQLGRRRHRSETF
IMTPPSLPFHLSPSGSLFLEIAQAASPHRHGGLEGGSPWENAQAAMSQCAIPAAPAAQAS
SSGSAEQGLNYIDLDLAIKDSSQTGLEGGATVPHIVFTSVHSGVVGGGMTGLGNNPGYAS
IDFCKSEELRAHHQSSRKDVKEC
NT seq 3672 nt   +upstreamnt  +downstreamnt
atggagaacgaggctgcggagctgctacagcagcagcagagctacgaggacgttcggaaa
agcgggtatctccgcaagcagaaatctatgcaccggcgattcttcgttttgagagaagcc
acggaacagggccctgcccgtctagaatattatgagaatgagaagaaattccaaagcaag
tcacctgtcccgaaaaaagcgctggatctggagacttgcttcaacatcaacaagcgggcg
gattccaagaacaagcacatgatagtgatgtatacccgcggggagagctttgccattgca
gcagacaatgaggaggtccagaatgaatggtaccaggccatgctggaccttcagtggaaa
tgtaaaagcccagagaattgtggcagtggtggggagtgtggactcccctctcctccaggc
ccagcttttaaggaggtgtggcaggtcaaggtgtggcctaaagggcttggccaggccaga
aacctagtgggcatctaccggctgtgcctgaccgacaagacggtcaacttcgtcaagctc
aactctgacatggccaccgtggtcctacagctgatgaatgtgcgtcgctgtggccactct
gagaacttcttcttcatcgaagtgggccgctcggccatgacggggcctggggagttctgg
atgcaggtggaggactcggtggtggcccagaacatgcatgagaccctactggaggccatg
aaggctctgagcgaggagttccgccagcgcagtaagtcccagtctgtgggagctacagct
ggaggtggcaccgcctccaaccccatcagtgtccccacccgccgccaccaccccaaccta
ccccccagccaggtgggcttcggcagacgatcccggaccgagacccctggagcaggtggg
gccagctgcaccagcacttcacccacaccacgcaacggattccccagggcacgtacagcc
agcatcgggggaaggatggaggagggtggaggtggacccaggggggcatgggcaagttcc
agtcccagcctgaatggatcctgttccactacacccaccctgagacccaagcccaccaga
gctccaaccccagctaagatcactctcagcctggcccgctacacccccaacccagccacc
tccccagccccaagcctctcctccagctctggtcatggctcagagtgtggactagtygga
ggggcaatgggaartgtagcsatytgytcttacacccgygtccctcaragagtmtctgtg
tcgggytcccctagtgactayggctcctcagacgagtatggctccagccctggagagcac
tccctrctwgtccccagtctrccwggagggtccmatggkggratgggacacmatgctcat
ggagagrgctcttccagctacatagtgatgggccagagagagagcctccctgggtcccat
cagcgtcctcagggccgcaggatgctgcggcgctcctccagcagggagtgtgaggcagag
cgcagactcctcagcaagagggcctccctgcccctggctgcgcacgaacgcctggcccct
cgtaggaaggaggaagaggatgaggacgaagagtacactgtcatgtcgcagagtattagc
agggatgcctttgtgtcacaacgtggatcagggggctcggcagcagggggctcggcagtg
gcagtcgtggttggggagacccgggcgagggctgatggggtccgaggagaggtgggagga
ggaggaggggcaccagtggacagtggctacatggccatgttacccggagtgacagcttct
cctgtttccctctctctatctgtggccgtgtctgacgtcggtgccaaacctgggactgat
gatgagtacatggccatgactcccaacaatagtgtgtctcccccccagcacatctgcctg
cctgtctcagagggctacatggtcatgtcccccaatagcagctgctccccagacttgcat
ggaatggccatgtgggggagcaggggcagcatggagagccgagctggcagtgactacatg
aacatgtctcctatcagcatccgctcagcttgcagcacacccccctcccaacctgaacag
aaccagttacaacccaagatggtctactcctacttctctctgccacgatcctacaaacac
acactctctacacgcttcgaagatgacttagatcaagggaaaagaaaggaggggggtcat
cacgaccatgacggtcctggaaatcggggtggacaagtgggctacagcaagagggacaca
gccacagttggccctgcaggaggctgtcaactctccctctcctcttcctccttctcttcc
agctcagctagcagtgagagcctggatgataggcccaaatcagtggcaacagggggaggg
ctacgactaacaagaacagggacagggttcaggaatggcgggttcaggaatgggggagca
cgcttaaaggacggatcctaccagcaaaaacgtgcatcgcatggcccagggggacagcag
atgaagcctcgtcccctcagtgtgtcggtggacatgtctaaagctaacactttgccaagg
gttaaggagaatctccttcccacagtgcctcagagccctggggattatgtcagcatagtg
ttcaggggtggtgacatggggtgcaggagaagagaccagtgggggccagagcatggactg
tcagtgatccatggaacccagaggcccctggaccgtccagccctctgccacagtggcgcc
accaacctcccccgcagcttctctgtacctctggccacctccgctgcctctgctgagtac
gtcaacatggacttggggatggggaagtctccttgcccatgcccccggagccctgttaaa
tcacctttcagcctgcccccagccatcgccccgaagccccgagttttggcccgtagtagg
ccctctcctagggcagcagagggcaatgtaggtgggcatagggcggcagtgccaacagac
ttacccacatcatatacagactacacagagatggccttcagcatgggttcagggcctaac
cctgcagcgcctgccatgcacgctgcccaaagaacatcaatggagcaggaaccaggcttg
gtctttccctcagaaaagtcctattcatctcctgcccagaagcaaagcagcaggctggcg
agagacagggttgacaggggcgaccaactgggacggagacgccaccgctctgagaccttc
attatgactcctccctctctccccttccacctatccccatcaggctccttgttcttggag
attgcccaggcagcatcgcctcatcggcacggagggctggaggggggttcaccgtgggag
aatgcacaggcagctatgtctcaatgtgccattcctgctgcacccgcagcccaggcttca
tcctctgggtctgctgaacaaggccttaactatattgatctggacctggccattaaggac
agctctcagactggactggaggggggagccaccgtcccccacatcgtcttcacatccgtc
cacagtggggtagttgggggaggcatgactggtttggggaacaaccctggctatgccagt
attgatttctgcaaatcagaggagttgagagcacatcatcagagcagcaggaaagatgta
aaagaatgttaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112259956
Entry
112259956         CDS       T05605                                 

Definition
(RefSeq) insulin receptor substrate 1-B-like isoform X1
  KO
K16172  insulin receptor substrate 1
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04140  Autophagy - animal
otw04150  mTOR signaling pathway
otw04910  Insulin signaling pathway
otw04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112259956
   04150 mTOR signaling pathway
    112259956
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112259956
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112259956
   04920 Adipocytokine signaling pathway
    112259956
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:otw04990]
    112259956
Domain-containing proteins not elsewhere classified [BR:otw04990]
 Phosphotyrosine binding (PTB) domain-containing proteins
  IRS related family proteins
   112259956
SSDB
Motif
Pfam: IRS PH PH_11 PH_8
Other DBs
NCBI-GeneID: 112259956
NCBI-ProteinID: XP_024290425
LinkDB
Position
10
AA seq 1284 aa
MESQPPEPQIYEDVRKSGYLRKQKSMHRRYFVLRTASERGPARLEYYESEKKFRGKTPVP
KKALVLETCFNINKRADAKNKHMLVLYTRAESFAIAAENEADQDEWYQAMVELQCKSKVA
STDTGPGGDYGVPTPGPAFKEVWQVKVWPKGLGQAKNLVGVYRLCLTEKTVNFVKLNSDA
AAVVLQLMNVRRCGHSENFFFVEVGRSAVTGPGEFWMQVDDSVVAQNMHETLLEAMKALS
EEFRQRSKSQSNSGPGGGATASNPISVPSRRHHPNPPPSQVGFTRRPRTEPPGGAGTGGN
SANASPTPRHSFPRSRTASDGSKGEEGVGGACGGVGQSSSLTTNGSCSTTPILRSKSARS
APTLAKNNPMGLMRSVSTPSPSPAPSLSSSSGHGSEFGIVVGATGGGGGGAGASAYSRVP
SHNASVSGSPSDYGSSDEYGSSPGEQSSHSLLAPFPNMPGGSAGSGGHGQPLDDEAANYT
LMGQRGGGATSSGCLPAGASSSAPSHQAQTKRVLRRSSSRECEAERGLLSKRASLPPMAL
ERLAPRPRRGEEEQDEDAADYAIMSRSTSRESFTTSSSSRRDSEISPGGEGGGGGYLDVA
GELGGGGGVVRDNGYMSMLPGGVTQPPVNLTNSLSASVADESKLADDYMAMTPNNSVSPP
QQIRPPPGDGYMMMSPNSSCSPDQRGGLAGGAWVGSSSADSRAGSDYMNMSPISARSANS
SPPPPEHTPQTDPHPLQQAPQTDPHPLQQAPKMVYSYYSLPRSYKHTPPGGHFEDGRGRR
PNGSGGGRGVGRAVGGRQDPNLGAVQGRHLSLSSSSYSSSSASSESLGENEDRSSQGAGP
SGGGAHSKDIGLLQQRRAAPKQGQQGGARTRPVSLFVDVSKANTLPRVRENPLPPEPKSP
GEYVSIQFRGGPGGAEGRGLRHGMSLPRGSSQRPSHQPTSCLGGFLPLSRSPSAPLTPLT
PPSASEYVNMDLGPSPSPSPLSLTPLGFPSFPTPPTPPPIALAPKAHGVLRVSPQQQGEP
EGAEAGPRINKQTTRVVVTQSESPTSCGDYTEMAFSLNNNSIASSMSNNTSSKAPSPASP
KPPVPVLTLGLDFPLAKTGPNPDHGAKVIRADAQGRRRHCSETFLPSPSLPPQSSNSSSV
ASLFPEHAQAVARRLGLEGVLWGNGASAEHLPSQFLHPGPGLPSAQTSSMEQGLNYIDLD
LANKENPHAALDGSSTVQANPLRLYSSMLTGGAGVVVSGAGVGGSVGSNLNTYASIDFYK
SEELRTHQNGNKDGTGSADIAKNI
NT seq 3855 nt   +upstreamnt  +downstreamnt
atggagagccaaccacccgagccgcaaatctacgaggacgtccgaaagagcggctatctc
cgcaagcagaaatccatgcaccggcgatacttcgtgctccggacggcctcggagaggggc
ccggcccggctcgaatactacgagagcgagaagaaattcagaggaaagacacccgtcccc
aagaaagccctggtgctggagacgtgtttcaacatcaataagcgggctgatgccaagaac
aagcacatgctagtgctgtacactcgggcggagagctttgccatcgcggcagaaaacgag
gcggaccaggacgaatggtatcaggccatggtggagctgcaatgcaaaagtaaggtggct
agtaccgacaccggtccgggaggggactacggtgtacccaccccaggccccgccttcaag
gaggtgtggcaggtcaaggtgtggccaaaggggctgggccaggccaagaacctggtgggc
gtctaccggctgtgcctgactgagaagacagtcaacttcgtcaagcttaattcagacgcc
gcagccgtggtcctgcaactgatgaatgtgaggcgctgcggtcactccgagaacttcttc
ttcgtggaggttggtcgttccgcggtcacgggccccggggagttctggatgcaggtggat
gactctgtggtggcccagaacatgcatgagaccctgctggaagccatgaaggccttgagc
gaggagttccgccaacgcagcaagtcgcaatccaactccggaccaggagggggcgctaca
gcctccaaccccatcagcgtcccctcgcgacgccaccaccccaacccgccccccagccag
gtgggcttcacccgcaggccccgcactgagccgcctggaggggctggaactgggggcaac
agtgccaatgcatcgcccactccccgccacagcttccccaggtcacgcacagccagcgac
gggagtaaaggtgaagaaggtgtgggtggagcgtgtggaggggtagggcagagttccagt
cttactaccaacgggtcctgctccaccacgcccatcctcaggtccaaatcggcccgctcg
gcccccaccctggctaagaacaaccccatgggcctgatgcgctctgtctccaccccatcc
ccctccccggcccccagcctctcctccagctccggccacggctccgagtttgggatagtg
gtgggtgcgaccggaggagggggtggtggagcaggggccagtgcatacagccgcgtcccc
tcgcacaacgcttccgtgtcgggctcccccagcgactatggctcctcggacgagtacggc
tccagccctggggagcaatcctcccactccctcctggcccccttccccaacatgcctgga
gggtcagccgggtcgggcggccacggtcaacccctggacgatgaggctgctaactacacc
ctaatgggtcagcgtggtggtggagccacgtcatctggctgtctgcctgctggtgcatcc
agctcagccccttcccaccaggcccagaccaagagggtcttgcgtcgctcctccagccgg
gaatgtgaggctgagagggggctgctgagcaagcgggcgtccctgccccccatggcactg
gagcgcctggccccacggccccgcaggggggaggaggagcaggacgaggatgcggccgac
tacgccatcatgtcacgaagcaccagcagggagtccttcaccacctcctcctcttcacgg
agagattctgaaataagccctggtggagaggggggaggaggggggtacctggatgtggct
ggagagttgggtggaggtggaggtgtagtgcgggataatggctacatgtccatgctcccg
ggaggagtgacccaaccccctgtcaacctcaccaactctctttccgcctcggttgctgac
gagtccaagctggcggacgactacatggccatgacacccaacaacagcgtatcaccgcca
caacagatccggccccctcccggagacggctacatgatgatgtcacccaacagcagctgc
tctccggaccagcgtggtggcctggcaggcggggcctgggtgggcagcagcagcgcggac
agccgggcgggcagcgactacatgaacatgtcccccatcagcgcccgctcggccaacagc
agcccccctccccccgagcacacccctcagacagacccccatccccttcagcaggcccct
cagacagacccccatccccttcagcaggctcccaagatggtctactcctactactcactg
ccccgctcctataaacacacaccacctggtggacactttgaggacggccgaggaaggagg
cccaatgggagcggtggtggtagaggggttggcagggcagtgggtggtcgtcaggacccc
aatttgggtgcggtccaaggtcgccacctgtccctctcctcgtcctcatactcctccagc
tcggccagcagtgagagcctaggggagaatgaggacaggtcttcccagggagcaggcccc
tcaggtgggggagctcactctaaagacatagggctcctccagcagagacgggcggccccc
aagcagggccagcaagggggggccaggacccggccggtcagcctgtttgtggacgtttcc
aaagccaacaccctccccagggtccgtgagaaccccctccccccggagcccaagagccca
ggggagtatgtgagcatccagttcagaggagggccaggaggtgcggaagggaggggactc
agacatgggatgtccctccctcgcggttccagccagcgcccctcacaccagcccacgtcc
tgcctgggggggttcctgcccctctcccgcagcccctctgcccccctgacacccctcacc
ccaccatcagcctctgagtatgtcaacatggacctggggccctctccgtccccctcgccc
ctctccctgacaccgctgggcttcccttccttccccacccctcctacgccccctcccata
gccctggcacccaaggcccacggtgtgctcagggtgtcccctcagcagcaaggggaaccc
gagggggctgaagcagggcccaggataaacaaacagactacccgcgttgtggtgactcaa
tcagaatccccaacctcctgcggggactatacagagatggccttcagcctgaacaacaac
agcattgccagctccatgtccaacaacacctcctccaaagccccctccccagccagcccc
aagccaccagtccctgtcctcaccttgggcctggacttccccctggccaaaaccgggccc
aacccggaccacggcgctaaagtgatccgggccgacgcccagggccgcagacgccactgc
tccgaaaccttcctcccctccccctctctccctccccaatcctccaactcttcctctgtc
gcctccctcttcccggagcacgcccaggctgtggctcgccgtctggggttggagggcgtg
ctgtggggaaacggagcatcagccgagcatctcccctcgcagttcctccatcctgggcct
ggcctgccctctgcccagacttcatccatggagcaaggcctcaactacatagacttggac
ttggctaacaaagagaaccctcatgcagccctagacgggtcttcaaccgtccaggccaac
ccccttcgcctctactcgtccatgttgactgggggggctggggtggtggtgtccggggct
ggagtggggggcagtgtaggctccaacctcaacacctatgccagcatcgacttctacaag
tcagaggagttgcgaacgcatcagaacggaaacaaggatggtacaggttctgcagacata
gcaaagaacatctga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112266609
Entry
112266609         CDS       T05605                                 

Definition
(RefSeq) insulin receptor substrate 2-like
  KO
K07187  insulin receptor substrate 2
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04140  Autophagy - animal
otw04910  Insulin signaling pathway
otw04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112266609
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112266609
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112266609
   04920 Adipocytokine signaling pathway
    112266609
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:otw04990]
    112266609
Domain-containing proteins not elsewhere classified [BR:otw04990]
 Phosphotyrosine binding (PTB) domain-containing proteins
  IRS related family proteins
   112266609
SSDB
Motif
Pfam: IRS PH PH_11 Mcp5_PH
Other DBs
NCBI-GeneID: 112266609
NCBI-ProteinID: XP_024300004
LinkDB
Position
14
AA seq 1049 aa
MASPPTSGGQMLSNVTNNSNNVKKCGYLKKQKHGHRRFFVLREPSESFPARLEYYESEKK
WKNKSAAKRVILLDSCLCINKRADSKHKHLIAFYTKDEYFAVAAENKQEQESWFRVLSDM
IEEGKVYDSPASNSTSLFSFEEANYGMITPTTAFYKEVWQVNLKSRGLGQTKHLIGVFRL
CLSSRTISFVKLNSEVAAVSLQLMNIRRCGHSDSFFFIEVGRSAVTGPGELWMQADDSVV
AQNIHETILEAMKAMKELSEFRPRSKSQSARTNPISVPTRRNLNNLPPSQTGLVRRSRTN
SIVATSPMSKFTSCRIRTANGGDGSMVRPVSMSISMSGSPTSPLSNRIPLSRSPSSPAGA
LPDTESSLQHSRSLPVSTPPPPGCISICLSPMSGTLPTPDAVHRPFSCSASISGSLSDAS
FMLCDENSSSPGDTSRLLPLTRSDTHDSLSSTPSSWEANDLCGYMIMDRTNDQQRACQEE
GLTLEKAYRKRTYSLTTPRQQRVPAQLSSASLDEYTLLWAAHHTNSEHHSRNSSISASPK
VSYPESNRNNSKADAYMPMSPMCVSAPKQIINPWAQIHQDGGGYRTNSPSSGGSLEDSGY
MRMWCSSKSSIESPDSRSTYMNMSPSNAAYTTSQTPPDYFLEQLPGGEPSIYSADSLPRP
TKLHQTSKEVGNTDHQYVLMSPQGHQSLGGESDDYYSVMTNAATLNSSVPSAIRQSRGTE
SLTSHRGRMGRPNRLSLDSFRILPSMNEHLLPGEPRSPGEYINIDFSESTKYSSLSASNE
SQELSLGSIGSQPRSPLSDYMNLHHIVSHSPKARDTPAGRLDTVPESSLCPCLDGEAVYH
LRSKRESKCPQRGKDEYTEMTFGLGMANMPPQFVPQTSASPSAREKSLSLGEQGLPVGIG
VFLLGAVNPVDPDRAAKVIRADPNGRRRHSSETFSSTATVTPVFPSFAHGNAKRHSSVEN
LSMRSSEGSDEECDSPMSRETSAGFQNGLNYIALNLMENWDRDLEGPCCEDLPTVSFKPA
TSCKGALHGLHVTPYVCLGFKEAATTVKD
NT seq 3150 nt   +upstreamnt  +downstreamnt
atggcgagtcctcctacgagtggaggacagatgttgtctaatgtgaccaataacagtaat
aacgttaagaaatgtggatatctaaagaaacagaagcatggacacagacgttttttcgtg
ttgcgagaacccagcgagagctttcctgcccgtctggaatactacgagagcgagaagaag
tggaaaaataagtcggctgctaaaagggtgatactgctggactcatgtctttgcataaac
aagcgagctgactctaagcacaaacacctcatcgccttttacaccaaggacgaatacttt
gcagtggcagccgaaaacaagcaggagcaggagagctggtttcgagtgttgtcggatatg
atcgaagaggggaaagtctatgacagccccgcgtctaattccacctctcttttcagtttc
gaggaggcgaattacggtatgatcacgccaaccactgccttttacaaggaggtatggcaa
gttaatttgaaatccagaggactgggtcaaacaaaacatttgataggggtgtttaggctg
tgtttatccagtcggactatcagctttgtgaaactgaactcggaggttgcagctgtcagt
ttacagctcatgaatatccggagatgtggccactctgacagctttttcttcatcgaggtt
ggtaggtcggctgtcacaggccccggtgagctctggatgcaggctgacgactcggtggtt
gcacaaaacatccacgaaaccatcctggaggcaatgaaagccatgaaagagctgtccgaa
ttcagacctcgcagtaagagtcagtcggctagaaccaaccccatttcagtgcccacaaga
cgcaacttgaacaatcttcccccaagtcagacagggttagtgaggaggtcgagaacaaac
agcatagtggccacatctccaatgagcaagttcacatcctgtcggataaggactgctaat
gggggggatggcagcatggtcaggccagtgtctatgtcaatatctatgagcgggagtccc
accagtcccctctccaaccggatccccctgagccggtcaccatcatctccagcgggcgca
ttgccagatactgagtccagcctccagcacagccgctccttgcccgtctccacccccccc
cccccaggttgcatttccatctgcctctctcccatgagtgggaccctccccacccctgat
gcggtccaccgccccttcagctgcagtgcctccatctcaggttccctcagtgacgcaagc
ttcatgctatgcgacgagaacagctccagcccaggcgacacctccaggctcctacccctc
accaggagtgacacccacgactccctctccagcactccctcctcctgggaggccaacgac
ctgtgtggctacatgattatggacaggacgaatgaccaacagcgggcgtgccaggaggag
ggcctgacattggagaaggcgtacaggaagaggacatactctctcaccacaccacgccaa
cagagggtgcccgcccagctgtcgtctgcctcgttggatgagtacaccctattgtgggct
gcccaccacaccaacagtgagcaccactccagaaacagctccatctctgcctccccaaag
gtgtcctaccccgaatccaacagaaacaacagcaaggcagacgcttacatgcccatgagc
cccatgtgtgtctcggctcccaagcagatcatcaatccctgggcccaaatccaccaggac
gggggcggctaccggaccaactcacccagcagcggaggctccttggaggacagtggctac
atgaggatgtggtgcagctccaagtcgtccattgaaagccctgacagccgctcgacctac
atgaacatgtcccctagcaacgctgcttacaccacctcgcagacccccccagactacttc
ctggagcagcttccgggtggtgagccttccatctactctgccgactccctgccacgcccc
accaaactccaccagacttccaaggaggtggggaacactgatcaccagtacgtcctgatg
agccctcaaggccatcagtcgctaggtggggagtcagatgactactactcagtgatgacc
aatgcggccacgctcaactcctcggtgccctcggccatcagacagagccgggggactgag
agcctgacgtcccaccgggggaggatggggcgacccaaccggctgtctctcgacagcttt
aggatcctgcccagcatgaacgagcacctcttgcccggggaacccaggagcccgggtgag
tatatcaacatagacttcagtgagagcaccaagtactcctcgctgtcagcatccaatgag
agccaggagttgtctctgggctccatcggcagccagccgaggtcccctctctccgactac
atgaacctgcaccacatcgtctcgcactcacccaaggccagagacacccctgctggacgg
ttggacacggtccctgagtcatccctgtgcccttgtctggatggggaggcagtgtaccat
ctccgatcgaagagggaatccaagtgcccccagagaggcaaggatgagtacaccgagatg
acatttggacttggaatggccaacatgcctccccagttcgtccctcagacctcagcaagc
cccagtgccagagagaagagtctatccctgggtgagcagggcctccctgtcggcattggg
gtgttcctccttggcgccgtcaaccccgtggatcctgacagggccgctaaggtgatccgg
gccgaccccaatgggcgcaggcggcacagctccgaaaccttctcctctacggctaccgtc
acccctgtgttcccctcgttcgcccatgggaatgccaaacgccatagctcggtggagaac
ctgtcgatgcggagcagcgagggctcagacgaggagtgtgacagccccatgagtagagag
acctctgcaggcttccagaatggactgaactatattgccctgaacctaatggagaactgg
gacagggacctggagggaccttgttgcgaagacctgcccacggtcagctttaagccggcc
accagctgcaagggagccctccatggattacacgtcacgccgtacgtctgtttggggttc
aaggaggcggcaaccactgtcaaagactga

DBGET integrated database retrieval system