KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112214606Help
Entry
112214606         CDS       T05605                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: coagulation factor XIII A chain-like
  KO
K03917  coagulation factor XIII A1 polypeptide [EC:2.3.2.13]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Brite
Enzymes [BR:otw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     112214606
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_N Transglut_C Transglut_core
Motif
Other DBs
NCBI-GeneID: 112214606
NCBI-ProteinID: XP_024229257
LinkDB All DBs
Position
15
AA seq 732 aa AA seqDB search
MSDSEPAAKPQPQVSHRGRSAAPIATSNADGEKVXECEPFGLMPRGPPILSEFLDIWDVN
MLRKPDEINKRQHTTHLYATDNLIVRRGQEFQLKVTFDRPYKPSDDQFAVEFVIGGSPQF
SKGTYIPVSVASDRQSPWAGRVVESADNVVTVGITPAPDCIVGKWRTYVAVVTPYGIRRT
RQDESRDVYILFNPWAAADSVFLDDGNEREECVLNEVGVIYHGAFDDVSERPWNFGQFDY
GVLDACLFIMDKAAMPITNRGDPIKVARKASAMLNSRDDDGVLVGSWSGDYTYGVAPTSW
TGSTEILLNYSSSKMPVCYAQCWVYAAVFNTFLRCLGIPARVVTNFFSSHDNDGNLKTDI
ILDENGRIDKQRTKDSIWNYHCWNECYMSRPDLPQGFGGWQAVDATPQETSDGMYRCGPA
SVQAIKHGQICFPFDAPFVFAEVNSDVVFYSRNPRDGTLEPVKVNSSHVGRMVVTKAPGQ
DTRRDITDQYKFPEGSPEERTVLEKAEEYGCQREKVTLPEADVELNMPLIEVRVGDDFEL
KLEFNNKSGQARTGEMYVSGNVVYYTGVTSSEFLFKTPKVTLDPMKAEKKVIQVRSQDYM
RKLVEQANLHFIATGKVKETGQIVTAMRVVTLHNPKLSVQVSGLAKVSXEEFVTVEFTNP
FKFNLXDVYIRVGGPGVMPPKXKHYSLILAGSSLNWTESFTPRREGPTKLMASLDCAALR
QVYGQTQLTVKP
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atgtctgactcagagcccgccgccaagccacaaccccaggtgtcacaccgcggacgcagt
gccgcccccatcgccacctccaatgcagatggggagaaggtgnctgagtgcgagcccttc
ggcctgatgccccgaggaccccctatcctatcagagttcttggacatctgggacgtgaac
atgctgcggaagccagacgagatcaataagcggcagcacaccacccacctgtatgccact
gacaacctcatcgttcgcaggggacaggagttccagctgaaggtgaccttcgaccgtccc
tacaagccctccgacgaccagttcgctgtggagttcgtcatcgggggcagtccccagttt
agtaagggcacctacatccctgtgtctgtggccagtgaccgccagagcccgtgggcaggc
cgggtggtggagagcgcagacaacgtggtcacggtggggatcaccccagcgcccgactgc
attgtgggaaagtggcgcacgtacgtggcggtggtgacgccatacggaatccgcaggaca
aggcaggacgagagtcgagacgtctatatcctgttcaacccctgggcggcagctgattct
gtgttcctggatgacggcaatgagagggaggagtgtgttctcaacgaggtgggggtcatc
taccacggggcgtttgacgacgtgtccgagcggccctggaactttggccagtttgactac
ggggtgctggatgcgtgtctgttcatcatggataaagctgccatgcccatcaccaacagg
ggggaccccatcaaagtagcccggaaggcctcagccatgctgaactctcgtgacgacgac
ggggtgctggtggggagctggagtggtgactacacctacggagtggcacccacctcctgg
actggaagtactgagatcctcctcaactactccagcagcaagatgcccgtctgctatgcc
cagtgctgggtctacgctgccgtctttaacaccttcttgcgctgtctggggatccccgcc
agggttgtcaccaacttcttctcttcccacgacaatgatggcaacctgaaaactgacatc
atcctggatgagaacggcagaattgacaagcaacgcaccaaggactctatctggaactac
cattgctggaacgagtgctacatgagcaggccagaccttcctcaagggtttgggggctgg
caggctgtggatgctacgccccaagagaccagtgatgggatgtacaggtgtggccctgcg
tctgtccaggccatcaaacatggccagatctgcttcccgttcgacgcacctttcgtgttt
gctgaggtgaacagtgatgtggtgttctactcgcggaacccccgagacggaaccctggag
ccggtcaaagtcaacagcagccatgttggtaggatggtggtgaccaaagctcccggccag
gacacccggcgtgacatcactgaccagtacaagttccccgaaggtagcccggaggagcgc
acggttctggagaaggcagaggagtatggttgtcagcgtgagaaggtcacccttccagag
gctgacgtggagctgaacatgcccctgatcgaggtgagggtgggcgatgacttcgagctg
aagctggagttcaacaacaagagtggccaggctcgcaccggggagatgtatgtcagtggc
aacgtggtgtattacacaggagtcaccagctctgagttcctcttcaagacccctaaagtg
acattggatcccatgaaagctgagaagaaggtgatccaggtgcgttcccaggactacatg
agaaagctggtggagcaggccaacctccacttcattgccactgggaaggtcaaggagacg
ggtcagattgtcaccgccatgagggtcgtcactcttcacaaccccaaactctctgtccag
gtgtctggtctggctaaggtaagtnaggaggagtttgtgactgtggagttcaccaacccg
ttcaagttcaacctgngagatgtgtacattcgcgtgggagggccaggagtcatgccaccc
aagntaaaacattacagtctgatcctggctggctcgtccctgaattggacagagagtttt
accccgcgaagggagggacccaccaagctgatggccagtctggactgtgctgcactcagg
caggtgtacggtcagacccagctgaccgtcaagccctga

DBGET integrated database retrieval system