KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112214775
Entry
112214775         CDS       T05605                                 

Definition
(RefSeq) putative transcription factor p65 homolog isoform X1
  KO
K04735  transcription factor p65
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04137  Mitophagy - animal
otw04210  Apoptosis
otw04218  Cellular senescence
otw04620  Toll-like receptor signaling pathway
otw04621  NOD-like receptor signaling pathway
otw04622  RIG-I-like receptor signaling pathway
otw04623  Cytosolic DNA-sensing pathway
otw04625  C-type lectin receptor signaling pathway
otw04920  Adipocytokine signaling pathway
otw05132  Salmonella infection
otw05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112214775
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    112214775
  09143 Cell growth and death
   04210 Apoptosis
    112214775
   04218 Cellular senescence
    112214775
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    112214775
   04621 NOD-like receptor signaling pathway
    112214775
   04622 RIG-I-like receptor signaling pathway
    112214775
   04623 Cytosolic DNA-sensing pathway
    112214775
   04625 C-type lectin receptor signaling pathway
    112214775
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    112214775
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112214775
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    112214775
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:otw03000]
    112214775
Transcription factors [BR:otw03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    112214775
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer PBP_N
Other DBs
NCBI-GeneID: 112214775
NCBI-ProteinID: XP_024229550
LinkDB
Position
15
AA seq 600 aa
MNGMYGWGQPPLNQGNSFIEIIEQPKPRGMRFRYKCEGRSAGSIPGEKSNDTTKTHPAIK
VHNYNGPLRVRVSLVTKNPPHKPHPHELVGKDCKHGYYEADLQERRVHSFQNLGIQCVKK
KDVNEAVSCRLQTQNNPFNIPEAKVWEEEFDLNAVRLCFQASITLPTGELHPLEPVVSQP
IYDNRAPNTAELKICRVNRNSGSCRGGDEIFLLCDKVQKEDIEVRFFQDSWEGKGTFSQA
DVHRQVAIVFRTPPFYDTNLTEPIKVKMQLRRPSDREVSEPMDFQFLPSDPDEYRLIEKR
KRTEGMFQNLKLGSISGAMPAERPFNTARRTVAAKPAASQPVNPVAPPRAASVKHQPYYD
SPQPGQLFRTQPKAEPSSSTPAETWKFLNSLTLDSQHKATPVAQFTNPQASAATSQAFPT
VNLSDLHGFTFSTFASPQEPVSAAATPEPTSTFGVQDSQFRVDGPMVDEELPEFPSFSEV
HQSGTLDNINIDDFQAMLVQSGLAGEGPGNSRVSVSQAPCHLPATNPVVNNSCGGSTWMN
YPNSIVNLLQSEGMIDSSPGNSSQPAVLDDLDVFSSIDEDRLISILNSGNQAGFVSGHQT
NT seq 1803 nt   +upstreamnt  +downstreamnt
atgaatggaatgtatggatggggacagccccctttgaaccaagggaattctttcatagag
atcattgagcagcccaagccgagaggcatgaggttcaggtacaagtgtgaggggcgctcg
gcgggcagcatcccgggagagaagagcaacgataccaccaagacacaccccgcaatcaag
gtgcacaactacaatggtcccctgcgtgtccgtgtctccttggtgaccaagaacccgcct
cacaagccccacccacacgagctggtggggaaagactgcaaacatggctactacgaggca
gacttgcaggagagacgagtacacagttttcagaacctgggcattcagtgtgtgaagaaa
aaggatgtgaacgaagcagtttcctgtagactgcagacccaaaacaaccccttcaacatt
cccgaggcgaaggtgtgggaggaggagtttgacctgaatgcagtgaggctttgtttccag
gcctcgatcactctacctaccggtgaacttcaccctctggagcccgtggtgtctcagccc
atctacgacaatagagcacccaacacagcagaattgaagatctgtcgagtgaacagaaac
tctgggagctgcagaggaggggacgagatcttcttactctgtgacaaagtgcaaaaagag
gacatcgaggtacggttcttccaggactcgtgggaggggaagggcaccttctcccaggcg
gacgtccacaggcaggtggccatcgtgttccgtaccccgcccttctacgacaccaacttg
accgagccaatcaaagtgaagatgcagcttcgcaggccctcggaccgcgaggtcagcgag
ccaatggacttccaattcctgccctccgacccagatgaatatagactgatagagaagcga
aaacggacagagggaatgttccagaatctgaagctggggtccatatcaggggccatgcca
gcagagaggcctttcaacactgccagaagaacagtcgccgccaagccagcagctagccag
ccagtgaacccagtggcgccccctcgtgccgcctctgtgaagcaccagccctactatgat
agcccccagcctggccagctgttccgaacccagcccaaagcagagccctcctcctccact
ccagcagagacctggaagttcctcaacagcctgaccttggactcccaacacaaagccacc
cccgtggcccaattcaccaacccccaggcatctgcagccacctcacaggccttccccacc
gtcaacctgtcggacctccacggcttcaccttctccaccttcgctagtccccaggagcca
gtgagcgcagccgctaccccagagcccacctctacctttggggtccaggattcccagttc
agggtggatggccccatggtggatgaggagctacccgagttccccagcttctctgaggtc
caccagtcagggacactagataacataaacatcgacgacttccaggctatgctggtccag
agtggtctggctggagaggggccagggaacagtagggtgtcggtctctcaggcaccctgc
cacttacctgccaccaaccctgtggtcaacaacagctgtggcggcagcacctggatgaac
taccccaacagcatcgtgaacctgctccagagtgagggcatgatcgacagttctcctggc
aactccagccagccggccgtcctcgacgacctggacgtcttcagctccatagacgaagac
cgtctcatttccatcctgaacagtggcaaccaggccggtttcgtgtccggacatcagact
tag

DBGET integrated database retrieval system