KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112214774
Entry
112214774         CDS       T05605                                 

Definition
(RefSeq) serine/threonine-protein phosphatase PP1-beta catalytic subunit isoform X1
  KO
K06269  serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw03015  mRNA surveillance pathway
otw04114  Oocyte meiosis
otw04218  Cellular senescence
otw04261  Adrenergic signaling in cardiomyocytes
otw04270  Vascular smooth muscle contraction
otw04510  Focal adhesion
otw04810  Regulation of actin cytoskeleton
otw04910  Insulin signaling pathway
otw05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    112214774
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    112214774
   04218 Cellular senescence
    112214774
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112214774
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112214774
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112214774
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112214774
   04270 Vascular smooth muscle contraction
    112214774
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    112214774
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:otw01009]
    112214774
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:otw03021]
    112214774
   03019 Messenger RNA biogenesis [BR:otw03019]
    112214774
   03041 Spliceosome [BR:otw03041]
    112214774
Enzymes [BR:otw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     112214774
Protein phosphatases and associated proteins [BR:otw01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     112214774
Transcription machinery [BR:otw03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     112214774
Messenger RNA biogenesis [BR:otw03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     112214774
Spliceosome [BR:otw03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    112214774
SSDB
Motif
Pfam: Metallophos STPPase_N
Other DBs
NCBI-GeneID: 112214774
NCBI-ProteinID: XP_024229548
LinkDB
Position
15
AA seq 327 aa
MAEGELDVDSLIARLLEVRGCRPGKIVQMSEAEVRGLCIKSREIFLSQPILLELEAPLKI
CGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLL
RGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQ
SMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDL
DLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEK
KAKYQYGGMNSGRPVTPPRTVVPPKKR
NT seq 984 nt   +upstreamnt  +downstreamnt
atggcggagggggaattggacgtcgactcgctgatcgcccgattattagaggtgcgggga
tgtcgcccagggaagattgtgcagatgtcagaggctgaggtgagaggcctctgcatcaag
tccagagagatcttcctcagccagcccatcctgttggaattggaggctcccctcaaaatc
tgtggtgacatccacggccagtacacagacctgctgcggctctttgagtacgggggcttc
ccgcccgaggccaactacctgttcctgggggactacgtggaccgaggcaagcagtccctg
gagaccatctgtctactgctggcctacaagatcaaataccccgagaacttcttcctcctc
aggggcaaccacgagtgtgcttccatcaaccgcatctatggcttctatgatgagtgtaag
cgcagattcaacataaagctgtggaagacatttactgactgcttcaactgccttcccatc
gctgccatcgtagatgagaagatcttctgttgccatggaggcctctctccagacctgcag
tctatggagcagatccgtcgtatcatgagacccacagacgtccccgacaccgggttgctg
tgcgacttgctgtggtcggacccagacaaagatgttcagggttggggggagaacgaccgc
ggggtctcgttcacgtttggggctgatgtggtcagcaagttcctcaaccgtcacgatctg
gacctcatctgcagagcccaccaggtggtggaggatggctatgagttctttgccaagcgg
cagctggtgactctgttctcagctcctaactactgtggagagtttgacaacgccggcggt
atgatgagtgttgacgagaccctgatgtgctcctttcagatcctgaagccgtctgagaag
aaggccaagtaccagtacggagggatgaactccggccgacccgtcaccccgccccgcacc
gtggtcccaccaaagaaacggtga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112216138
Entry
112216138         CDS       T05605                                 

Definition
(RefSeq) protein phosphatase 1 regulatory subunit 12B-like isoform X1
  KO
K12329  protein phosphatase 1 regulatory subunit 12B
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04270  Vascular smooth muscle contraction
otw04510  Focal adhesion
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112216138
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112216138
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    112216138
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:otw01009]
    112216138
Protein phosphatases and associated proteins [BR:otw01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     112216138
SSDB
Motif
Pfam: PRKG1_interact DUF4695 HIP1_clath_bdg Occludin_ELL Laminin_II Sec34 Csm1_N
Other DBs
NCBI-GeneID: 112216138
NCBI-ProteinID: XP_024231644
LinkDB
Position
16
AA seq 367 aa
MQACLPRSYLTPVRDEEAESQRKARSRQARQTRRSTQGVTLAELKEAQRTNSLSPLDRDR
QTADGHSRLTDRSCLRGKWAAGDRGETRTKLAQSMETEDHSPTWSREIDELGNHRSRLGT
MEAEYSSASGHYTSLANRTSSRVVEWKDENQNPIEDPSKHVLSTREKQVRFCDQESDEAY
QNLESVEMSSMYPRTKELSRTRKSLSDSPPSSPSPTAKNFRHDRASRLDSGGGDSRDEPL
GRTSSYTRRETRLAALNKHEDDTSSRDYKKMYEDALAENDKLKSRLDDSKQELTKIRTQL
DKVTQKQDRVSERSTVLESEKREKQALEKRVMDMEEELKVLTELKSDNQRLKDENGALIR
VISKLSK
NT seq 1104 nt   +upstreamnt  +downstreamnt
atgcaagcctgcctgcccaggtcctatctaaccccagtgagagatgaggaggcagagtct
cagaggaaggccagatcccgccaagccaggcaaacccgcagatccacacagggtgtgacc
ctggctgaactgaaggaagctcagaggaccaacagcctgtctcccctggacagagacaga
cagacagcagatggacatagcagactgactgacaggtcctgtctgcgggggaaatgggct
gcaggggacagaggagagaccaggaccaaactggctcagtctatggagacagaggatcac
agtcccacatggagcagggagatagatgagctcggaaatcatagatcaaggctggggacc
atggaggcagaatattcctctgctagtgggcactataccagcctggccaaccgcacatcc
tccagagttgttgaatggaaagatgaaaaccagaacccaattgaggatccctccaaacat
gtcctctccacaagagagaaacaagttcgattctgtgaccaagagtcagatgaagcctac
cagaatttggagagtgtggagatgtcatctatgtacccccgcaccaaggagctgtccagg
actaggaagtctctgtccgactcaccaccctcttcaccctctcctaccgccaagaacttc
agacatgacagggcatcaaggttggactctggtggtggggacagcagggatgaacctctg
ggcagaaccagctcctacacacgcagggaaaccagattggcagcgctgaacaagcatgag
gacgacaccagctccagggattacaagaagatgtatgaagatgctttggcagagaatgac
aagctcaagtcccggctggatgatagcaaacaggagctgaccaagatacgcacccagctg
gacaaagtcacccagaaacaggacagagtatctgaaagatccactgtacttgaatcagag
aaaagggaaaaacaggctctggagaagagggtaatggacatggaggaagagctcaaggtc
ttgacagagcttaaatcagacaaccagagactgaaggacgagaatggggctctgatccgt
gtcatcagcaagctgtccaagtaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112217890
Entry
112217890         CDS       T05605                                 

Definition
(RefSeq) serine/threonine-protein phosphatase PP1-beta catalytic subunit-like
  KO
K06269  serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw03015  mRNA surveillance pathway
otw04114  Oocyte meiosis
otw04218  Cellular senescence
otw04261  Adrenergic signaling in cardiomyocytes
otw04270  Vascular smooth muscle contraction
otw04510  Focal adhesion
otw04810  Regulation of actin cytoskeleton
otw04910  Insulin signaling pathway
otw05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    112217890
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    112217890
   04218 Cellular senescence
    112217890
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112217890
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112217890
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112217890
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112217890
   04270 Vascular smooth muscle contraction
    112217890
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    112217890
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:otw01009]
    112217890
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:otw03021]
    112217890
   03019 Messenger RNA biogenesis [BR:otw03019]
    112217890
   03041 Spliceosome [BR:otw03041]
    112217890
Enzymes [BR:otw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     112217890
Protein phosphatases and associated proteins [BR:otw01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     112217890
Transcription machinery [BR:otw03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     112217890
Messenger RNA biogenesis [BR:otw03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     112217890
Spliceosome [BR:otw03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    112217890
SSDB
Motif
Pfam: Metallophos STPPase_N
Other DBs
NCBI-GeneID: 112217890
NCBI-ProteinID: XP_024234262
LinkDB
Position
18
AA seq 327 aa
MAESELNVDSIISRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKI
CGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLL
RGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQ
SMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDL
DLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDESLMCSFQILKPSEK
KAKYQYGGVNTGRPVTPPRTAQAPKKR
NT seq 984 nt   +upstreamnt  +downstreamnt
atggcggaaagcgagctcaacgttgacagcatcatctcccgattgcttgaagtgcgagga
tgccgtccagggaagatagtccagatgacggaggcggaggtgcgggggttgtgcatcaag
tcccgggagatcttcctcagccagcccatcctactggagctggaggcgccgctcaaaatt
tgtggtgatatccatggccagtacacagacctgctgcggctctttgagtacgggggcttc
cccccggaggctaactacctgttcctgggggattatgtggaccgaggcaagcagtccctg
gaaaccatctgcctactgctggcctacaagatcaaataccctgagaacttcttcctgctc
agaggaaaccacgaatgtgcctccatcaaccgcatctacggtttctatgacgagtgcaaa
cgcagattcaacataaagctgtggaagaccttcacagattgcttcaactgtttgcccatt
gccgctataatcgatgagaagatcttctgctgccatggaggtctctctcctgatctgcag
tccatggagcaaatccgacgcatcatgaggcccactgatgtccctgacacaggcctgctg
tgtgacctgctgtggtcagatccagacaaagacgtgcagggctggggggaaaacgaccgg
ggcgtttccttcacctttggggctgacgtggtcagcaagttcctcaaccgccacgacctg
gacctcatctgcagagcccaccaggttgttgaggacggctatgagttctttgccaaacgg
cagctggtgacgctgttctcagctcccaactactgcggggagtttgacaacgctgggggc
atgatgagcgtggatgagtccctcatgtgttcctttcagattttgaagccgtcagagaaa
aaagctaagtaccagtatgggggagtgaacacgggacgccctgtaaccccgcctcgtact
gcccaagccccaaagaagaggtga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112221953
Entry
112221953         CDS       T05605                                 

Definition
(RefSeq) protein phosphatase 1 regulatory subunit 12B-like
  KO
K12329  protein phosphatase 1 regulatory subunit 12B
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04270  Vascular smooth muscle contraction
otw04510  Focal adhesion
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112221953
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112221953
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    112221953
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:otw01009]
    112221953
Protein phosphatases and associated proteins [BR:otw01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     112221953
SSDB
Motif
Pfam: PRKG1_interact HIP1_clath_bdg Occludin_ELL DHR10 FapA TMPIT Csm1_N Tho2 PCRF Jnk-SapK_ap_N DUF4407
Other DBs
NCBI-GeneID: 112221953
NCBI-ProteinID: XP_024240195
LinkDB
Position
22
AA seq 327 aa
MYCLHLRQGVTLSELKEAQRTYSLSPLDRDRQTEDGCSRLAERSCLPGRGSMEDRGEARS
SLAQYVETEDHSPTWSRELDELGNHRSRLETMEAEYSTAGPGLISPSASGLYTRPFSSSL
ANRTFSKEVEWKDENQNPVEDPSKRGLATREKHLCFCDQEADETYQTFKHDRASRLDSGG
GDSKAEPLGRTSSYTRRETRLAALNKQEDDTSPRDYKKMYEDALAENDKLKSRLDDSKHE
LTKIRSQLDKVNQKQDRISERSTVLESEKREKQALEKRVTDMEEELKALPVLALRSGNER
LLAENRAMLRVLAHLSQMASLPETEDL
NT seq 984 nt   +upstreamnt  +downstreamnt
atgtactgtctgcatcttcgtcagggtgtgaccctgtctgaactgaaggaggctcagagg
acctacagtctgtctcctctggacagagacagacagacagaggatggatgtagcagactg
gctgagaggtcctgtctgccggggagagggtctatggaggacagaggagaggccaggtcc
agcctggcccagtatgtagagacagaggatcacagtcctacatggagcagggagctagac
gagcttggaaatcatagatcaaggctggagacaatggaggcagagtattccactgcagga
ccagggctcatatctccctctgccagtgggctctatacccggcctttctcctccagcctg
gccaaccgcacattctccaaagaagttgaatggaaagatgaaaaccagaaccccgttgag
gatccctccaaacgtggcctcgccacaagagagaaacatctttgcttctgtgaccaagag
gcagatgaaacctaccagacttttaagcatgacagggcatcaaggttggactctggtggt
ggggacagcaaggctgaacccctgggcagaaccagctcctacacacggagggagaccaga
ctggcagcattgaacaagcaggaggatgacaccagccccagggactacaagaagatgtat
gaagacgccttggcagagaatgacaagctcaagtcccggctggatgacagcaaacacgag
ctgaccaagatccgctcccagctggacaaagtcaaccagaaacaggacagaatatctgaa
agatccactgtacttgaatcagaaaaaagggaaaaacaggctctggagaagagggtaaca
gacatggaggaggaactcaaggccctccctgttctggcactgcggagcggcaatgagcgt
ctcttggctgagaacagggccatgctgcgtgtcctcgcccacctttcccagatggcctcc
ctgcctgagactgaggacctctaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112223856
Entry
112223856         CDS       T05605                                 

Definition
(RefSeq) serine/threonine-protein phosphatase alpha-2 isoform-like
  KO
K06269  serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw03015  mRNA surveillance pathway
otw04114  Oocyte meiosis
otw04218  Cellular senescence
otw04261  Adrenergic signaling in cardiomyocytes
otw04270  Vascular smooth muscle contraction
otw04510  Focal adhesion
otw04810  Regulation of actin cytoskeleton
otw04910  Insulin signaling pathway
otw05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    112223856
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    112223856
   04218 Cellular senescence
    112223856
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112223856
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112223856
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112223856
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112223856
   04270 Vascular smooth muscle contraction
    112223856
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    112223856
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:otw01009]
    112223856
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:otw03021]
    112223856
   03019 Messenger RNA biogenesis [BR:otw03019]
    112223856
   03041 Spliceosome [BR:otw03041]
    112223856
Enzymes [BR:otw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     112223856
Protein phosphatases and associated proteins [BR:otw01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     112223856
Transcription machinery [BR:otw03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     112223856
Messenger RNA biogenesis [BR:otw03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     112223856
Spliceosome [BR:otw03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    112223856
SSDB
Motif
Pfam: Metallophos STPPase_N
Other DBs
NCBI-GeneID: 112223856
NCBI-ProteinID: XP_024242906
LinkDB
Position
24
AA seq 325 aa
MAEADKLNIDSIIQRLLEVKGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLK
ICGDVHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKVKYPENFFL
LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDL
QSMEQVRRVMRPTDVPDQGLLCDLLWADPDKDVLGWGENDRGVSFTFGADVVTKFLHKHD
MDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAD
KKLFYGGGGGMGSGRPVTPPRKAKK
NT seq 978 nt   +upstreamnt  +downstreamnt
atggcagaagccgataaattaaacatcgactccatcatacagcgacttctggaagtgaag
ggctcccgacctggcaaaaatgtgcagctgacggagaacgagattcgtggcctctgcctc
aagtcccgggagatcttcctcagccagccaatactgctcgaactcgaggcgccactcaag
atttgtggtgacgtccacggtcagtactacgacctgctgagactatttgagtacggaggc
ttccccccggagagcaactacctgttcttgggggactatgtggaccgaggaaagcagtca
ttggagacaatctgcctgctgctggcctacaaggtcaaatacccagagaacttctttctg
ctgcgggggaaccacgagtgtgcctccatcaacagaatatatggcttctacgatgagtgt
aagaggcggtacaatatcaagctgtggaagaccttcaccgactgcttcaactgcctgcct
gtggcggccatcgtcgacgagaagatattttgttgtcatggaggcctgtcccctgatctc
cagtctatggagcaggtgcggcgggtgatgcggcccacggacgtgcctgaccagggcctg
ctatgcgacctgctgtgggcagacccggacaaggatgtgctgggctggggcgagaatgac
cgtggcgtctcctttacctttggtgccgacgtggtcaccaagttcctccacaagcacgac
atggacctcatctgcagggcccaccaggtggttgaggatggctacgagttctttgcgaag
aggcagctagtgacactgttctcggcccccaactactgcggcgagtttgacaacgccgga
gccatgatgagtgtggacgagaccctcatgtgctccttccagatcctgaaacctgcagac
aagaagctgttctatgggggtggagggggcatgggctccggacgtcctgtcacccccccc
aggaaagccaagaagtga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112245361
Entry
112245361         CDS       T05605                                 

Definition
(RefSeq) serine/threonine-protein phosphatase PP1-beta catalytic subunit-like
  KO
K06269  serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw03015  mRNA surveillance pathway
otw04114  Oocyte meiosis
otw04218  Cellular senescence
otw04261  Adrenergic signaling in cardiomyocytes
otw04270  Vascular smooth muscle contraction
otw04510  Focal adhesion
otw04810  Regulation of actin cytoskeleton
otw04910  Insulin signaling pathway
otw05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    112245361
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    112245361
   04218 Cellular senescence
    112245361
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112245361
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112245361
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112245361
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112245361
   04270 Vascular smooth muscle contraction
    112245361
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    112245361
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:otw01009]
    112245361
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:otw03021]
    112245361
   03019 Messenger RNA biogenesis [BR:otw03019]
    112245361
   03041 Spliceosome [BR:otw03041]
    112245361
Enzymes [BR:otw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     112245361
Protein phosphatases and associated proteins [BR:otw01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     112245361
Transcription machinery [BR:otw03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     112245361
Messenger RNA biogenesis [BR:otw03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     112245361
Spliceosome [BR:otw03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    112245361
SSDB
Motif
Pfam: Metallophos STPPase_N
Other DBs
NCBI-GeneID: 112245361
NCBI-ProteinID: XP_024269176
LinkDB
Position
Unknown
AA seq 327 aa
MAESELNVDSIISRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKI
CGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLL
RGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQ
SMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDL
DLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDESLMCSFQILKPSEK
KAKYQYGGVNSGRPVTPPRTAQAPKKR
NT seq 984 nt   +upstreamnt  +downstreamnt
atggcggaaagcgagctcaacgttgacagcatcatctctcgattgcttgaagtacgagga
tgtcgtccagggaagatagtccagatgaccgaggcggaggtgcgggggttgtgcatcaag
tcccgggagatcttcctcagtcagcccattctactggagctggaggctccgctcaaaatc
tgcggtgatatccatggccagtacacagacctgctgcggctctttgagtacgggggcttc
ccgccggaggctaactacctgttcctgggagactacgtggaccgaggcaagcagtccctg
gagaccatctgtctactgctggcctacaagatcaaataccccgagaacttcttcctactc
agaggcaaccacgagtgtgcttccatcaaccgcatctacggtttctatgatgagtgcaaa
cgcagattcaacataaagctgtggaagaccttcacagattgcttcaactgtctgcccatc
gccgctataatcgatgagaagatcttctgctgccatggaggtctctctcctgatctacag
tccatggagcaaattcgacgcatcatgaggccaaccgatgtccctgacacaggactgctg
tgtgatctgctgtggtcggatccagacaaagacgtgcagggctggggggaaaacgaccgg
ggcgtctccttcacctttggggctgacgtggtcagcaagttcctcaaccgccacgacctg
gacctcatctgcagagcccaccaggttgttgaggacggctatgagttttttgccaaacgg
cagctggtgacgctgttctcggctcccaactactgcggggagtttgataacgctgggggc
atgatgagcgttgacgagtccctcatgtgttcctttcagattttgaagccgtcagagaaa
aaagctaagtaccagtatggaggggtgaactcgggacgccccgtaaccccgccccgtact
gcccaagcccccaagaagaggtga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112245503
Entry
112245503         CDS       T05605                                 

Definition
(RefSeq) protein phosphatase 1 regulatory subunit 12C-like isoform X1
  KO
K17457  protein phosphatase 1 regulatory subunit 12C
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04270  Vascular smooth muscle contraction
otw04510  Focal adhesion
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112245503
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112245503
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    112245503
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:otw01009]
    112245503
Protein phosphatases and associated proteins [BR:otw01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     112245503
SSDB
Motif
Pfam: PRKG1_interact Ank_2 Ank_5 Ank_4 Ank Ank_3
Other DBs
NCBI-GeneID: 112245503
NCBI-ProteinID: XP_024269391
LinkDB
Position
Unknown
AA seq 710 aa
MGDTAKDKRQEQLKRWSGSSTDREPAVPRRRWRGDVEDAGCSEAVNNSVSKDHSQDVEGS
GSTTGEANSRLLKRRRRVRFDTAAEFLAACASGDTDEAQEMLKDAKETEGKNGDYQGEVV
NCANADGITALHQACIDGSMEVMVFLLARGANINQVDSEGWTPLHVAATCGNLEITDFLL
QQGASLTAVNCDGDVPLDIAEDEATESLLHQYTVRQGVDVEAAKRVEEEQIMKDARAWLT
EGPPSELRHPKTGATPLHVAAAKGYLEAIKLLCQCGLDVSEMDCDGWTPLHAASHWGQGD
ACRILAEQLCDMEVCSNGGQTPFDVADESVVSLLEELSQKQANWRNEQSIVDRQNPAGST
AAKADNKRRRTSVCRMSSKEKMNVQDQSKERRSEGLELSEEKESSPESSTLSSPDTESAT
STVSPAEKQTPEEKDVEERDQDRASRTARVQPTPQRKEPLADSPNNTNPDRRKFQAPVRD
EESESQRKARSRLMRQSRRSTQGVTLTDLKEAEKSVAKPADPPPSNILHVSPIVTITPAE
RDTDPVKEVGSEGETRLGVRDRRKGRRERRSTGVVQLGNEHLDAMDEAQQDENHRHSSPS
EPQLGDSSPDYKMLYRSVLQENGLLKDKLQETALLLSQSKVELERLRQSQESNTERPALL
ELERFEKRALQRKAVELEDELKVLVDLRADNQRLKDENAALIRVISKLSK
NT seq 2133 nt   +upstreamnt  +downstreamnt
atgggggacacagcaaaggataaacggcaagaacaactgaagcgctggtccggttcaagc
accgacagagaaccggctgtgcccaggcgaaggtggcggggcgatgtcgaggatgcaggc
tgctcggaggccgtaaacaactccgtttcaaaggaccattctcaggatgtggagggaagc
ggatcgaccaccggggaagccaatagtcgtctactcaaacgaaggaggcgagtgcggttt
gatactgctgccgagttcctggcagcttgtgccagtggtgacacagatgaggcccaagag
atgctgaaagatgcaaaagagacagaaggcaagaatggagactaccagggagaggttgtg
aattgtgccaatgctgatggaatcacagctcttcaccaggcttgcatagatgggagcatg
gaggtgatggtctttctcctggctcggggtgccaacataaaccaggtggacagtgagggc
tggactccgctgcatgtggcagccacctgtgggaacctggagatcactgatttccttttg
cagcagggtgcgtctctcactgctgtgaactgcgatggcgacgtcccgctagatatagct
gaagacgaggccactgagtcgctcctgcaccaatacacagtgagacaaggggtggacgtg
gaggcagctaagcgggtggaggaggagcagatcatgaaagacgccagagcctggctgaca
gaggggcctccctcagaactacggcaccccaaaactggggccactcccttgcatgtggct
gcagccaagggctacctggaagccatcaaactgctatgccagtgtggtctggacgtgtcg
gagatggactgtgatggctggacgcctctccacgcagcgtcacactgggggcagggagat
gcctgcaggatactggctgaacagctctgtgacatggaggtctgcagcaatgggggtcag
actccatttgatgtcgctgatgagagtgttgtgtcgctgctggaggagctgtcacagaaa
caagccaactggcgtaatgagcagtccatcgtggacagacagaaccctgcaggctctact
gctgcaaaagctgataacaaacgacggaggacctccgtgtgcaggatgagcagtaaggag
aagatgaacgtgcaggaccagtctaaagagaggaggtctgaaggcctggagctcagcgag
gagaaagagagcagccctgaaagctccactctatccagtccagacacagagagtgccacc
tccaccgtcagccctgctgagaagcagactccagaagagaaggatgtggaggagcgggac
caggacagagccagtcgtacagcccgggtccagcccaccccccagaggaaagaacccctg
gccgatagtcccaacaacaccaacccagacagacggaagttccaggccccagtaagagac
gaggagtctgagtctcagaggaaggcacgatcacgcctcatgcgccagtctcgccgctcc
acacagggtgtgacgctcactgacttgaaggaggcagagaagagcgtagccaaaccggct
gatccaccacctagcaacatcctgcatgtcagccctatagtcaccataacacctgctgag
agagacaccgacccagtgaaggaggtcgggtccgagggagagacgcggctaggagtgagg
gaccgacggaagggaaggagagagagacgctccaccggggtggttcagctagggaatgaa
catttggatgcaatggatgaagcccaacaggatgaaaaccaccgtcatagttcacccagt
gagcctcagttgggagattcttcaccagactacaaaatgctgtacaggtcggtgctgcag
gagaacggcctgctcaaagacaagctgcaggagacggcgctgctgctcagccagagcaaa
gtggagctggagagactccgacagagtcaagagagcaacacagagaggccggccctgctg
gaactggagagatttgagaagagagcactccagagaaaagcagtggaactggaggatgag
ctgaaggtgctggtggatctccgagcagacaaccagaggctaaaggacgagaatgccgct
ctcatccgtgtcatcagcaaactttccaaatga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112245504
Entry
112245504         CDS       T05605                                 

Definition
(RefSeq) protein phosphatase 1 regulatory subunit 12C-like isoform X1
  KO
K17457  protein phosphatase 1 regulatory subunit 12C
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04270  Vascular smooth muscle contraction
otw04510  Focal adhesion
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112245504
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112245504
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    112245504
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:otw01009]
    112245504
Protein phosphatases and associated proteins [BR:otw01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     112245504
SSDB
Motif
Pfam: PRKG1_interact Ank_2 Ank_5 Ank_4 Ank Ank_3
Other DBs
NCBI-GeneID: 112245504
NCBI-ProteinID: XP_024269393
LinkDB
Position
Unknown
AA seq 710 aa
MGDTAKDKRQEQLKRWSGSSTDREPAVPRRRWRGDVEDAGCSEAVNNSVSKDHSQDVEGS
GSTTGEANSRLLKRRRRVRFDTAAEFLAACASGDTDEAQEMLKDAKETEGKNGDYQGEVV
NCANADGITALHQACIDGSMEVMVFLLARGANINQVDSEGWTPLHVAATCGNLEITDFLL
QQGASLTAVNCDGDVPLDIAEDEATESLLHQYTVRQGVDVEAAKRVEEEQIMKDARAWLT
EGPPSELRHPKTGATPLHVAAAKGYLEAIKLLCQCGLDVSEMDCDGWTPLHAASHWGQGD
ACRILAEQLCDMEVCSNGGQTPFDVADESVVSLLEELSQKQANWRNEQSIVDRQNPAGST
AAKADNKRRRTSVCRMSSKEKMNVQDQSKERRSEGLELSEEKESSPESSTLSSPDTESAT
STVSPAEKQTPEEKDVEERDQDRASRTARVQPTPQRKEPLADSPNNTNPDRRKFQAPVRD
EESESQRKARSRLMRQSRRSTQGVTLTDLKEAEKSVAKPADPPPSNILHVSPIVTITPAE
RDTDPVKEVGSEGETRLGVRDRRKGRRERRSTGVVQLGNEHLDAMDEAQQDENHRHSSPS
EPQLGDSSPDYKMLYRSVLQENGLLKDKLQETALLLSQSKVELERLRQSQESNTERPALL
ELERFEKRALQRKAVELEDELKVLVDLRADNQRLKDENAALIRVISKLSK
NT seq 2133 nt   +upstreamnt  +downstreamnt
atgggggacacagcaaaggataaacggcaagaacaactgaagcgctggtccggttcaagc
accgacagagaaccggctgtgcccaggcgaaggtggcggggcgatgtcgaggatgcaggc
tgctcggaggccgtaaacaactccgtttcaaaggaccattctcaggatgtggagggaagc
ggatcgaccaccggggaagccaatagtcgtctactcaaacgaaggaggcgagtgcggttt
gatactgctgccgagttcctggcagcttgtgccagtggtgacacagatgaggcccaagag
atgctgaaagatgcaaaagagacagaaggcaagaatggagactaccagggagaggttgtg
aattgtgccaatgctgatggaatcacagctcttcaccaggcttgcatagatgggagcatg
gaggtgatggtctttctcctggctcggggtgccaacataaaccaggtggacagtgagggc
tggactccgctgcatgtggcagccacctgtgggaacctggagatcactgatttccttttg
cagcagggtgcgtctctcactgctgtgaactgcgatggcgacgtcccgctagatatagct
gaagacgaggccactgagtcgctcctgcaccaatacacagtgagacaaggggtggacgtg
gaggcagctaagcgggtggaggaggagcagatcatgaaagacgccagagcctggctgaca
gaggggcctccctcagaactacggcaccccaaaactggggccactcccttgcatgtggct
gcagccaagggctacctggaagccatcaaactgctatgccagtgtggtctggacgtgtcg
gagatggactgtgatggctggacgcctctccacgcagcgtcacactgggggcagggagat
gcctgcaggatactggctgaacagctctgtgacatggaggtctgcagcaatgggggtcag
actccatttgatgtcgctgatgagagtgttgtgtcgctgctggaggagctgtcacagaaa
caagccaactggcgtaatgagcagtccatcgtggacagacagaaccctgcaggctctact
gctgcaaaagctgataacaaacgacggaggacctccgtgtgcaggatgagcagtaaggag
aagatgaacgtgcaggaccagtctaaagagaggaggtctgaaggcctggagctcagcgag
gagaaagagagcagccctgaaagctccactctatccagtccagacacagagagtgccacc
tccaccgtcagccctgctgagaagcagactccagaagagaaggatgtggaggagcgggac
caggacagagccagtcgtacagcccgggtccagcccaccccccagaggaaagaacccctg
gccgatagtcccaacaacaccaacccagacagacggaagttccaggccccagtaagagac
gaggagtctgagtctcagaggaaggcacgatcacgcctcatgcgccagtctcgccgctcc
acacagggtgtgacgctcactgacttgaaggaggcagagaagagcgtagccaaaccggct
gatccaccacctagcaacatcctgcatgtcagccctatagtcaccataacacctgctgag
agagacaccgacccagtgaaggaggtcgggtccgagggagagacgcggctaggagtgagg
gaccgacggaagggaaggagagagagacgctccaccggggtggttcagctagggaatgaa
catttggatgcaatggatgaagcccaacaggatgaaaaccaccgtcatagttcacccagt
gagcctcagttgggagattcttcaccagactacaaaatgctgtacaggtcggtgctgcag
gagaacggcctgctcaaagacaagctgcaggagacggcgctgctgctcagccagagcaaa
gtggagctggagagactccgacagagtcaagagagcaacacagagaggccggccctgctg
gaactggagagatttgagaagagagcactccagagaaaagcagtggaactggaggatgag
ctgaaggtgctggtggatctccgagcagacaaccagaggctaaaggacgagaatgccgct
ctcatccgtgtcatcagcaaactttccaaatga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112245575
Entry
112245575         CDS       T05605                                 

Definition
(RefSeq) protein phosphatase 1 regulatory subunit 12C-like isoform X1
  KO
K17457  protein phosphatase 1 regulatory subunit 12C
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04270  Vascular smooth muscle contraction
otw04510  Focal adhesion
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112245575
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112245575
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    112245575
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:otw01009]
    112245575
Protein phosphatases and associated proteins [BR:otw01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     112245575
SSDB
Motif
Pfam: PRKG1_interact Ank_2 Ank_4 Ank Ank_5 Ank_3
Other DBs
NCBI-GeneID: 112245575
NCBI-ProteinID: XP_024269455
LinkDB
Position
Unknown
AA seq 709 aa
MGDTAKDKRQEQLKRWSGSSTEREPAVPRRRWRGDVEDVGGSEAVNNAVSKDHSQDVEGS
GSTTGEAHSILLKRRRRVRFDTAAEFLAACASGDTDEAQEMLKDARETEGKNGDYQGEVV
NCANADGITALHQACIDGSMEVMVFLLAQGANINQVDSEGWTPLHVAATCGNLEITDFLL
QQGASLTAVNCDGDVPLDIAEDEATESLLHQYTVRQGVDVEAAKRVEEEQIMKDARAWLT
EGLPSELRHPKTGATPLHVAAAKGYLEAIKLLCQCGLDVSEMDCDGWTPLHAASHWGQGD
ACRILAEQLCDMEACSNGGQTPFDVADESVVSLLEELSQKQANWRNEQSIMDRQNPAGST
AAKADNKRRRTSVCRMSSREKMNVQDQSKERSEGLELSEEKESSPEGSTLSSPDTESATS
TVSPAEKQTPEEKDVEERDQDRASRTARVQPTPQRKDPLADSPNNTNPDRRKFQAPVRDE
ESESQRKARSRLMRQSRRSTQGVTLTDLKEAEKSVAKLADPPPSNILHVSPIVTITPAER
DTDPVKEVGSEGETRLGVRDRRKGRRERRSTGVVQLGNEHLDAMDEAQQDENHRHSSPSE
PQLGDSSPEYKMLYMSVLQENSLLRDKLQETALLLSQSKVELERLRQSQESNTERPALLE
LERFEKRALQRKAVELEDELKVLVDLRADNQRLKDENAALIRVISKLSK
NT seq 2130 nt   +upstreamnt  +downstreamnt
atgggggacacagcaaaggataaacggcaggaacaattgaagcgctggtccggttcaagc
accgaaagagaaccggctgtgcccaggcgaaggtggcggggcgatgtcgaggatgtaggc
ggctcggaggccgtgaacaacgccgtttcaaaggaccattctcaggatgtggagggaagc
ggatcgaccaccggggaagcccatagtattctactcaaacgaaggaggcgagtgcggttt
gatactgctgcagagttcctggcagcttgtgccagtggtgacacagatgaggcccaggag
atgctgaaagatgcaagagagacggaaggcaaaaatggagactatcagggagaggttgtg
aattgtgccaatgctgatggaatcacagctcttcaccaggcttgtatagatgggagcatg
gaggtgatggtctttctcctggctcagggtgccaacataaaccaggtggacagtgagggc
tggactccgctgcatgtggcagccacctgtgggaatctggagattactgatttccttttg
cagcagggtgcttctctcactgctgtgaactgcgatggcgacgtccccctagatatagct
gaagacgaggccactgagtcgctcctgcaccaatacacggtgagacaaggtgtggacgta
gaggcagctaagcgggtggaggaggagcagatcatgaaagatgccagagcctggctgaca
gaggggcttccctcagaactacggcatcccaaaactggggccactcccctgcatgtggct
gcagccaagggctacctggaagccatcaaactgctatgccagtgtggtctggacgtgtca
gagatggactgtgatggctggacgcctctccacgcagcgtcacactggggtcagggagat
gcctgcaggatactggctgaacagctctgcgacatggaggcctgtagcaatgggggtcag
actccgtttgatgtcgctgatgagagtgttgtgtcactgctggaggagctgtcacagaaa
caagccaactggcgtaatgagcagtccataatggacagacagaaccctgcaggctctact
gctgcgaaagctgataacaaacgacggaggacctccgtgtgcaggatgagcagtagggag
aagatgaacgtgcaggaccagtctaaagagaggtctgaaggcctggagctcagcgaggag
aaagagagcagccctgaaggctccactctatccagtccagacacagagagtgccacctcc
accgtcagccccgctgaaaagcagactccagaggagaaggatgtggaggagcgggaccag
gacagagccagtcgtacagcccgggtccagcccaccccccagaggaaagaccccctggct
gatagtcccaacaacaccaacccagacagacggaagttccaggcccctgtaagagacgag
gagtctgagtctcagaggaaagcacgatcacgcctcatgcgccagtctcgccgctccaca
cagggtgtgacgctcactgacttgaaggaggcagagaagagcgtagccaaactggctgat
ccaccacctagcaacatcctgcatgtcagccctatagtcaccataacacctgctgagaga
gacaccgacccagtgaaggaggtcgggtctgagggagagacgcggctaggagtgagggac
cgacggaagggaaggagagagagacgctccaccggggtggttcaactagggaatgaacat
ttggatgcaatggatgaagcccaacaggatgaaaaccatcgtcatagttcacccagtgag
cctcagttgggagattcttcaccagagtacaaaatgctgtacatgtcggtgctgcaggag
aacagcctgctcagagacaagctgcaggagactgcgctgctgctcagccagagcaaagtg
gagctggagagactccgacagagtcaagagagcaacaccgagaggccggccctgctggaa
ctggagcgatttgagaagagagcactccaaagaaaagcagtcgaactggaggatgagctg
aaggtgctggtggatctccgagcagacaaccagaggctaaaggatgagaatgccgctctc
atccgtgtcatcagcaaactttccaaatga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112248359
Entry
112248359         CDS       T05605                                 

Definition
(RefSeq) serine/threonine-protein phosphatase PP1-gamma catalytic subunit
  KO
K06269  serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw03015  mRNA surveillance pathway
otw04114  Oocyte meiosis
otw04218  Cellular senescence
otw04261  Adrenergic signaling in cardiomyocytes
otw04270  Vascular smooth muscle contraction
otw04510  Focal adhesion
otw04810  Regulation of actin cytoskeleton
otw04910  Insulin signaling pathway
otw05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    112248359
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    112248359
   04218 Cellular senescence
    112248359
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112248359
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112248359
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112248359
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112248359
   04270 Vascular smooth muscle contraction
    112248359
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    112248359
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:otw01009]
    112248359
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:otw03021]
    112248359
   03019 Messenger RNA biogenesis [BR:otw03019]
    112248359
   03041 Spliceosome [BR:otw03041]
    112248359
Enzymes [BR:otw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     112248359
Protein phosphatases and associated proteins [BR:otw01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     112248359
Transcription machinery [BR:otw03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     112248359
Messenger RNA biogenesis [BR:otw03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     112248359
Spliceosome [BR:otw03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    112248359
SSDB
Motif
Pfam: Metallophos STPPase_N
Other DBs
NCBI-GeneID: 112248359
NCBI-ProteinID: XP_024273081
LinkDB
Position
4
AA seq 323 aa
MADVDKLNIDSIIQRLLEVRGAKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLK
ICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFL
LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDL
QSMEQIRRVMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGSEVVAKFLHKHD
LDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAE
KKKPNGSRPVTPPRNMVTKQGKK
NT seq 972 nt   +upstreamnt  +downstreamnt
atggccgatgttgacaaactcaacatagacagtatcatccagcgtcttttagaagtcagg
ggagcaaagcctggtaagaatgtgcagctgcaggagaacgagatccgaggattgtgcctc
aagtccagggagatatttctcagccaacctatccttcttgaacttgaagcccccctcaag
atctgtggtgacatccatgggcaatattacgacctattgaggctgtttgagtatgggggc
ttccctcctgagagcaactacctatttctgggagactatgtggacagggggaagcagtct
ctggagaccatctgtctgcttctggcctacaaaatcaaatacccggagaacttcttcctg
ctgagagggaatcatgagtgcgcctccatcaacagaatatatggattctatgatgagtgt
aaaagaaggtacaacatcaagctctggaaaacatttacagattgctttaactgcctccct
attgctgccattgttgatgagaagatcttctgttgccatggagggttgtcaccagacctc
cagtccatggagcagatcaggcgcgtcatgcggcccaccgacgtccccgaccagggcctc
ctgtgtgacctgctctggtcagatccagacaaggatgtcctcggctggggagagaatgac
agaggcgtctcatttacttttggctcagaagttgtggcaaagttcctgcacaaacatgat
ttggatctgatctgtcgcgcccatcaggttgttgaggacggctatgagttcttcgccaag
cgacagcttgtgactttattctcagcacccaactactgcggggagtttgacaatgctggt
gctatgatgagtgtggatgagaccctcatgtgctcttttcagattttgaagcccgctgag
aagaagaagccaaatggcagccgtccagtcacacccccacggaacatggtcaccaagcaa
ggcaagaaataa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112250506
Entry
112250506         CDS       T05605                                 

Definition
(RefSeq) serine/threonine-protein phosphatase PP1-beta catalytic subunit-like
  KO
K06269  serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw03015  mRNA surveillance pathway
otw04114  Oocyte meiosis
otw04218  Cellular senescence
otw04261  Adrenergic signaling in cardiomyocytes
otw04270  Vascular smooth muscle contraction
otw04510  Focal adhesion
otw04810  Regulation of actin cytoskeleton
otw04910  Insulin signaling pathway
otw05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    112250506
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    112250506
   04218 Cellular senescence
    112250506
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112250506
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112250506
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112250506
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112250506
   04270 Vascular smooth muscle contraction
    112250506
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    112250506
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:otw01009]
    112250506
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:otw03021]
    112250506
   03019 Messenger RNA biogenesis [BR:otw03019]
    112250506
   03041 Spliceosome [BR:otw03041]
    112250506
Enzymes [BR:otw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     112250506
Protein phosphatases and associated proteins [BR:otw01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     112250506
Transcription machinery [BR:otw03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     112250506
Messenger RNA biogenesis [BR:otw03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     112250506
Spliceosome [BR:otw03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    112250506
SSDB
Motif
Pfam: Metallophos STPPase_N
Other DBs
NCBI-GeneID: 112250506
NCBI-ProteinID: XP_024276473
LinkDB
Position
5
AA seq 327 aa
MAESELNVDSIISRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKI
CGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLL
RGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQ
SMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDL
DLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDESLMCSFQILKPSEK
KAKYQYGGVNSGRPVTPPRTAQAPKKR
NT seq 984 nt   +upstreamnt  +downstreamnt
atggcggaaagcgagctcaacgttgacagcatcatctctcgattgcttgaagtacgagga
tgtcgtccagggaagatagtccagatgaccgaggcggaggtgcgggggttgtgcatcaag
tcccgggagatcttcctcagtcagcccattctactggagctggaggctccgctcaaaatc
tgcggtgatatccatggccagtacacagacctgctgcggctctttgagtacgggggcttc
ccgccggaggctaactacctgttcctgggagactacgtggaccgaggcaagcagtccctg
gagaccatctgtctactgctggcctacaagatcaaataccccgagaacttcttcctactc
agaggcaaccacgagtgtgcttccatcaaccgcatctacggtttctatgatgagtgcaaa
cgcagattcaacataaagctgtggaagaccttcacagattgcttcaactgtctgcccatc
gccgctataatcgatgagaagatcttctgctgccatggaggtctctctcctgatctacag
tccatggagcaaattcgacgcatcatgaggccaaccgatgtccctgacacaggactgctg
tgtgatctgctgtggtcggatccagacaaagacgtgcagggctggggggaaaacgaccgg
ggcgtctccttcacctttggggctgacgtggtcagcaagttcctcaaccgccacgacctg
gacctcatctgcagagcccaccaggttgttgaggacggctatgagttttttgccaaacgg
cagctggtgacgctgttctcggctcccaactactgcggggagtttgataacgctgggggc
atgatgagcgttgacgagtccctcatgtgttcctttcagattttgaagccgtcagagaaa
aaagctaagtaccagtatggaggggtgaactcgggacgccccgtaaccccgccccgtact
gcccaagcccccaagaagaggtga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112258985
Entry
112258985         CDS       T05605                                 

Definition
(RefSeq) serine/threonine-protein phosphatase alpha-2 isoform-like
  KO
K06269  serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw03015  mRNA surveillance pathway
otw04114  Oocyte meiosis
otw04218  Cellular senescence
otw04261  Adrenergic signaling in cardiomyocytes
otw04270  Vascular smooth muscle contraction
otw04510  Focal adhesion
otw04810  Regulation of actin cytoskeleton
otw04910  Insulin signaling pathway
otw05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    112258985
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    112258985
   04218 Cellular senescence
    112258985
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112258985
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112258985
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112258985
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112258985
   04270 Vascular smooth muscle contraction
    112258985
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    112258985
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:otw01009]
    112258985
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:otw03021]
    112258985
   03019 Messenger RNA biogenesis [BR:otw03019]
    112258985
   03041 Spliceosome [BR:otw03041]
    112258985
Enzymes [BR:otw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     112258985
Protein phosphatases and associated proteins [BR:otw01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     112258985
Transcription machinery [BR:otw03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     112258985
Messenger RNA biogenesis [BR:otw03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     112258985
Spliceosome [BR:otw03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    112258985
SSDB
Motif
Pfam: Metallophos STPPase_N
Other DBs
NCBI-GeneID: 112258985
NCBI-ProteinID: XP_024289435
LinkDB
Position
9
AA seq 332 aa
MAEPDKLNIDSIIQRLLEVKGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLK
ICGDVHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKVKYPENFFL
LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDL
QSMEQVRRVMRPTDVPDQGLLCDLLWADPDKDVLGWGENDRGVSFTFGADVVAKFLHKHD
MDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAD
KKLYSYGGGGGMGSGRPVTPPRNSAKGGKAKK
NT seq 999 nt   +upstreamnt  +downstreamnt
atggcggagccggacaaattaaacatcgactccataatacagcgtcttctggaagttaag
ggctctcggccaggcaagaacgttcagctgacagagaacgagatccgtggactttgcctc
aagtctcgcgaaatcttcctcagccagccaatcctgctcgagcttgaggcaccactcaag
atctgcggtgacgtccacggtcagtactacgacctgctgcggctgtttgagtatggaggt
ttccccccggagagcaactacctgttcctaggggactacgtggaccgagggaagcagtcc
ctggagaccatctgcttgcttctggcctacaaggtcaaatacccagagaacttcttcttg
ctgcgcggcaaccacgagtgtgcctccattaaccgcatctacggcttttatgacgagtgt
aagagacggtataacatcaagctgtggaagacgttcacagactgcttcaactgtttaccc
gtggctgccattgtagatgagaagatcttctgctgccatggaggcctctctccagacctc
cagtccatggagcaggtgcgcagagtgatgcgacccacagatgtgcctgaccagggcctg
ctgtgtgatctgctgtgggccgacccagacaaagatgtcctgggctggggcgagaacgac
cgcggggtctctttcacattcggcgcagacgtggtggccaaatttctgcacaaacacgac
atggaccttatatgcagggcacatcaggtggtagaagacggttacgagttctttgcaaag
agacagcttgttactctgttctctgcccctaactactgtggagagtttgataatgccggt
gccatgatgagtgtggatgagaccctcatgtgttcctttcagattctcaagccagcggat
aagaagctctactcttatggtggaggtggaggaatgggatctggacgccccgtcaccccg
ccacggaattccgccaaaggcgggaaggccaagaaataa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112259017
Entry
112259017         CDS       T05605                                 

Definition
(RefSeq) serine/threonine-protein phosphatase alpha-2 isoform-like
  KO
K06269  serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw03015  mRNA surveillance pathway
otw04114  Oocyte meiosis
otw04218  Cellular senescence
otw04261  Adrenergic signaling in cardiomyocytes
otw04270  Vascular smooth muscle contraction
otw04510  Focal adhesion
otw04810  Regulation of actin cytoskeleton
otw04910  Insulin signaling pathway
otw05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    112259017
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    112259017
   04218 Cellular senescence
    112259017
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112259017
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112259017
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112259017
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112259017
   04270 Vascular smooth muscle contraction
    112259017
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    112259017
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:otw01009]
    112259017
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:otw03021]
    112259017
   03019 Messenger RNA biogenesis [BR:otw03019]
    112259017
   03041 Spliceosome [BR:otw03041]
    112259017
Enzymes [BR:otw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     112259017
Protein phosphatases and associated proteins [BR:otw01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     112259017
Transcription machinery [BR:otw03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     112259017
Messenger RNA biogenesis [BR:otw03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     112259017
Spliceosome [BR:otw03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    112259017
SSDB
Motif
Pfam: Metallophos STPPase_N
Other DBs
NCBI-GeneID: 112259017
NCBI-ProteinID: XP_024289539
LinkDB
Position
9
AA seq 390 aa
MAEPDKLNIDSIIQRLLEVKGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLK
ICGDVHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKVKYPENFFL
LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDL
QSMEQVRRVMRPTDVPDQGLLCDLLWADPDKDVLGWGENDRGVSFTFGADVVAKFLHKHD
MDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAD
KKLYSYGGGGGMGSGRPVTPPRNSAKGESKEITPTGPPLLNKHPPPPPYSFSTSHFSLIT
KQQQNRQYLGFGPLFPDTVFNCLSVCRSCV
NT seq 1173 nt   +upstreamnt  +downstreamnt
atggcggagccggacaaattaaacatcgactccataatacagcgtcttctggaagttaag
ggctctcggccaggcaagaacgttcagctgacagagaacgagatccgtggcctttgcctc
aagtctcgcgaaatcttcctcagccagccaatcctgctcgagcttgaggcaccactcaag
atctgcggtgacgtccatggtcagtactacgacctgctgcggctgtttgagtacggaggc
ttccccccggagagcaactacctgtttctaggggactacgtggaccgagggaagcagtcc
ctggagaccatctgcttgcttctggcctacaaggtcaaatacccagagaacttcttcttg
ctgcgcggcaaccacgagtgtgcctccattaaccgtatctatggcttttatgacgagtgt
aagagacggtataacatcaagctgtggaagacgttcacagactgcttcaactgtttaccc
gtggctgccattgtagatgagaagatcttctgctgccatggaggcctctctccagacctt
cagtccatggagcaggtgcgcagagtgatgcgacccacagatgtgcctgaccagggcctg
ctgtgtgacctgctttgggccgacccagacaaagatgtcctgggctggggcgagaatgac
cgcggggtctctttcacattcggggcagacgtggtggccaaatttctgcacaaacacgac
atggaccttatatgcagggcacatcaggtggtagaagacggttacgagttctttgcaaag
agacagcttgttactctgttctctgcccctaactactgtggagagtttgataatgccggt
gccatgatgagtgtggatgagaccctcatgtgttcctttcagattctcaagccagcggat
aagaagctctactcttatggtggaggtggaggaatgggatctggacgccccgtcaccccg
ccacggaattccgccaaaggcgaaagcaaagaaataacacccactggaccccccctcctg
aacaagcacccccccccccccccatactctttctctacctcccacttttccctcatcacc
aaacagcaacaaaacagacagtacctagggttcggtcctctttttcctgatactgttttt
aactgtttgagtgtatgtaggtcctgtgtctga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112260058
Entry
112260058         CDS       T05605                                 

Definition
(RefSeq) serine/threonine-protein phosphatase PP1-beta catalytic subunit-like isoform X1
  KO
K06269  serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw03015  mRNA surveillance pathway
otw04114  Oocyte meiosis
otw04218  Cellular senescence
otw04261  Adrenergic signaling in cardiomyocytes
otw04270  Vascular smooth muscle contraction
otw04510  Focal adhesion
otw04810  Regulation of actin cytoskeleton
otw04910  Insulin signaling pathway
otw05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    112260058
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    112260058
   04218 Cellular senescence
    112260058
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112260058
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112260058
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112260058
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112260058
   04270 Vascular smooth muscle contraction
    112260058
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    112260058
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:otw01009]
    112260058
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:otw03021]
    112260058
   03019 Messenger RNA biogenesis [BR:otw03019]
    112260058
   03041 Spliceosome [BR:otw03041]
    112260058
Enzymes [BR:otw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     112260058
Protein phosphatases and associated proteins [BR:otw01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     112260058
Transcription machinery [BR:otw03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     112260058
Messenger RNA biogenesis [BR:otw03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     112260058
Spliceosome [BR:otw03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    112260058
SSDB
Motif
Pfam: Metallophos STPPase_N
Other DBs
NCBI-GeneID: 112260058
NCBI-ProteinID: XP_024290627
LinkDB
Position
10
AA seq 327 aa
MAEGELDVDSLIARLLEVRGCRPGKIVQMSEAEVRGLCIKSREIFLSQPILLELEAPLKI
CGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLL
RGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQ
SMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDL
DLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEK
KAKYQYGGMTSGRPVTPPRTAVPPKKR
NT seq 984 nt   +upstreamnt  +downstreamnt
atggcggagggggagttggacgtcgactcgctgatcgcccggctattagaggtgcgggga
tgtcgccctgggaagatcgtgcagatgtcagaggctgaggtgaggggcctctgcatcaag
tccagagagatcttcctcagccagcccatcctcctggaactggaggctcccctcaagatc
tgtggtgacatccacggccagtacacagacctgctgcggctcttcgagtacgggggcttc
ccgcccgaggccaactacctgttcctgggagactacgtggaccgaggcaagcagtccctg
gagaccatctgtctactgctggcctacaagatcaaataccccgagaacttcttcctcctc
agaggcaaccacgagtgtgcctccatcaaccgcatctacggcttctacgacgagtgtaag
cgcagattcaacataaagctgtggaagacatttactgactgcttcaactgccttcccatc
gctgccatcgtggatgagaagatcttctgttgccatggaggcctctctccagacttgcag
tctatggagcagatccgtcgcatcatgagacccacagacgttcctgacacggggttgctg
tgtgacctgctgtggtcggacccagacaaagacgttcagggttggggggagaacgaccgc
ggggtctcgttcacatttggggctgatgtggtcagcaagttcctcaaccgtcacgatctg
gacctcatctgcagagcccaccaggtggtggaggatggatatgagttctttgccaagcgg
cagctggtgactctgttctcagctcctaactactgtggagagtttgacaatgccggcggc
atgatgagcgttgacgagaccctgatgtgctccttccagatcctgaagccgtctgagaag
aaggccaagtatcagtacggagggatgacctctggccgacccgtcaccccgccccgcaca
gccgtcccgccaaagaaacggtga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112263044
Entry
112263044         CDS       T05605                                 

Definition
(RefSeq) serine/threonine-protein phosphatase PP1-gamma catalytic subunit-like
  KO
K06269  serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw03015  mRNA surveillance pathway
otw04114  Oocyte meiosis
otw04218  Cellular senescence
otw04261  Adrenergic signaling in cardiomyocytes
otw04270  Vascular smooth muscle contraction
otw04510  Focal adhesion
otw04810  Regulation of actin cytoskeleton
otw04910  Insulin signaling pathway
otw05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    112263044
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    112263044
   04218 Cellular senescence
    112263044
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112263044
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112263044
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112263044
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112263044
   04270 Vascular smooth muscle contraction
    112263044
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    112263044
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:otw01009]
    112263044
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:otw03021]
    112263044
   03019 Messenger RNA biogenesis [BR:otw03019]
    112263044
   03041 Spliceosome [BR:otw03041]
    112263044
Enzymes [BR:otw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     112263044
Protein phosphatases and associated proteins [BR:otw01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     112263044
Transcription machinery [BR:otw03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     112263044
Messenger RNA biogenesis [BR:otw03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     112263044
Spliceosome [BR:otw03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    112263044
SSDB
Motif
Pfam: Metallophos STPPase_N
Other DBs
NCBI-GeneID: 112263044
NCBI-ProteinID: XP_024294782
LinkDB
Position
12
AA seq 323 aa
MADVDKLNIDSIIQRLLEVRGAKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLK
VCGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFL
LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDL
QSMEQIRRVMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGSEVVAKFLHKHD
LDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAE
KKKPNGSRPVTPPRNMVTKQGKK
NT seq 972 nt   +upstreamnt  +downstreamnt
atggccgatgttgataaactcaatatagacagtatcatccagcgtcttttagaagtcaga
ggagcaaaacctggtaagaatgtgcagctgcaggagaatgagatccgaggattgtgcctc
aagtccagggagatctttctcagccaacctatccttctggagcttgaagcccccctcaaa
gtctgtggtgacatccatgggcaatattacgacctattgaggctgtttgagtatgggggc
ttccctcctgagagcaactacctatttctgggagactatgtggacagagggaagcagtct
ctggagaccatctgtctgcttctagcctacaaaatcaaatacccggagaacttcttcctg
ctgaggggaaaccatgagtgcgcctccatcaacagaatatatggattctatgatgagtgt
aaaagaaggtacaacatcaagctctggaaaacatttacagattgttttaactgcctccct
atcgctgccattgttgatgagaagatcttctgttgccatggagggttgtcacccgacctc
cagtccatggagcagatccggcgtgtcatgcggcccaccgacgtccctgaccagggcctc
ctgtgtgacctgctctggtctgatccagacaaggatgtccttggctggggagagaacgac
aggggcgtctcattcacctttggatcagaagtggtggcaaagttcctgcacaaacatgac
ttggatctgatctgtcgcgcccatcaggttgttgaggacggctatgagttctttgcaaag
cgacagcttgtgactttattctcagcaccgaactactgcggggagtttgacaatgctggt
gccatgatgagtgtggatgagactctcatgtgctcgtttcagattttgaagccagccgag
aagaagaagccaaatggcagccgtccagtcacacccccacggaacatggtcaccaagcaa
ggcaagaaataa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112264608
Entry
112264608         CDS       T05605                                 

Definition
(RefSeq) protein phosphatase 1 regulatory subunit 12C-like isoform X1
  KO
K17457  protein phosphatase 1 regulatory subunit 12C
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04270  Vascular smooth muscle contraction
otw04510  Focal adhesion
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112264608
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112264608
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    112264608
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:otw01009]
    112264608
Protein phosphatases and associated proteins [BR:otw01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     112264608
SSDB
Motif
Pfam: PRKG1_interact Ank_2 Ank_4 Ank Ank_5 Ank_3
Other DBs
NCBI-GeneID: 112264608
NCBI-ProteinID: XP_024297101
LinkDB
Position
2
AA seq 709 aa
MGDTAKDKRQEQLKRWSGSSTEREPAVPRRRWRGDVEDVGGSEAVNNAVSKDHSQDVEGS
GSTTGEAHSILLKRRRRVRFDTAAEFLAACASGDTDEAQEMLKDARETEGKNGDYQGEVV
NCANADGITALHQACIDGSMEVMVFLLAQGANINQVDSEGWTPLHVAATCGNLEITDFLL
QQGASLTAVNCDGDVPLDIAEDEATESLLHQYTVRQGVDVEAAKRVEEEQIMKDARAWLT
EGLPSELRHPKTGATPLHVAAAKGYLEAIKLLCQCGLDVSEMDCDGWTPLHAASHWGQGD
ACRILAEQLCDMEACSNGGQTPFDVADESVVSLLEELSQKQANWRNEQSIMDRQNPAGST
AAKADNKRRRTSVCRMSSREKMNVQDQSKERSEGLELSEEKESSPEGSTLSSPDTESATS
TVSPAEKQTPEEKDVEERDQDRASRTARVQPTPQRKDPLADSPNNTNPDRRKFQAPVRDE
ESESQRKARSRLMRQSRRSTQGVTLTDLKEAEKSVAKLADPPPSNILHVSPIVTITPAER
DTDPVKEVGSEGETRLGVRDRRKGRRERRSTGVVQLGNEHLDAMDEAQQDENHRHSSPSE
PQLGDSSPEYKMLYMSVLQENSLLRDKLQETALLLSQSKVELERLRQSQESNTERPALLE
LERFEKRALQRKAVELEDELKVLVDLRADNQRLKDENAALIRVISKLSK
NT seq 2130 nt   +upstreamnt  +downstreamnt
atgggggacacagcaaaggataaacggcaggaacaattgaagcgctggtccggttcaagc
accgaaagagaaccggctgtgcccaggcgaaggtggcggggcgatgtcgaggatgtaggc
ggctcggaggccgtgaacaacgccgtttcaaaggaccattctcaggatgtggagggaagc
ggatcgaccaccggggaagcccatagtattctactcaaacgaaggaggcgagtgcggttt
gatactgctgcagagttcctggcagcttgtgccagtggtgacacagatgaggcccaggag
atgctgaaagatgcaagagagacggaaggcaaaaatggagactatcagggagaggttgtg
aattgtgccaatgctgatggaatcacagctcttcaccaggcttgtatagatgggagcatg
gaggtgatggtctttctcctggctcagggtgccaacataaaccaggtggacagtgagggc
tggactccgctgcatgtggcagccacctgtgggaatctggagattactgatttccttttg
cagcagggtgcttctctcactgctgtgaactgcgatggcgacgtccccctagatatagct
gaagacgaggccactgagtcgctcctgcaccaatacacggtgagacaaggtgtggacgta
gaggcagctaagcgggtggaggaggagcagatcatgaaagatgccagagcctggctgaca
gaggggcttccctcagaactacggcatcccaaaactggggccactcccctgcatgtggct
gcagccaagggctacctggaagccatcaaactgctatgccagtgtggtctggacgtgtca
gagatggactgtgatggctggacgcctctccacgcagcgtcacactggggtcagggagat
gcctgcaggatactggctgaacagctctgcgacatggaggcctgtagcaatgggggtcag
actccgtttgatgtcgctgatgagagtgttgtgtcactgctggaggagctgtcacagaaa
caagccaactggcgtaatgagcagtccataatggacagacagaaccctgcaggctctact
gctgcgaaagctgataacaaacgacggaggacctccgtgtgcaggatgagcagtagggag
aagatgaacgtgcaggaccagtctaaagagaggtctgaaggcctggagctcagcgaggag
aaagagagcagccctgaaggctccactctatccagtccagacacagagagtgccacctcc
accgtcagccccgctgaaaagcagactccagaggagaaggatgtggaggagcgggaccag
gacagagccagtcgtacagcccgggtccagcccaccccccagaggaaagaccccctggct
gatagtcccaacaacaccaacccagacagacggaagttccaggcccctgtaagagacgag
gagtctgagtctcagaggaaagcacgatcacgcctcatgcgccagtctcgccgctccaca
cagggtgtgacgctcactgacttgaaggaggcagagaagagcgtagccaaactggctgat
ccaccacctagcaacatcctgcatgtcagccctatagtcaccataacacctgctgagaga
gacaccgacccagtgaaggaggtcgggtctgagggagagacgcggctaggagtgagggac
cgacggaagggaaggagagagagacgctccaccggggtggttcaactagggaatgaacat
ttggatgcaatggatgaagcccaacaggatgaaaaccatcgtcatagttcacccagtgag
cctcagttgggagattcttcaccagagtacaaaatgctgtacatgtcggtgctgcaggag
aacagcctgctcagagacaagctgcaggagactgcgctgctgctcagccagagcaaagtg
gagctggagagactccgacagagtcaagagagcaacaccgagaggccggccctgctggaa
ctggagcgatttgagaagagagcactccaaagaaaagcagtcgaactggaggatgagctg
aaggtgctggtggatctccgagcagacaaccagaggctaaaggatgagaatgccgctctc
atccgtgtcatcagcaaactttccaaatga

DBGET integrated database retrieval system