KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112214760
Entry
112214760         CDS       T05605                                 

Definition
(RefSeq) solute carrier family 2, facilitated glucose transporter member 4-like isoform X1
  KO
K07191  MFS transporter, SP family, solute carrier family 2 (facilitated glucose transporter), member 4
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04910  Insulin signaling pathway
otw04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112214760
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112214760
   04920 Adipocytokine signaling pathway
    112214760
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:otw02000]
    112214760
Transporters [BR:otw02000]
 Solute carrier family (SLC)
  SLC2: Facilitative GLUT transporter
   112214760
 Major facilitator superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    112214760
SSDB
Motif
Pfam: Sugar_tr MFS_1 Phage_holin_2_3
Other DBs
NCBI-GeneID: 112214760
NCBI-ProteinID: XP_024229524
LinkDB
Position
15
AA seq 505 aa
MPSGFQQLGGETVTGTLALSVFTAVLGSFQFGYNIGVINAPQKIIEADYNATWVHRYGEP
IPSSTLTTLWSLSVAIFSIGGMISSFCVGVISEWLGRRKAMLINNLFAFIGGGLMGMAKI
SRSFEMMILGRFVIGAYCGLASGLVPMYVGEIAPTSLRGALGTLHQLAIVTGILMAQVLG
LESLLGSEELWPVLVGVTVLPTVLQMVLLPFCPESPRFLYIIRSQEHHAKSGLRRLTGRQ
EVGDMLAEMKEEKRRMDMERKVSIAELFRSPIYRQPIIIAILLQLSQQLSGVNAIFYYST
SIFQKAGVQSPVYATIGAGVVNCAFTVVSLFLVERTGRRTLHMLGLSGMCGCAIVMTMAL
ALLDSVPWMSYISMLAIFGFVAFFEVGPGPIPWFFVAELFSQGPRPAAMAVAGFANWTAN
FIIGFGFQYVAELCGPYVFLIFAALLLFFLIFTFFRVPETRGKTFDQISNTFSKHSPAMI
DMDLDMELGKRSTELDYLGEEGSLN
NT seq 1518 nt   +upstreamnt  +downstreamnt
atgccgtctgggtttcagcaactcggaggggagacggtgactggaacccttgctctctca
gtgttcaccgctgtattgggttcctttcagtttgggtacaacataggtgtcatcaacgct
cctcagaagatcattgaagcggactacaacgctacatgggtgcatcggtatggagagccc
atccccagcagtaccctcacaaccctctggtccctgtccgtagccatcttctctataggc
ggtatgatctcctccttctgtgtgggcgtcatctcagagtggctggggaggaggaaagcc
atgctcattaacaacttgtttgccttcatcggaggaggtttgatgggcatggccaagatc
agcaggtccttcgagatgatgattctgggacgattcgtcatcggtgcatactgtggattg
gcatcggggctggtgcccatgtatgtgggtgagatagcccctaccagtctgcgaggggca
ttgggcacgctccaccagctggctatcgtcacagggattctcatggcacaggtcctgggt
ctggagtctttgctgggcagtgaggagttgtggccagtgctggtgggtgtgaccgttcta
cccactgtcctgcagatggtgctgctgcccttttgccccgagagcccccgcttcctctac
atcatccgttcccaggagcaccacgccaagagcggcttgaggaggctgacggggagacag
gaagtgggggatatgctggcagagatgaaggaggagaagaggaggatggacatggagagg
aaggtgtccatcgcagagctcttccgctcccccatttaccggcagcccatcatcatcgcc
atcctactgcaactctcacaacagctgtccggggtgaacgctatcttctactactccacc
agtatcttccagaaggcaggggtccagagccctgtctacgccactataggagccggcgtg
gtcaactgtgccttcaccgtggtctcgctcttcctggttgagaggactggtcgccggaca
ctacacatgctgggcctgtctggaatgtgcggatgcgccattgtcatgacaatggctctc
gccctattggacagtgttccctggatgagctacatcagcatgctggccatctttggcttc
gtggccttcttcgaggtgggccccgggcccatcccctggttctttgtggctgagctcttc
tcccaaggccccaggcctgctgctatggccgtggccggattcgccaattggacagccaac
ttcattatcggctttggcttccaatatgttgctgagctttgtgggccatatgtcttcctc
atcttcgctgctctcctgctattcttcctcatcttcaccttcttccgggtgccggaaaca
cgggggaagacattcgaccagatctccaacaccttcagcaaacactcgcccgccatgata
gatatggacctggacatggagctgggaaaacgcagcacagagcttgattacctgggggag
gaggggagcctcaactga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112260046
Entry
112260046         CDS       T05605                                 

Definition
(RefSeq) solute carrier family 2, facilitated glucose transporter member 4-like
  KO
K07191  MFS transporter, SP family, solute carrier family 2 (facilitated glucose transporter), member 4
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04910  Insulin signaling pathway
otw04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112260046
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112260046
   04920 Adipocytokine signaling pathway
    112260046
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:otw02000]
    112260046
Transporters [BR:otw02000]
 Solute carrier family (SLC)
  SLC2: Facilitative GLUT transporter
   112260046
 Major facilitator superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    112260046
SSDB
Motif
Pfam: Sugar_tr MFS_1 Phage_holin_2_3
Other DBs
NCBI-GeneID: 112260046
NCBI-ProteinID: XP_024290599
LinkDB
Position
10
AA seq 503 aa
MPPGFQQLGVETVTGTLALSVFTAVLGSFQFGYNIGVINAPQKIIEADYNATWVHRYGEP
IPTATLTTLWSLSVAIFSIGGMISSFCVGVISEWLGRRKAMLINNLFAFIGGGLMGMAKI
SRSFEMMILGRFVIGAYCGLASGLVPMYVGEIAPTSLRGALGTLHQLAIVTGILIAQVLG
LESLLGSEELWPVLVGVTVLPTVLQMVLLPFCPESPRFLYIIRCQEHHAKSGLRRLTGRQ
EVGDMLAEMKEEKRRMDMERKVSIAELFRSPMYRQPIIIAILLQLSQQLSGVNAIFYYST
SIFQKAGVQSPVYATIGAGVVNCAFTVVSLFLVERTGRRTLHMLGLSGMCGCAIVMTIAL
ALLDSVPWMSYISMLAIFGFVAFFEVGPGPIPWFFVAELFSQGPRPAAMAVAGFSNWTAN
FIIGFGFQYLAELCGPYVFLIFAVLLVFFLIFTFFRVPETRGKTFDQISASFSKHPPAMM
DLDMELGKRSTELDYLGGEGSLD
NT seq 1512 nt   +upstreamnt  +downstreamnt
atgccgcctgggtttcagcaacttggagtggagacagtgactggaacccttgctctctca
gtgttcactgctgtattgggctcctttcagtttggatacaacatcggcgtcatcaatgca
cctcagaagatcattgaggcggactacaatgctacatgggtgcaccggtatggagagccc
attcccaccgctacactcaccactctgtggtccctgtcggtggccatcttctctatagga
ggcatgatctcttccttctgtgtgggcgtcatctcagaatggctgggcaggaggaaagcc
atgctcataaacaacttgtttgccttcatcggaggaggtttgatgggcatggccaaaatc
agccggtcctttgagatgatgatcctgggacgcttcgtcatcggtgcatactgtgggttg
gcatcagggctagtgcccatgtatgtgggcgagatagcgcctacaagtctgcgaggtgct
ttgggcacgctccaccagttggcgatcgtcacagggattctcatagcacaggtcctaggt
ctggagtctttgctgggcagtgaggagttgtggccagtgctggtgggtgtgaccgttctg
cccactgtcctgcagatggtgctgctacccttctgccccgagagcccccgctttctctac
atcatccgctgccaggagcaccacgccaagagcggcttgaggaggctgaccgggaggcag
gaggtgggggatatgctggcggagatgaaggaggagaagaggaggatggacatggagagg
aaggtgtccatcgcagagctcttccgctcccccatgtaccggcagcccatcatcatcgcc
atcctgctgcagctctcacaacagctctctggggtcaacgctatcttctactactctacc
agcattttccagaaggcaggggtccagagccccgtctacgccactataggagccggcgtg
gtcaactgtgccttcaccgtggtctcgctcttcctggtggagaggacaggccgccggacg
ctacacatgctggggctgtccggaatgtgcggctgtgctattgtcatgacgatagctctt
gccttattggacagtgttccctggatgagctacatcagcatgctggcaatctttggcttc
gtggccttctttgaggtggggcctggccccatcccctggttctttgtggctgagctcttc
tcccaaggccccaggcccgctgcgatggccgtggccggattctccaactggacggccaac
ttcattattggctttggcttccagtatctcgctgagctttgtgggccttatgtcttcctc
atctttgcagtgctccttgtcttcttcctcatcttcaccttcttccgggtgccggagaca
cggggcaagacgttcgaccagatctccgcctccttcagcaagcacccacccgccatgatg
gacctggacatggagctgggcaagcggagtacagagctggactacctggggggggaggga
agccttgactaa

DBGET integrated database retrieval system