KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112215181
Entry
112215181         CDS       T05605                                 

Definition
(RefSeq) protransforming growth factor alpha-like
  KO
K08774  transforming growth factor, alpha
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112215181
   04012 ErbB signaling pathway
    112215181
SSDB
Motif
Pfam: DUF4840 Laminin_EGF EGF
Other DBs
NCBI-GeneID: 112215181
NCBI-ProteinID: XP_024229893
LinkDB
Position
2
AA seq 193 aa
MMNRAFWDVIFLITGSLFTYGTGQDNSTIATNSTMTTTPPVTTTTVNIMLFSTTTSTITT
TNLPVKKFVAAAVRSHFDDCPDSHSHFCFHGTCRFLILEETPACVCHQGFVGMRCEHADL
LAVVATNHRQQTVATALVLCVIGCVLTMLLCTLLHCWWRRDGLGRRHRLHCAPEKQDSRL
KGRGPCCHSESVV
NT seq 582 nt   +upstreamnt  +downstreamnt
atgatgaatcgggcattctgggatgtgatctttctcattactgggtccctctttacctat
ggaaccggacaggataattctactattgctactaattctactatgaccaccacccctcct
gtgactactaccactgtaaacattatgctattttctaccactaccagcaccattactaca
accaaccttccagttaaaaagtttgtggcagcagctgttcgatcacacttcgatgactgt
cctgactcgcacagccacttctgtttccatggcacctgtcgtttcctgattctggaggag
acccctgcatgtgtgtgtcaccaaggctttgtagggatgcgatgcgagcacgccgacctg
ctagccgtggtggccaccaatcacaggcaacagacagttgccacggcgctagtgctgtgt
gtgattggctgtgtcttgacgatgcttctctgtacacttttacattgctggtggaggcgg
gacggtttggggcggaggcacagactccactgtgccccagagaaacaagacagtaggctg
aagggccgaggtccctgctgtcactctgaaagtgtggtttga

DBGET integrated database retrieval system