KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112214757
Entry
112214757         CDS       T05605                                 

Definition
(RefSeq) gamma-aminobutyric acid receptor-associated protein-like
  KO
K08341  GABA(A) receptor-associated protein
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04136  Autophagy - other
otw04137  Mitophagy - animal
otw04140  Autophagy - animal
otw04371  Apelin signaling pathway
otw04621  NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    112214757
   04068 FoxO signaling pathway
    112214757
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112214757
   04136 Autophagy - other
    112214757
   04137 Mitophagy - animal
    112214757
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    112214757
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112214757
   04121 Ubiquitin system [BR:otw04121]
    112214757
   03029 Mitochondrial biogenesis [BR:otw03029]
    112214757
Membrane trafficking [BR:otw04131]
 Autophagy
  Autophagosome formation proteins
   Atg8 conjugation proteins
    112214757
Ubiquitin system [BR:otw04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   112214757
Mitochondrial biogenesis [BR:otw03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    112214757
SSDB
Motif
Pfam: Atg8 APG12
Other DBs
NCBI-GeneID: 112214757
NCBI-ProteinID: XP_024229516
LinkDB
Position
15
AA seq 122 aa
MKFQYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQF
YFLIRKRIHLRAEDALFFFVNNVIPPTSATMGLLYQEHHEEDFFLYIAYSDESVYGDSQT
EV
NT seq 369 nt   +upstreamnt  +downstreamnt
atgaagtttcaatacaaagaggagcacccatttgagaagagacggtctgagggcgagaaa
ataaggaagaagtatccggacagggtacccgtaattgtggaaaaagcccccaaagcaagg
ataggagatctggacaagaagaaataccttgtgccctctgacctcacagtgggccagttc
tacttcctcatccgaaaacgaatccacctgcgggccgaggacgccctgttcttctttgta
aacaacgtcattcctcccacctcagccaccatgggccttctataccaggagcaccatgaa
gaggactttttcctctacattgcctacagtgatgagagtgtctatggagacagccaaacg
gaagtctaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112225868
Entry
112225868         CDS       T05605                                 

Definition
(RefSeq) gamma-aminobutyric acid receptor-associated protein-like 1
  KO
K08341  GABA(A) receptor-associated protein
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04136  Autophagy - other
otw04137  Mitophagy - animal
otw04140  Autophagy - animal
otw04371  Apelin signaling pathway
otw04621  NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    112225868
   04068 FoxO signaling pathway
    112225868
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112225868
   04136 Autophagy - other
    112225868
   04137 Mitophagy - animal
    112225868
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    112225868
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112225868
   04121 Ubiquitin system [BR:otw04121]
    112225868
   03029 Mitochondrial biogenesis [BR:otw03029]
    112225868
Membrane trafficking [BR:otw04131]
 Autophagy
  Autophagosome formation proteins
   Atg8 conjugation proteins
    112225868
Ubiquitin system [BR:otw04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   112225868
Mitochondrial biogenesis [BR:otw03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    112225868
SSDB
Motif
Pfam: Atg8 APG12
Other DBs
NCBI-GeneID: 112225868
NCBI-ProteinID: XP_024245738
LinkDB
Position
3
AA seq 117 aa
MDSQYQRSVPLEVRRAEGERVRAKHPDKIPIIVERAARSRAPDLDKKKYLVPSDLTVGQL
CFLIRQRVSMRPEEALFFFVNNSLPPSSSPLSAVYEEHHEEDLFLYMTYSNESVYGA
NT seq 354 nt   +upstreamnt  +downstreamnt
atggacagtcagtaccagcgctctgtaccactggaggtgaggagggcagagggtgagagg
gtgcgagccaagcatcctgacaagataccgatcattgtggagagggctgccaggtcaaga
gctcctgacctggacaagaagaagtacctcgtaccctctgacctcacagtgggtcaactg
tgcttcctgatccgacagcgtgtgtctatgagacctgaggaggctctcttctttttcgtc
aacaactcccttcccccatccagttctcctctctctgctgtctatgaggagcaccatgaa
gaggacctgttcctatacatgacttacagtaacgagagtgtctacggtgcctga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112229012
Entry
112229012         CDS       T05605                                 

Definition
(RefSeq) gamma-aminobutyric acid receptor-associated protein
  KO
K08341  GABA(A) receptor-associated protein
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04136  Autophagy - other
otw04137  Mitophagy - animal
otw04140  Autophagy - animal
otw04371  Apelin signaling pathway
otw04621  NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    112229012
   04068 FoxO signaling pathway
    112229012
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112229012
   04136 Autophagy - other
    112229012
   04137 Mitophagy - animal
    112229012
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    112229012
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112229012
   04121 Ubiquitin system [BR:otw04121]
    112229012
   03029 Mitochondrial biogenesis [BR:otw03029]
    112229012
Membrane trafficking [BR:otw04131]
 Autophagy
  Autophagosome formation proteins
   Atg8 conjugation proteins
    112229012
Ubiquitin system [BR:otw04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   112229012
Mitochondrial biogenesis [BR:otw03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    112229012
SSDB
Motif
Pfam: Atg8 APG12
Other DBs
NCBI-GeneID: 112229012
NCBI-ProteinID: XP_024250648
LinkDB
Position
30
AA seq 122 aa
MKFLYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQF
YFLIRKRIHLRAEDALFFFVNNVIPPTSATMGLLYQEHHEEDFFLYIAYSDESVYGNSQT
KV
NT seq 369 nt   +upstreamnt  +downstreamnt
atgaaattcctgtataaagaggagcacccatttgagaagagaagatcggagggggaaaag
atcaggaagaagtacccagatagagtgccagtgatagtggagaaagcccccaaagccaga
attggtgatttggacaagaagaaatatcttgtaccctctgatcttacagtgggacagttc
tacttcctaatacggaagaggattcacctgcgggcagaggacgcccttttcttctttgtc
aacaatgtcattcctcccacctcagccaccatgggactactttaccaggaacaccacgaa
gaggacttctttctttacattgcctacagtgacgagagtgtctacggaaacagccaaacg
aaagtctag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112252285
Entry
112252285         CDS       T05605                                 

Definition
(RefSeq) gamma-aminobutyric acid receptor-associated protein-like 2
  KO
K08341  GABA(A) receptor-associated protein
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04136  Autophagy - other
otw04137  Mitophagy - animal
otw04140  Autophagy - animal
otw04371  Apelin signaling pathway
otw04621  NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    112252285
   04068 FoxO signaling pathway
    112252285
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112252285
   04136 Autophagy - other
    112252285
   04137 Mitophagy - animal
    112252285
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    112252285
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112252285
   04121 Ubiquitin system [BR:otw04121]
    112252285
   03029 Mitochondrial biogenesis [BR:otw03029]
    112252285
Membrane trafficking [BR:otw04131]
 Autophagy
  Autophagosome formation proteins
   Atg8 conjugation proteins
    112252285
Ubiquitin system [BR:otw04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   112252285
Mitochondrial biogenesis [BR:otw03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    112252285
SSDB
Motif
Pfam: Atg8 APG12
Other DBs
NCBI-GeneID: 112252285
NCBI-ProteinID: XP_024279161
LinkDB
Position
6
AA seq 117 aa
MKWMFKEDHSLEHRCVESAKIRNKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQF
MWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKERDGDGFLYMAYSGENTFGF
NT seq 354 nt   +upstreamnt  +downstreamnt
atgaaatggatgtttaaagaggatcattccctcgaacaccgatgtgtggagtctgccaaa
atacgcaacaaatatcctgacagggtaccggtgatagtggagaaagtgtctggctcacag
atagtggacatcgacaagagaaaatacttggtcccttctgacatcacagtggcccagttc
atgtggatcatcaggaagcgcatccagctgccctcagagaaagctatttttctctttgtt
gacaaaactgttccccagtccagtctgacaatgggacagctatatgagaaagagagagat
ggggatggctttctgtacatggcgtacagtggcgaaaacactttcggtttctag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112253764
Entry
112253764         CDS       T05605                                 

Definition
(RefSeq) gamma-aminobutyric acid receptor-associated protein-like 1
  KO
K08341  GABA(A) receptor-associated protein
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04136  Autophagy - other
otw04137  Mitophagy - animal
otw04140  Autophagy - animal
otw04371  Apelin signaling pathway
otw04621  NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    112253764
   04068 FoxO signaling pathway
    112253764
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112253764
   04136 Autophagy - other
    112253764
   04137 Mitophagy - animal
    112253764
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    112253764
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112253764
   04121 Ubiquitin system [BR:otw04121]
    112253764
   03029 Mitochondrial biogenesis [BR:otw03029]
    112253764
Membrane trafficking [BR:otw04131]
 Autophagy
  Autophagosome formation proteins
   Atg8 conjugation proteins
    112253764
Ubiquitin system [BR:otw04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   112253764
Mitochondrial biogenesis [BR:otw03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    112253764
SSDB
Motif
Pfam: Atg8 APG12
Other DBs
NCBI-GeneID: 112253764
NCBI-ProteinID: XP_024281507
LinkDB
Position
7
AA seq 117 aa
MDSQYQRSVPLEVRRAEGERVRAKHPDKIPIIVERATRSRAPDLDKKKYLVPSDLTVGQL
CFLIRQRVSMRPEEALFFFVNNSLPPSSSPLSAVYEEHHEEDLFLYMTYSNESVYGA
NT seq 354 nt   +upstreamnt  +downstreamnt
atggacagtcagtaccagcgctctgtaccactggaggtgaggagggcagagggtgagagg
gtgcgagccaagcatcccgacaagataccgatcattgtggagagggctaccaggtcgaga
gctcctgacctggacaagaagaagtaccttgtgccctctgacctcacagtgggtcaactg
tgcttcctgatccgacagcgtgtgtctatgagacctgaggaggctctcttctttttcgtc
aacaactcccttcccccatccagttctcctctctctgctgtctatgaggagcaccatgaa
gaggacctgttcctatacatgacctacagtaacgagagcgtctacggtgcctga

DBGET integrated database retrieval system