KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112214536
Entry
112214536         CDS       T05605                                 

Definition
(RefSeq) plasminogen activator inhibitor 1-like
  KO
K03982  plasminogen activator inhibitor 1
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04115  p53 signaling pathway
otw04218  Cellular senescence
otw04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    112214536
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    112214536
   04218 Cellular senescence
    112214536
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:otw01002]
    112214536
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112214536
   00536 Glycosaminoglycan binding proteins [BR:otw00536]
    112214536
Peptidases and inhibitors [BR:otw01002]
 Peptidase inhibitors
  Family I4: serpin family
   112214536
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   112214536
Glycosaminoglycan binding proteins [BR:otw00536]
 Heparan sulfate / Heparin
  Coagulation and fibrinolysis
   112214536
SSDB
Motif
Pfam: Serpin
Other DBs
NCBI-GeneID: 112214536
NCBI-ProteinID: XP_024229117
LinkDB
Position
15
AA seq 388 aa
MLCLYVCFLLSLSGAALSNLQEKQTDFGMRVFCHVAQTSRGSNLAFSPYGVATILGMAQL
GAGGNTRKTLNAKLGFSLQERGMSRQQRLLQQNLSSEEGVELASGIMVEKKMALEKGFRR
GLVKAFQVSPHQLDFSRPDQALEFINAWVSDHTAGTIPSFLSSGALTDETRIVLLNALHF
QGLWKVPFDPKMTEERLFHCANGSSVPVPMMRLTHHFNYGEFVTPDGVDYDVIEVPYEGE
SLSMLLVTPFESERPVSVLSSELTTRRLQQWREELRSVKRQLALPKFTLDTEVDLKSTLT
SMGLGDMFNLAKADFTRITTEERLCVSKVLQKVKIEVNEKGTKGSSATAAIMFSRMAIEE
ITLDRPFLFLIQHKSTGAVLFMGQVNQP
NT seq 1167 nt   +upstreamnt  +downstreamnt
atgctgtgcctgtacgtgtgcttcctcctcagcctctctggagcggccctctctaacctc
caggagaaacagacagactttgggatgcgggtcttctgtcatgtggcccagacctccagg
ggctctaacttggccttctcaccctacggcgtggccaccatcctgggcatggctcagctg
ggcgctgggggcaacacccggaagacactcaacgccaaattgggcttctctctacaagag
cgagggatgtcacgtcagcagcgtctgctacagcagaacctctccagtgaggagggagtg
gagctggccagtggcatcatggtagagaagaagatggctctggagaaaggcttcaggagg
gggctggtgaaagccttccaggtctcccctcaccaattggacttctccaggccagaccag
gccctggaattcatcaatgcctgggtctctgaccacaccgcaggtaccatcccttcattc
ctgtcgtccggtgctctgactgacgagactcgcatagtcctactgaacgctctgcacttc
caggggttatggaaggtgccctttgaccccaagatgaccgaggagaggctgttccattgt
gccaatggcagctctgtgcccgtacctatgatgaggctcacacaccacttcaactacggt
gagttcgtgacccccgatggtgtggactatgatgtcatcgaggttccgtacgagggagaa
tccctgagcatgctgctggtcacccccttcgagtccgagaggccagtgagcgtgctcagt
agcgagctgaccaccagacgcctgcaacagtggagagaggagctgaggagcgtcaagcgt
caactggctctgcccaagtttaccctggacactgaggtggatctgaagtctacactgacc
agcatggggttgggggacatgttcaacctggccaaagcagacttcactcgcatcaccact
gaggaaaggctgtgtgtgtccaaggttctgcagaaagtcaagattgaggtgaacgagaag
ggaaccaagggatcatctgccacagctgccattatgttctctcgtatggctatagaggag
atcaccctggacaggcccttccttttcctcatccaacacaagtccacaggtgctgtactg
ttcatgggtcaagtcaaccaaccctag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112259747
Entry
112259747         CDS       T05605                                 

Definition
(RefSeq) plasminogen activator inhibitor 1-like
  KO
K03982  plasminogen activator inhibitor 1
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04115  p53 signaling pathway
otw04218  Cellular senescence
otw04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    112259747
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    112259747
   04218 Cellular senescence
    112259747
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:otw01002]
    112259747
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112259747
   00536 Glycosaminoglycan binding proteins [BR:otw00536]
    112259747
Peptidases and inhibitors [BR:otw01002]
 Peptidase inhibitors
  Family I4: serpin family
   112259747
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   112259747
Glycosaminoglycan binding proteins [BR:otw00536]
 Heparan sulfate / Heparin
  Coagulation and fibrinolysis
   112259747
SSDB
Motif
Pfam: Serpin
Other DBs
NCBI-GeneID: 112259747
NCBI-ProteinID: XP_024290142
LinkDB
Position
10
AA seq 391 aa
MLCLYVWFFLGLSGAAISNLQEKQTDFGMRVFSQVAQNSKGSNLAFSPYGVATILAMAQL
GAGGNTLKTLNAKLGFSLQERGMARQQRLLQRDISSEEGVELASGVMVERKMALEKGFRR
GLGKAFQASPHQLDFSRPDQALDIINAWVSDHTAGTIPSFLSSGALTDETRMVLLNALHF
QGLWKVPFDPKMTEERLFHCANGSSVPVPMMRLTHRFKYGEFVTPDGVDYDVIEVPYEGE
SLSMLLVSPFEPEMPVSSLSSELTTQRLQQWRQEMRSVKRQLVLPRFTLDSEVELKSILI
RMGLGDMFNLAKADFTRITTEQPLCVSKVLQKVKIEVNEEGTKGSAATAAILFSRMAVEE
ITMNRPFLFLIHHKSTGAVLFMGQVNQPQQH
NT seq 1176 nt   +upstreamnt  +downstreamnt
atgctgtgcctgtacgtgtggttcttcctcggcctgtccggagccgccatctctaacctg
caggagaaacagacagactttgggatgcgggtcttctcccaggtggcccagaactccaag
gggtctaacctggccttctccccctacggcgtggccaccattctggccatggctcagctg
ggagctgggggcaacaccctgaagaccctgaacgccaaattgggtttctcactacaagag
cgagggatggcgcgtcagcagcgtcttctccagcgagacatctccagtgaggagggagtg
gagctggccagcggcgtcatggtggagagaaagatggctctggagaaaggcttcagaagg
gggctggggaaagccttccaggcctcccctcaccagctggacttctccaggccagaccag
gccctggacatcatcaacgcctgggtctctgaccacactgcaggtaccatcccttcattc
ctgtcttccggtgctctgaccgatgagacccgtatggtcctgctgaacgcccttcacttc
caggggctatggaaggttccctttgaccccaagatgacagaggagaggctattccactgt
gccaacggcagctccgtgcccgtacccatgatgaggctcacacaccgcttcaaatacggt
gagtttgtgacccccgatggcgtggactacgatgtcatcgaggttccgtacgaaggcgag
tccctgagcatgctgctggtctcccccttcgagcccgagatgccagtgagctccctcagt
agcgagctgaccacccagcggctgcagcagtggagacaggagatgaggagcgttaaacgt
caactggtcctgcctaggttcaccctggactctgaggtggaactgaagtctattctaatc
cgtatggggttgggggatatgttcaacctggccaaggcagacttcacacgcatcaccact
gagcagcctctgtgtgtatccaaggttctgcagaaagtcaagattgaggtgaatgaggag
ggaaccaagggatcagctgccacagctgccatcctgttctctcgtatggctgtagaggag
atcacaatgaatagacctttcctcttcctcatccatcacaagtccacaggtgctgttctg
ttcatgggtcaagtcaaccaaccccagcaacactag

DBGET integrated database retrieval system