KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112215023
Entry
112215023         CDS       T05605                                 

Definition
(RefSeq) caveolin-3-like
  KO
K12959  caveolin 3
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04144  Endocytosis
otw04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:otw00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112215023
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112215023
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112215023
Membrane trafficking [BR:otw04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    112215023
SSDB
Motif
Pfam: Caveolin
Other DBs
NCBI-GeneID: 112215023
NCBI-ProteinID: XP_024229810
LinkDB
Position
2
AA seq 154 aa
MTVTMADINNGYEQKFQTDRHHKEIDLINRDPKQVNEDVVKVDFEDVIAEPDGTHSLDGV
WKASYTTFTVSKYWCYRILSAILGIPMALLWGFLFACLSFCHIWAVVPCIKSCMIESQCF
SRIYSLAIHIFCDPLFEALGKIFSSVRVVLQKDV
NT seq 465 nt   +upstreamnt  +downstreamnt
atgaccgtgaccatggctgacatcaacaacggttatgaacagaagttccagacggacaga
catcataaagagattgacctgatcaacagagaccccaagcaagtcaacgaggatgtagtg
aaggtggactttgaggacgtgatcgctgagcctgacgggactcacagtctggacggggtg
tggaaggccagttacaccaccttcactgtgtccaaatactggtgctaccgtatcctgtct
gccattttggggatccccatggctctactgtggggcttcctatttgcctgcctctccttc
tgccacatctgggctgtggtgccgtgcattaagagttgcatgatagagtcccagtgtttc
agccgtatctactccctggccatacacatcttctgcgacccgctatttgaagccctggga
aagatattctcaagtgttcgggtggtgctacagaaggatgtgtaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112217080
Entry
112217080         CDS       T05605                                 

Gene name
cav3
Definition
(RefSeq) caveolin-3
  KO
K12959  caveolin 3
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04144  Endocytosis
otw04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:otw00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112217080 (cav3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112217080 (cav3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112217080 (cav3)
Membrane trafficking [BR:otw04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    112217080 (cav3)
SSDB
Motif
Pfam: Caveolin
Other DBs
NCBI-GeneID: 112217080
NCBI-ProteinID: XP_024233127
LinkDB
Position
2
AA seq 152 aa
MADQYQYNTNEEKIVKDSHTKEIDLINRDPKLINEDVIKVEFEDVIAEPDGTHSLDGVWK
LSYTTFTVSKYWCYRILSAIFGIPMALLWGFLFACISFCHIWAVVPCIKSCLIESQCISR
IYSLCIQTFCDPFFEALGKIFSSVKVALRKEV
NT seq 459 nt   +upstreamnt  +downstreamnt
atggccgaccagtaccagtacaacaccaacgaggagaagattgtgaaggacagccacacc
aaggagatcgatctgatcaacagagaccccaaattgataaatgaggatgtgatcaaggtg
gagtttgaggatgtgatcgcagagcccgacggcacacacagtctggatggggtgtggaag
ctcagctacaccaccttcaccgtgtccaagtactggtgctatcgcatcctctcagccatc
ttcggcatccctatggctctgctctggggcttcctcttcgcctgcatctcattctgtcac
atctgggctgtggtaccctgtatcaagagctgcttgatcgagtcccagtgcatcagtcgc
atctactccctctgcatccagaccttctgtgaccccttctttgaagccctgggcaagatc
ttcagcagtgtgaaagtggccctgcgcaaagaggtctag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112218852
Entry
112218852         CDS       T05605                                 

Definition
(RefSeq) caveolin-1
  KO
K06278  caveolin 1
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04144  Endocytosis
otw04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:otw00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112218852
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112218852
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112218852
Membrane trafficking [BR:otw04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    112218852
SSDB
Motif
Pfam: Caveolin DUF3169
Other DBs
NCBI-GeneID: 112218852
NCBI-ProteinID: XP_024235837
LinkDB
Position
19
AA seq 182 aa
MTGGLKDGETDEEFLHSPFIRKQGNIYKPNNKDMDNDSMSGMKTMQDVHTKEIDLVNRDP
KHINDDVVKVDFEDVIAEPAGTYSFDGVWKASFTTFTVTKYWCYRLLTALVGIPLALVWG
IFFAILSFIHIWAVVPCVKSYLIEIHCVSRVYSICVHTFCDPLFEAMGKCFSSIRISTTK
GV
NT seq 549 nt   +upstreamnt  +downstreamnt
atgactggcggactcaaggacggcgaaactgacgaggaatttctgcactcgccgttcatc
agaaaacaagggaacatttataaacctaataacaaagacatggataatgacagtatgagc
gggatgaagacgatgcaggatgtccatacaaaagagatcgacctggtgaaccgggacccc
aagcacataaacgacgacgttgtaaaggtggactttgaggatgtgattgcagagcctgca
ggcacgtacagcttcgacggcgtgtggaaggctagcttcaccaccttcacagtgaccaag
tactggtgctaccgtctcctcactgccctggtgggcatcccactggcgctggtctggggc
atcttcttcgccatcctgtcctttattcacatctgggcggtggtgccctgtgtcaagagc
tatctgatcgagatccactgtgtcagccgcgtctactccatttgcgtccacacattctgc
gacccgctgttcgaagccatgggcaagtgcttcagcagcatccgcatcagcaccaccaag
ggggtatag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112218853
Entry
112218853         CDS       T05605                                 

Definition
(RefSeq) caveolin-2-like
  KO
K12958  caveolin 2
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04144  Endocytosis
otw04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:otw00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112218853
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112218853
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112218853
Membrane trafficking [BR:otw04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    112218853
SSDB
Motif
Pfam: Caveolin AgrB
Other DBs
NCBI-GeneID: 112218853
NCBI-ProteinID: XP_024235838
LinkDB
Position
19
AA seq 162 aa
MGLEKVNYETSIIMDEDEFNRSIEPILSKNDKVYAAIPDRDHNDINAHLKVGFDDVIAEP
SSSHSFDKVWIGSHAVFELVKYGFYLILTTILAVPMAFILGIVFGVFSCVHIWVLMPVVR
SCLMVLPSIQVVWSSLTDMLVTPLFHSMGRCLSSVHVKTTDN
NT seq 489 nt   +upstreamnt  +downstreamnt
atgggtctcgaaaaggtgaattacgaaacgagcattatcatggacgaggacgagttcaac
agatcaatcgaaccgattctgtcgaaaaatgacaaagtatatgcggcgattccagaccga
gatcacaatgacataaatgcgcacttaaaggttggttttgacgatgtgatagcagagccc
agttcgagccacagcttcgacaaagtatggataggaagtcacgctgtcttcgaactggtc
aaatatggcttctacctaatattgaccaccatccttgctgtgcccatggcgtttatcctt
ggtattgtcttcggggtcttcagctgtgttcatatttgggtgctaatgccggtggtgcgg
agctgtctaatggtgctgccctctatccaggtggtctggagcagcctgacagacatgctc
gtcacccccctattccacagtatgggccggtgtctgtcatcagttcacgtcaagaccaca
gacaactga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112223176
Entry
112223176         CDS       T05605                                 

Definition
(RefSeq) caveolin-2-like
  KO
K12958  caveolin 2
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04144  Endocytosis
otw04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:otw00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112223176
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112223176
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112223176
Membrane trafficking [BR:otw04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    112223176
SSDB
Motif
Pfam: Caveolin TcpE
Other DBs
NCBI-GeneID: 112223176
NCBI-ProteinID: XP_024241975
LinkDB
Position
2
AA seq 192 aa
MGTMMRETDPVVTEIDLGDSDDEDLAEDLDEDREEPQLLWKAELGDGMDEEEAVSPLVDV
SDTKPLLKERDPRGVNDCLKVTFEDVIAEPVSVRSGDRVWIWSNALFEVTRVWIYRIVTV
LLAVPISIITALLFAILSFLHIWFFSPCVHYILIITYWLQSLWSIVLDIGVRPFLTSAAR
CHSGIRLRLTQE
NT seq 579 nt   +upstreamnt  +downstreamnt
atgggcaccatgatgagggaaacagatccagtggtgacagagattgacctaggagactct
gatgatgaagaccttgccgaagacctggatgaggaccgtgaggagcctcagctgctatgg
aaggctgaactgggggatggaatggatgaagaggaggctgtgtccccattagttgacgtt
agtgacaccaagcccctgctgaaagaaagagacccgagaggagtcaacgactgtctgaag
gtgacctttgaggatgtgatagcggagccggtgtcagtgcgtagcggagacagagtgtgg
atctggagtaatgccctgttcgaggtcaccagggtctggatctaccggatagtaactgtc
ttgctggccgtccctatatccatcatcactgcactgctcttcgccatcctcagcttccta
cacatatggttcttcagcccatgcgtccattacatccttattatcacatactggctgcag
agcctatggagcatcgtactggacattggtgtccgcccattcctcactagtgctgcaagg
tgccacagtggaatcaggcttcgcctgacacaggaatga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112252651
Entry
112252651         CDS       T05605                                 

Definition
(RefSeq) caveolin-1-like
  KO
K06278  caveolin 1
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04144  Endocytosis
otw04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:otw00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112252651
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112252651
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112252651
Membrane trafficking [BR:otw04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    112252651
SSDB
Motif
Pfam: Caveolin DUF3169
Other DBs
NCBI-GeneID: 112252651
NCBI-ProteinID: XP_024279858
LinkDB
Position
6
AA seq 182 aa
MTGGLKDGETDEGFLHSQFIRKQGNIYKPNNKEMDNDSMSGMKTMQDVHTKEIDLVNRDP
KYLNDDVVKVEFEDVIAEPPGTYSFDGVWKASFTTFTVTKYWCYRLLTALVGIPLALVWG
IFFAILSFIHIWAVVPCIKSYLIEIHCVSRVYSICIHTFCDPLFEAMGKCFSSVRISTTK
GV
NT seq 549 nt   +upstreamnt  +downstreamnt
atgactggtggactcaaggacggtgaaactgacgagggatttctgcactcgcagttcatc
aggaaacaaggaaacatatacaaaccaaataacaaagagatggataacgacagtatgagc
gggatgaagacgatgcaggacgtccacacgaaagagatcgacctggtgaaccgggacccc
aaatacttaaacgacgacgttgtcaaggtggagttcgaggatgtgatcgcggagcctcca
gggacatacagcttcgacggcgtgtggaaggccagcttcaccaccttcacggtgaccaag
tactggtgctaccgtctccttaccgccctggtgggaatcccgctggcgctggtctggggc
atcttcttcgccatcctgtccttcatccacatctgggcggtggtgccgtgcatcaagagc
tatctgatcgagatccactgtgtcagccgtgtttactccatctgcatccacaccttctgc
gatcctctgtttgaagccatgggcaagtgcttcagcagcgtccgcatcagcaccaccaag
ggggtgtag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112252652
Entry
112252652         CDS       T05605                                 

Gene name
cav2
Definition
(RefSeq) caveolin-2
  KO
K12958  caveolin 2
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04144  Endocytosis
otw04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:otw00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112252652 (cav2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112252652 (cav2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112252652 (cav2)
Membrane trafficking [BR:otw04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    112252652 (cav2)
SSDB
Motif
Pfam: Caveolin MtrC
Other DBs
NCBI-GeneID: 112252652
NCBI-ProteinID: XP_024279860
LinkDB
Position
6
AA seq 162 aa
MGIEKENYETSIIMDEDEFNRSIEPILSKKDKVYAAIPDRDPNDINAHLKVGFDDVIAEP
SSSHSFDRVWIGSHAVFELFKYVFYRILTTILAVPMAFIIGIVFGVLSCIHIWVLMPVVR
SCLMALPSVQVVWSSLTDIFVNPLFHSMGRCLSSVHVKAMDN
NT seq 489 nt   +upstreamnt  +downstreamnt
atgggtatcgaaaaggagaattacgagacgagtattatcatggacgaggacgagttcaac
agatcaatagaaccgattttgtcgaaaaaagacaaagtttacgcggcgatcccagaccga
gatcccaatgacataaatgcgcacttaaaggttggttttgacgatgtgatcgcagagccc
agttccagccacagcttcgacagagtatggataggaagtcacgccgtcttcgaactgttc
aaatatgtattctaccgaatactgaccaccatcctcgccgttcccatggcatttatcatc
gggatagtcttcggggtcctcagctgtattcatatttgggtgttgatgccggtggtgcgg
agctgtctgatggccctgccctctgtccaggtggtctggagcagccttacagacattttt
gtcaaccccctcttccacagtatgggcaggtgtctgtcctctgtccacgtcaaggccatg
gacaactga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112254822
Entry
112254822         CDS       T05605                                 

Definition
(RefSeq) caveolin-2-like isoform X1
  KO
K12958  caveolin 2
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04144  Endocytosis
otw04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:otw00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112254822
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112254822
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112254822
Membrane trafficking [BR:otw04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    112254822
SSDB
Motif
Pfam: Caveolin HCV_NS5a_C DUF4491 TcpE
Other DBs
NCBI-GeneID: 112254822
NCBI-ProteinID: XP_024283477
LinkDB
Position
7
AA seq 189 aa
MMRKTDPVETNIDLGDTDDEDLDADLYEEHEEPQLLWKAELGDRMDEVEAVSPLVDLSDI
KPLLNERDPRGVNKCLKVSFEDVIAEPASVRSGDRVWIWSNALFEVTRVWIYRIVTVLLA
VPVSIITGLIFAILSFLHIWFFSPFVHHILIITYWLQSLWSIVLDIGVRPFLTSAAKCYD
GIRLRLTLE
NT seq 570 nt   +upstreamnt  +downstreamnt
atgatgagaaagacagatccagtggagacaaatattgacctgggagacactgatgatgaa
gaccttgatgcagacctgtatgaggaacatgaggagcctcagctgctatggaaggctgaa
ctgggggacaggatggatgaggtggaagctgtgtccccgttagtggatcttagtgacatc
aagcccctcctgaatgagagagaccctcgaggagtcaacaagtgtttgaaggtgagcttt
gaggatgtgatagcagagccggcgtcagtacgtagcggagacagagtgtggatctggagc
aacgccctgttcgaggtcaccagggtctggatctaccgcatagtgaccgtcctgctggcc
gtccctgtatccatcatcaccggactgatcttcgccatcctcagcttcctacacatatgg
ttctttagcccattcgtgcatcatatccttataatcacatactggctgcagagcctatgg
agcatcgtactggacattggtgtccgcccattcctcactagtgcagcaaagtgctacgat
ggaatcagacttcgcctgactctggaatga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112254824
Entry
112254824         CDS       T05605                                 

Definition
(RefSeq) caveolin-3-like
  KO
K12959  caveolin 3
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04144  Endocytosis
otw04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:otw00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112254824
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112254824
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112254824
Membrane trafficking [BR:otw04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    112254824
SSDB
Motif
Pfam: Caveolin
Other DBs
NCBI-GeneID: 112254824
NCBI-ProteinID: XP_024283481
LinkDB
Position
7
AA seq 154 aa
MTATMADINNGYEQRFQANGHHKEIDLINRDPKQVNEDVVKVDFEDVIAEPDGTHSLDGV
WKASYTTFTVSKYWCYRILSAILGIPVALLWGFLFACLSFCHIWAVVPCIKSCLIESQCL
SRIYSLAIHTFCDPLFEALAKIFSSVRVVLRKEV
NT seq 465 nt   +upstreamnt  +downstreamnt
atgactgcaaccatggctgacatcaacaatggttatgaacaaaggtttcaggcaaacgga
catcataaagagattgacctgatcaacagagaccccaagcaagtcaacgaggatgtagtg
aaggtggactttgaggatgtgatcgctgagcctgatgggactcacagtctggatggggtg
tggaaagccagttacaccaccttcactgtgtccaaatactggtgctaccgcatcctatca
gccattttggggatcccagtggctctgctgtggggcttcctattcgcttgcctctccttc
tgccacatctgggccgttgtgccatgcattaaaagctgtctgatcgagtcccagtgtctg
agccgtatctactccctggccatccacaccttctgtgaccccctattcgaagccctggca
aaaatattctcaagtgttcgagtggtgctacggaaggaggtgtag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112255282
Entry
112255282         CDS       T05605                                 

Definition
(RefSeq) caveolin-2-like
  KO
K12958  caveolin 2
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04144  Endocytosis
otw04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:otw00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112255282
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112255282
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112255282
Membrane trafficking [BR:otw04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    112255282
SSDB
Motif
Pfam: Caveolin
Other DBs
NCBI-GeneID: 112255282
NCBI-ProteinID: XP_024284073
LinkDB
Position
7
AA seq 149 aa
MVVNLQSDPPALHPLSQPSEVTPVKDRDPRGVNKCLKVTFEDVIAQPPSVRSFDNVWLWS
HALFEVSRLWCYLLISILLAVPVSLVAGILFTVLSCLHIWLIMPCMQLFLINMHWVQTVS
SSVLNIAMTPFFKSMGKCCGSINVRLARD
NT seq 450 nt   +upstreamnt  +downstreamnt
atggtggtcaacctccagagtgacccccccgcccttcatcctctgtcccagcccagtgaa
gttacaccagtgaaggacagggacccaaggggagtcaacaagtgtctaaaggtgacgttt
gaggacgtgatagctcagcccccctcggtgcggagcttcgataatgtgtggctgtggagc
cacgccctgtttgaagtgtcccgtctctggtgctacctgctcatctccatcctcctggcc
gtacccgtctctctggtagcagggatcctcttcactgtcctcagctgcctacacatctgg
ctgatcatgccctgtatgcagctcttcctgatcaacatgcactgggttcagactgtttcg
agcagtgtgttaaacatcgccatgactcccttctttaagagtatgggaaagtgctgtggt
agcatcaacgtccgactagccagggactga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112255496
Entry
112255496         CDS       T05605                                 

Definition
(RefSeq) caveolin-3-like
  KO
K12959  caveolin 3
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04144  Endocytosis
otw04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:otw00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112255496
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112255496
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112255496
Membrane trafficking [BR:otw04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    112255496
SSDB
Motif
Pfam: Caveolin
Other DBs
NCBI-GeneID: 112255496
NCBI-ProteinID: XP_024284243
LinkDB
Position
7
AA seq 191 aa
MRGLPAVCFSGFTLTVLCPSPPPPTTLPASAPAQAHGPTMADQYQFNTNEEKFVKDSHTK
EIDLINRDPKLINEDVIKVEFEDVIAEPDGTHSLDGVWKLSYTTFTVSKYWCYRILSAIF
GIPVALLWGFLFACISFCHIWAVVPCIKSCLIESQCISRIYSLCIQTFCDPFFEALGKIF
SSVKVALRKEV
NT seq 576 nt   +upstreamnt  +downstreamnt
atgcgggggctgcctgcagtctgcttcagtgggttcacactcactgtcctctgccccagc
cctccaccccccactactctccctgcctctgccccagcccaggcccacggccccaccatg
gccgaccagtaccagttcaacaccaacgaggagaaatttgtgaaagacagccacaccaag
gagatcgacctgatcaacagagaccctaaattgatcaatgaggatgtgatcaaggtagag
tttgaggatgtaatcgcagagcctgacggcacacacagtctggatggggtgtggaagctc
agctacaccaccttcaccgtgtccaagtactggtgctaccgcatcctctcagccatcttc
ggcatccctgtggccctgctctggggcttcctcttcgcctgcatctcattctgtcatatc
tgggccgtggtgccctgcatcaagagctgcctgatcgagtcacagtgcatcagtcgtatc
tactccctctgcatccagaccttctgtgaccccttctttgaagccttgggcaaaatcttc
agcagtgtgaaagtggccctgcgcaaagaggtctag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112262828
Entry
112262828         CDS       T05605                                 

Definition
(RefSeq) caveolin-2-like
  KO
K12958  caveolin 2
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04144  Endocytosis
otw04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:otw00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112262828
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112262828
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112262828
Membrane trafficking [BR:otw04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    112262828
SSDB
Motif
Pfam: Caveolin
Other DBs
NCBI-GeneID: 112262828
NCBI-ProteinID: XP_024294383
LinkDB
Position
2
AA seq 184 aa
MTTGRTPAETRLDLEDIEEQGIPPGRHTAEGLLEEVVEVEAEEPAQEEDSTQSHIRALVK
NRDPRGVNKCLKVTFEDVIAEPPSVRSFDKVWLWSHALFEVSRLWCYRLISLLLAVPVSL
VAGILFAVFSCLHIWLITPFIQLFLINMHWVQTVWGSVLDIAIAPFFKSMGKCCSSINVR
LARD
NT seq 555 nt   +upstreamnt  +downstreamnt
atgaccacggggcgtacaccagctgagaccaggctagacctggaggacatagaggagcag
gggatccctccaggcagacacactgcagagggactactggaggaagtagtggaggtagag
gcagaggaaccagctcaggaggaggactccacccagagtcacatcagggctctggtcaag
aacagggacccaaggggagtcaacaagtgtctaaaggtgacctttgaggacgtgatagca
gagcccccctcggtgcggagcttcgataaggtgtggctgtggagccacgccctatttgag
gtgtcccgtctctggtgctaccggctgatctccctcctcctggccgtgcccgtctctctg
gtagcagggatcctcttcgctgtcttcagctgcctacatatctggctgatcacgcccttt
attcagctcttcctgatcaacatgcactgggttcagactgtgtggggcagtgtattggac
atcgccatcgctcccttctttaagagtatggggaagtgctgcagtagcatcaatgtccga
ctggccagggactga

DBGET integrated database retrieval system