KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112215221
Entry
112215221         CDS       T05605                                 

Definition
(RefSeq) integrin alpha-5-like
  KO
K06484  integrin alpha 5
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04145  Phagosome
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
otw04810  Regulation of actin cytoskeleton
otw05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112215221
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    112215221
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112215221
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112215221
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    112215221
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112215221
   04515 Cell adhesion molecules [BR:otw04515]
    112215221
   04090 CD molecules [BR:otw04090]
    112215221
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112215221
Cell adhesion molecules [BR:otw04515]
 Integrins
  Integrin alpha subunits
   112215221
CD molecules [BR:otw04090]
 Proteins
  112215221
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha Tudor_3
Other DBs
NCBI-GeneID: 112215221
NCBI-ProteinID: XP_024229918
LinkDB
Position
16
AA seq 1080 aa
MGSKRYHSKTPGKLNYSLFCIGVCLIILLPLCDTFNLDVENPSVYSGPNGSYFGYSVEFY
LTNSSSVSVVIGAPKANTSQFNITEGGSVYFCPWSLGQSECHNIEFDNQGDRIVTVSGTD
YQAEVKSHQWFGATIRSHGDTILACAPLYSWRTKAEKPQSDTTGTCYLSVKNFTKFVEYA
PCRTEFINQGGQGYCQGGFSADFTKDGKVVLGGPGSFFWQGQVISAAKEEIIKAYYPGYF
MQSVEGQTQTRQAQIKYDDSYHGYSVAVGEFSGDDVEDVVAGVPKGVMLYGLVSVLNGTD
LKSMLNYTGEQMGSYFGYTVSTADINNDGMSDLLVGAPMYMTRGSDGRLEEVGRVYLYLQ
RGPLDLEPTLNLTGTQVFGRFGSTIAPLGDLNLDGYNDLAISCPFGGEDQQGLVLIYNGF
AGGLRNTPSQVIAGQWASGTVPASFGFSLRGAKDQDMNGYPDLIVGAFGVDKAILYRSRP
IVNTSASLTVYPTMINPEEKSCSVNNGNTTIPVSCVNLSFCLSANGKYLPDNLGFLVEVQ
LDHLKHMQKGGVKRALFVDSQQAMLQRSVRVRSGERVCHETKIYLRDDKEFRDKLSSIYI
SLNFSLDPQAAFDSHGLRPILNYKTTEVIEPEPHPSALLSDPQRSTPTLEDSSESTAPAQ
ILLDCGEDNICVPDLKLAVHGDRKEVYLGDDNLLTLTFNARNEGEGGAYEAELYVLLPPE
ADYSGIARNNESLTQLTCSYEAENQTRYLSCDLGNPMKSGTSLWAGLRFTVPRLKDTRKT
VQFELQIRSKNENNSHSEVVPYKLEVVVQADVILQGVSRPDKVFFPPPNWKVSKTPQEEQ
DIGPVIQHVYELVNKGPSGISHTVLQLSCPLSVQGQGLLYPLEMSTEGPLNCTTNHSINY
LQLKLQQTSTEQPPLLVPGQDHHIERREVQRDQLAEHTNLSCSNVECWTLQCDVGLLEKG
TSAILKLRSRIWAETFIERAYKGYVLECLARFSVVKMPYAILPKEVPSGSKKVVTPLVWN
KQDSQYSVPLWIIILAILAGLLLLALLIYVLYKLGFFKRSLPYGTAMEKAQLKPQAASEA
NT seq 3243 nt   +upstreamnt  +downstreamnt
atgggttccaaaagataccattcgaagacaccgggaaaactgaactactcattattctgc
attggggtttgtctaataattctgctaccgttgtgtgatacattcaacttggacgtggag
aacccttctgtctacagcggacctaatgggagctactttggatattccgtggaattttac
ttgactaattcttcaagcgtcagtgtagtgattggcgctcccaaggccaataccagtcag
ttcaacatcacagagggcgggtctgtgtacttctgcccatggagtctcggccaatctgag
tgccacaacattgaatttgacaatcaaggggaccgcatagtcactgtcagtggcacagac
taccaggctgaagtcaagtcccaccagtggttcggcgccaccatccgttcccacggagac
accattctggcctgtgcccccctctactcctggagaaccaaagcagaaaagccacagtcc
gataccacgggaacctgctacctctctgtcaagaacttcaccaagtttgtggaatatgct
ccctgtcgcacagaattcattaaccagggtggtcagggctactgtcaggggggattcagt
gctgatttcacaaaggatgggaaagtggtgcttggaggaccaggcagcttcttctggcaa
ggtcaggtgatctcagcagccaaagaggagataatcaaggcctactatccagggtacttc
atgcagtctgtggagggacagacccagaccagacaggctcagatcaaatatgacgacagc
taccacggttactctgttgcagttggggaattcagtggagatgacgtggaagatgttgtg
gctggggtcccaaaaggggtcatgctctatggtttggtgtctgttttaaatggcactgat
ctgaagtccatgctcaactacactggcgaacagatgggctcctattttgggtatactgtg
tccacagccgacatcaataacgacggcatgtctgacctgttggtgggagctcccatgtac
atgacccgagggtcagacggccgtctggaggaggtgggacgtgtgtacctctatctgcag
cgtggaccactggacctggagccaactctcaacctgaccgggacccaggtgtttgggagg
tttggcagcaccatcgcacctctgggagacctcaacctggatggatacaatgacttggcc
atcagctgtcctttcggtggagaggaccagcagggattggttctcatctacaacggattc
gccggtgggctcaggaacacaccctctcaggtcatagctggccaatgggcttcaggcaca
gtgccggccagctttggattctcactccgaggtgctaaggatcaggacatgaatggctac
ccagatcttattgttggtgctttcggagttgacaaggcgattttgtacagatcccggccc
atcgtcaacaccagtgcctccttgaccgtctatcccacaatgatcaaccccgaggagaag
agttgttcagtcaacaacggcaacaccaccatacctgtctcttgtgtcaacctgagtttc
tgcctctctgccaatgggaagtacctaccagacaacctaggcttcctggtagaggtgcag
ttggaccatctgaaacacatgcagaagggaggggtgaagagggctctgtttgtagactcc
cagcaggcaatgcttcagaggagtgtgagagtgcggagcggagagcgtgtgtgtcacgag
accaagatctacctgagggatgacaaggagttcagagataagctctcctccatctacatc
tccctcaacttcagtctggatcctcaggcagcgtttgactcccacggcctcagacccatc
cttaactacaagaccaccgaagtaatcgagccagaaccacacccttccgcccttctgtct
gacccccagcgcagcactccaaccttggaggactcctctgagtcaacagcccctgcccag
attctgctggactgtggagaagacaacatctgtgttcccgacttaaaactggcggtgcac
ggggacaggaaggaagtgtacctaggtgacgacaacttgctgaccttgactttcaacgcg
cggaacgagggtgaaggtggggcctatgaggctgaattgtatgtgctgttacctcctgaa
gcagactacagcggtatagctcgcaataacgagagcctgacccagctgacctgtagctac
gaggctgagaaccagacccgctacctcagctgtgacctgggcaatcccatgaagtctggc
accagcctgtgggcaggcctgcgtttcactgtgccacgactgaaggacacacgcaagacg
gttcagtttgagctgcagatccgcagtaaaaatgagaataattcccacagtgaggtggtg
ccctacaagctggaggtggttgtccaggccgatgttattttacagggtgtctcccggcca
gacaaggtcttcttccctccacccaactggaaggtctccaagaccccccaggaggagcag
gacattgggcctgtaatccaacacgtctatgaattggtgaacaaaggtcccagtgggatc
agccacacagtgctgcagctcagctgtcctctcagtgttcagggccagggtctcctctac
cccctggagatgtctactgagggaccactcaactgcaccaccaaccactccatcaactac
ctgcagctcaagctccagcagacttccacagagcagccgcccctacttgtgcctggtcag
gatcaccacatcgagaggagagaagtccagagagaccagctggcagagcacacgaacctg
tcctgctctaacgtggagtgctggacactgcagtgtgatgtgggtcttctggagaagggg
accagcgccatcctcaaattgcgctcccgcatctgggctgagaccttcatcgagagggca
tacaaggggtacgtgttggagtgcctggcaaggttcagtgtggtcaagatgccctatgcc
atcttgcccaaggaggtaccgagtggatctaaaaaggtggtgaccccgttggtgtggaac
aaacaagacagccaatactctgtgcccttgtggatcatcattctggccatactggctggg
cttctgctgctggcactgctcatctacgtcctgtacaaacttggcttcttcaaaaggtcg
ctaccctacggcacggctatggagaaggcccaactcaagccccaggctgcgtctgaggcc
taa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112218294
Entry
112218294         CDS       T05605                                 

Gene name
itga11
Definition
(RefSeq) LOW QUALITY PROTEIN: integrin alpha-11
  KO
K06587  integrin alpha 11
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112218294 (itga11)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112218294 (itga11)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112218294 (itga11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:otw04515]
    112218294 (itga11)
Cell adhesion molecules [BR:otw04515]
 Integrins
  Integrin alpha subunits
   112218294 (itga11)
SSDB
Motif
Pfam: Integrin_alpha2 VWA FG-GAP VWA_2 VCBS FG-GAP_2 Ku_N
Other DBs
NCBI-GeneID: 112218294
NCBI-ProteinID: XP_024234725
LinkDB
Position
19
AA seq 1190 aa
MEYYCSLLLWTCALLPGLLQCFNFDTKKYKIIEGSKEAQFGYTVQQHEAGGQKWLLVGAP
FETSGQHQTGDIYKCPMDTSPNTNCTRLNLGKVSLNNVSERKDKMRLGMTLTSNPKDNSF
VTCGPLWSYECGSSYYSTGICSRVNESFKFSKTISPAFQRCETYMDIMIVLDGSNSIYPW
YEVQDFLINILQKFYIGPGQIQVGVVQYGSRVVHEFTLNDFRSVEEVVEAAKTIDQRGGE
ETRTALGINVARTEGFKRGGRKGAKKVMLVITDGESHDSPDLQKAMEDTEADNITMYAIA
VLGYYNRRGINPEAFLKEIKYIASDPDDKHFFNVTDESALKDIVDALGERIFSLEGVNPN
GTGFGLQMSQAGFSSHIVEDGILVGAVGAYDWNGAVLKETRHGKVVPPKSSYLEEFPEEL
KNHGAYLGYTVNSVVSAKGRQLYVAGAPRFNHTGKVIIFTLRNNGNLTILHSLKGQQIGS
YYGSELAPLDIDGDGVTDFLLVAAPMFFSKGWERGKVYIYRVTQQNHFLLEGTLEVSDQS
QNSRFGGAMAPIPDMNGDSYSEVVVGAPLEDDHQGAIYLFYGQLSGIHHKYRQVKIGAAG
FSAGLQYFGRSVHGMMDVNEDGLVDLAVGALGAAVLIWSRSVVRIQGKITFEPEKINTFN
KDCRRGGKDVTCMSAIVCISLEARTRMQSHGVGVWYRVLIDERRHPPRASLDDNDRQQQS
RNLTLQRGEESCEHVHFYVQETADYGHPIVFVVKVGLQSPDQGPVLDHGWPTTFRTEIAF
WNGCEGDDSCVPDLILHSRTDLLDRRQFCRPRERAAWALCHHQGASVGSERVVEASRRRL
VVEARLENQGENAYGTTLNISHSHNLLFSSLIVKDHSDIQIECRAEDRERNDRTCNVSSP
FMRSLTQVSFRLEFELSHSVFLXHVRVVLQAASDGEEMSPDDNINNIFHPLKYEADLLFT
RDSKPPRFEINSDHYRNKPGSSGPMFNLTYHIQNLGFFPVTDLQFAVDVFAVTKSGNHLF
QIANIDTDQAVSSNCVLPNHMTPSHVFPEDLSHVPQLNHSNSMTLPMQCRLNVPAYREVR
VTVRGRLHLQALFAVKFKTLELVTAASIELSPSSPVFLHEERPTRHIILEMRKEEDYKIP
IWIIVGSTLGGLLLLALLILALWKLGFFNRQKQREEEEEQVGNGKMPEER
NT seq 3573 nt   +upstreamnt  +downstreamnt
atggaatactactgcagcctgctgctgtggacctgtgccctcctgccaggccttctgcaa
tgcttcaattttgacacaaaaaagtacaagatcattgaaggctccaaagaggcccagttt
gggtacacagtgcagcagcatgaggcaggaggacagaagtggctactagttggagctccc
tttgaaaccagtggccaacaccagacaggcgatatatacaaatgcccgatggacaccagt
cccaacaccaactgcactagactcaacctaggaaaggtatccctgaacaatgtgtcagag
cgcaaggacaaaatgaggctgggcatgacactgacctccaaccctaaggacaacagcttt
gtgacctgtggtcctctgtggtcgtacgaatgtggaagctcctactacagcacaggcatc
tgctccagggttaacgaaagcttcaagttctccaaaaccatctcgccggcctttcagagg
tgcgagacctacatggacataatgattgtcctggacgggtccaactccatctacccttgg
tatgaggtgcaggacttcctcatcaacattctgcagaagttctacattgggccaggtcag
atccaggttggagtggtgcagtatgggtcgagggtggtccatgagttcaccctgaatgac
tttcgctctgtggaggaggtggtagaagcagccaagaccatcgaccaacggggaggggag
gagacacgcacggccctgggcatcaatgtggcacggacggagggatttaaacggggaggt
cggaaaggggctaagaaagtgatgctcgtgattacggatggtgaatcccacgacagccct
gacctgcagaaggccatggaggacactgaggcggacaacatcaccatgtatgccatcgct
gtattgggctactacaatcggcgcgggataaacccagaggccttcttgaaagagatcaag
tatatcgccagcgatcctgacgacaaacacttcttcaatgtgaccgatgagtcggcgcta
aaggacatagtggacgccctgggagagaggatcttcagtctcgagggagtgaaccctaac
gggacggggttcggtctgcagatgtctcaggcaggcttctcatcacacatagtggaggat
ggcatattggtgggggccgtgggggcctatgactggaacggggctgttctgaaagagaca
cgtcatgggaaggtagtcccacccaagtcctcctatctggaagagttcccagaagaactg
aagaaccatggggcctacttgggttacacagtaaattcagtggtgtcggccaaaggcagg
cagctctatgttgctggagcccctcgcttcaaccacacaggcaaagtcatcatctttacc
ctgagaaacaatggcaacctcaccatcctacactcactcaaaggccagcagattgggtca
tactacgggagtgagctagctcctctggacatcgatggggacggtgtgacagacttcctc
ctggtggcagcgcccatgttcttcagtaagggctgggagaggggcaaggtgtacatctac
agggtgactcagcagaaccatttccttttggaagggacacttgaggtctccgaccagtcc
cagaactctcgttttggtggagcgatggcccctatccctgatatgaatggtgactcgtac
agtgaggtagtggtgggagctcctctagaggacgatcaccagggggccatctacctgttc
tacggccagctcagtggcatacatcacaaatacagacaggtgaaaattggagcagcaggc
ttctctgctggtctgcagtattttggccgcagtgttcatgggatgatggatgtcaatgaa
gacgggttggtggacttggcagtgggcgcattaggtgcagcagtactgatctggtctcgc
agtgtggtgcgcatccaaggaaaaatcacttttgaaccggaaaagatcaataccttcaac
aaggactgccgcaggggaggcaaggacgtcacctgcatgtctgccatcgtgtgtatcagt
ctggaggccaggactcggatgcagagccatggagtgggtgtgtggtacagggtgctgata
gacgagaggaggcaccctcccagagcatcgctggatgacaatgacagacaacagcagtca
aggaatctgacactacaacgcggggaggagtcctgtgaacatgtccacttctatgttcag
gaaactgcagactacggccatcccatagtgtttgtggtgaaggtaggactgcagagtcca
gaccaaggcccggtgctggaccacggctggcccactacctttaggactgagatcgccttc
tggaatggctgcgagggggatgacagctgtgtccctgacctcatcctgcacagtcggaca
gaccttctagaccgcaggcagttctgtaggccaagggagcgggccgcatgggcgctgtgt
caccaccagggggcctcggtgggctcggagcgagtggtggaggcatcacgcaggaggctg
gtggtagaagctcgtctggagaaccaaggagagaacgcctatggcaccacgctcaacatc
tcccactcccacaacctgctcttctccagtctcatagtcaaggaccactcagacatccag
attgaatgtcgtgctgaggacagggagaggaacgataggacctgcaatgtcagctcaccc
tttatgaggtcactgacccaggtgtctttccggctggagtttgagttgagtcactctgtc
ttcctgngacatgtgagggttgtcctgcaggctgccagcgatggggaggagatgagccca
gacgacaacatcaacaacatatttcatcccctgaagtacgaggcagacctcctgttcaca
agggactccaagcctcctcgttttgagatcaactcagaccactaccggaacaaacccggc
agcagtggtccaatgtttaaccttacttatcacatccagaatctgggcttcttcccagtg
acagacttgcagttcgctgttgacgtgtttgctgttacaaagagtggtaaccatctcttc
cagattgccaatatcgacactgaccaggcggttagctctaactgtgtcctcccaaatcac
atgactccaagccatgttttccctgaagatctctcacacgtcccacagctgaatcactcc
aacagcatgacgttgccaatgcagtgcagactcaacgtgcctgcgtacagggaggtcaga
gtgacagtcagggggcgtctgcacctccaagctctctttgctgtgaagtttaaaactctg
gagttggtgacagcagcctccatagaactgagtccgtccagtcccgtgttcctgcatgag
gagaggccaacacgacacataatcctggagatgagaaaggaggaagattacaaaattccc
atctggattatagtagggagcacactgggtggtctgctgctgctagccttgctcatcctg
gctctatggaagcttggcttcttcaacaggcagaaacagagagaggaagaggaggagcaa
gtaggcaacgggaagatgccagaggagcggtaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112219683
Entry
112219683         CDS       T05605                                 

Gene name
itga1
Definition
(RefSeq) integrin alpha-1 isoform X1
  KO
K06480  integrin alpha 1
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112219683 (itga1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112219683 (itga1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112219683 (itga1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112219683 (itga1)
   04515 Cell adhesion molecules [BR:otw04515]
    112219683 (itga1)
   04090 CD molecules [BR:otw04090]
    112219683 (itga1)
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   112219683 (itga1)
Cell adhesion molecules [BR:otw04515]
 Integrins
  Integrin alpha subunits
   112219683 (itga1)
CD molecules [BR:otw04090]
 Proteins
  112219683 (itga1)
SSDB
Motif
Pfam: Integrin_alpha2 VWA FG-GAP VCBS VWA_2 FG-GAP_2
Other DBs
NCBI-GeneID: 112219683
NCBI-ProteinID: XP_024236930
LinkDB
Position
20
AA seq 1188 aa
MLGRMQYIKLTTALALLPCVFSFNVDDKNGLNFHGSLEDMFGYSVQQFENSEGKWVLIGS
PLAGQPAKRTGDVYKCPVDRGPNPKCIKLELPENTTIPNLHEVKDNMTMGTTLVTNPQGG
FLACGPQYGYMCGQQTYISGVCTNVSSTFQVLNSIAPAVQECAKELDIVMVLDGSNSIWP
WNSIIEFLVKFLKNIEIGPKLSQVGIVSYGEQVIHNVNLSQFNNTLSLLGKVMNLEQQQG
VRTMTFLGIDTARKEAFTVERGARPGVKKVMIIVTDGESHDSHNLKNVTAECEKDDIERF
GIAVLGDYNRNNRSITEVKKFIEEIKNISSDPVGDHFFNVSDEFALLTIVDALGSRIFAL
EATSGNYTSSFEMEMSQAGFSAHNSKEGVMLGAVGAYEWNGTVVMHTDQGTMVPLNADFH
DPLDERKESLAGYVGYDVQSASTPNGVLYITGAPRHNHTGRVIVYKLDGQHITVTQVLKG
EQIGSYFGSVLQTVDVDQDSYTDILLVGAPMYMGPEREEQGQVYVFKLNEKGMFEHQATL
KPDNQTCCTSAHSHGCTNVRTNDPCGARFGTAIAEVSDLDLDGNRDVAIGAPFENDHRGA
VYIYHGAKKTIKEKYVQRIPGPGDGVKTKFFGQSIHGVMDLNGDGIIDVTIGGLGGASLF
WSKDVAELYANMTFDPSKINLQQPSKGCMLGGRETVCVKTRVCFSYSVKSEKDDTNSGTA
IKYSLTLDSLRAKSRAAFVNIDEKSERKAQATAKIIDNLCVEHLFAMKAKLDFRDPIMVS
LEFGLAEDTGPVLDGDLPTSLNKTIPLVDCGTDDKCIADLSLKAVPSIQSLVIKANKEKF
HVLITTRNSKDNAYNTKVMLSFTENINYVKVEPKEKDCSLNNTKVECAVGYPFLKSNVEE
VFKILFEVNPAHIWKEIQINVTATSDSDEVNSTLFDNSVRISIPVKYEAGLRFTTDRHMK
EDHIIVKEGEQHPRVFNGTSVIGEEVKISYTINRDVDMATPPLKLRVKYPYLSPRENILL
YLTRVTSSQDVRCHAGHLINPLKINHNNVHTLNLKKETLSDFLVGCKDHPCESFDCSIPH
VNNSQVNVTFRVWKPTFIKAEFTSLHMIVHATLENQNMDLFMLSTANNARDVKIQVSKEA
LGGIPLWIIIVSILIGLLILALVIIALWKAGFFKRKSMEDMEKEDMKN
NT seq 3567 nt   +upstreamnt  +downstreamnt
atgctcgggcgaatgcagtatattaaattaacgacagcactcgcgttgctaccgtgtgtg
ttctcctttaacgtggatgacaagaatgggctgaatttccatggttcgctggaggacatg
tttggatactcagtccagcagtttgagaacagtgaagggaaatgggtacttatcggttct
cccttggccggccagccagccaaacggactggagatgtctacaaatgccctgtggatcga
ggaccaaaccctaaatgtatcaaactggagctgcctgaaaacacaacaattcctaactta
cacgaagtcaaggataacatgaccatgggaacgacgctggttaccaaccctcaaggaggc
tttctggcttgtggtccccagtacggctacatgtgtggtcagcagacgtacatctctggg
gtatgtaccaacgtcagctcaaccttccaggtactcaactccatcgccccggccgtgcaa
gagtgtgccaaggagcttgacattgtcatggtgcttgacggctccaatagtatatggcca
tggaacagcatcattgagttcctggtcaagtttctgaaaaatatcgaaattggacctaaa
ctgtcccaggtgggcattgtgtcgtatggagagcaagtcattcacaatgtgaacctcagc
cagtttaataacactctatccctgctgggaaaagtgatgaatcttgaacagcaacagggt
gtcaggaccatgaccttcctgggtatcgacacagcaaggaaagaggccttcaccgtggag
cgaggggcgcggcccggggtcaagaaggtcatgataatcgtgacggatggagagtcacat
gactctcataacctcaaaaatgtcaccgcagaatgcgagaaagacgacattgagaggttc
ggtattgcagtgcttggtgattacaacaggaacaacagaagcatcactgaggtgaaaaag
ttcattgaggagatcaagaacatctccagcgatcctgtgggagatcacttcttcaacgtg
tccgacgagtttgccttgctcaccatcgtagacgctctgggaagcaggatctttgccttg
gaagcaacgtcaggtaactacacctcgtcgtttgagatggagatgtcccaggcaggattt
agtgcccacaactctaaggagggtgtgatgctgggagcagtgggagcgtatgaatggaac
gggacagtagttatgcacacagaccagggtaccatggttcccctaaacgcagacttccat
gaccccctggacgagaggaaggagagcctggcggggtatgtgggttatgatgtgcagtcg
gcatcaactcctaatggtgtattatatatcacgggggcaccgcggcacaaccacacaggc
agagtcatcgtgtacaaactggatgggcaacacatcacagtcacacaagtgctgaaagga
gagcagattggctcctactttggcagcgttctccagacggtggatgttgaccaggactcg
tacacagacatcctgctggtgggagctcctatgtacatgggcccagagagggaggaacag
ggacaggtgtacgtcttcaaactcaatgagaagggcatgtttgagcaccaggccacgctg
aagccggacaaccagacgtgttgtacctcggcccactcccatggctgcaccaacgttcgc
acgaatgacccgtgtggcgcccgtttcggcaccgccatcgccgaggtcagcgacctggac
ctggacgggaaccgggacgtggccatcggggcaccgttcgagaatgaccacagaggagcc
gtctacatctaccacggagccaagaagacgatcaaggagaaatacgtccagcgtatccca
ggtcctggagacggagtgaagactaaattctttggccagtcaatccatggagtcatggac
ctgaacggagatggaatcatagacgttaccatcggaggtctgggaggcgcttctctgttc
tggtccaaggatgttgctgagctttatgccaacatgacctttgacccgagcaagatcaac
ctacagcagccctctaaaggctgcatgttgggcgggagggaaactgtgtgtgtgaagacc
agggtctgctttagctacagcgtcaagtctgagaaggatgacactaactcgggcacagcc
attaagtacagcctgacgctggactctctgagggcgaagtcgagggctgcgtttgtcaac
atagacgagaaaagtgagaggaaggcccaggccaccgccaagatcatagacaatctgtgt
gtggagcatttatttgccatgaaggctaaattggacttcagagacccaatcatggtctcc
ctagagtttggcctggctgaggacacgggtcccgtcctggatggagatctaccaacgtca
cttaacaaaacgattcctttggtggactgtgggaccgatgacaagtgcatagctgaccta
tcgctgaaggctgtgccaagtatacaaagtcttgtgattaaagcgaacaaggagaagttc
cacgttctgatcaccactagaaacagcaaagacaatgcgtacaacaccaaagttatgctg
agctttactgaaaacataaactacgtcaaggtcgagcccaaagaaaaagactgtagtcta
aataataccaaagttgagtgtgctgtgggatatccattcctcaaaagcaatgtagaggag
gtctttaagatcctgtttgaagtcaaccctgcacatatctggaaggaaattcagatcaac
gtaactgcaaccagtgacagcgacgaagtgaacagcaccctttttgataactctgtgaga
atctccatccctgtgaagtacgaggctggacttagattcacaactgacaggcacatgaag
gaggaccacatcatagtgaaagagggagagcagcaccccagggtcttcaacggcaccagt
gtgataggagaagaggtcaagatcagctacacgattaatcgggatgtggatatggcgact
cctcctctgaagctaagggtgaagtacccgtacctctctcccagagagaacatcctgctt
tacctgactcgtgtcacctcctcacaggatgtgagatgccatgccggccatctgattaac
cctttaaagatcaaccacaacaatgtccacactctcaaccttaaaaaagagaccctcagt
gacttcctggtgggctgtaaggaccacccatgtgagtcatttgactgctccatccctcac
gtcaacaacagccaggtcaatgttaccttcagggtgtggaagcccacctttatcaaagca
gagttcaccagccttcatatgatagttcatgccaccctggagaaccagaacatggatctc
ttcatgttgagcaccgcgaataacgccagagatgtgaagatccaggtgtctaaagaggct
ttgggaggtataccgctgtggatcattatagtcagcatcctaataggacttctcattctg
gcactggtcatcatcgccctatggaaggctggatttttcaaaagaaaatccatggaggac
atggagaaggaggacatgaagaattaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112219685
Entry
112219685         CDS       T05605                                 

Definition
(RefSeq) integrin alpha-2-like isoform X1
  KO
K06481  integrin alpha 2
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04145  Phagosome
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112219685
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    112219685
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112219685
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112219685
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112219685
   04515 Cell adhesion molecules [BR:otw04515]
    112219685
   04090 CD molecules [BR:otw04090]
    112219685
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   112219685
  Exosomal proteins of bladder cancer cells
   112219685
Cell adhesion molecules [BR:otw04515]
 Integrins
  Integrin alpha subunits
   112219685
CD molecules [BR:otw04090]
 Proteins
  112219685
SSDB
Motif
Pfam: Integrin_alpha2 VWA FG-GAP VWA_2 VCBS FG-GAP_2 Integrin_alpha
Other DBs
NCBI-GeneID: 112219685
NCBI-ProteinID: XP_024236933
LinkDB
Position
20
AA seq 1207 aa
MELNPKRTVLTLLLIQCWSIPRSLSFNVGTAGAKVFSGPALEEFGYTVKQFRNHQGKWLL
VGSPWSGYNQDRKGDIYKCEIRGSSSGCQRLNLQNSVSMSTVKNINVNMSLGLTLTHTAT
EDKFMTCGPLWAQKCGSQYYYPGICAEVNPLFNPLSSFSPALQTCGGPMDIAIIVDGSNS
IYPWPPIVAFLKKLLENLDIGPDNTQASIIQYGVEPVVEFHLNAYKTKDSIIAAAANILQ
REGLETNTFRAIEFARQNAFLPGNGARPGASKVMVVVTDGESHDKNLRDDVIRKCESEKI
TRFGIAVLGYYIRNDIDTKNLIAEIKSIASTPTDRYFFNVSAEEALLEIAGSLGDRIFNI
EGTGKGGDFQMEMSQVGFSAHQTKKQNMIMLGAVGAYGWSGTVVHYTTQKSDIFPKTAFE
RILEDRNHSSLLGYSVTSAGHCYTFVHNIPSGYSVTTLNDGSIEYYVAGAPRSNHTGQVI
VYIINGKGQPTVIDSQRGDQIGSYYGSVLCPLDVDKDGVSDLLLVGAPMFMNEQQKEIGK
VHLLSFTKGILSVQGFLKGPSPVENARFGMSVSAVPDLNMDGYSDVVVGAPLEDNNKGVI
YVFNGDKKRLRTQYSQKILGSKLDPALQYFGRSMDASSDLNDDTIPDVSVGAYGMVVQLW
SRGMAVVTARATFNPDTVSILSKTCRVSGRLVSCFNTSVCFSATFRPKIPVGPVAIRFNL
TLDAELQSSRVTSRGQFRNSERVLQKDIRVSTREVCETLEVFVQEAPDFVSSIGLRVDIT
LQDPDSSPVLDVLSPTAWEFFIPFSKDCGSDDVCLSDLLLKLKKGEMIPSSSRMLVSFKD
KRLSFTVSVTNKKENAYNTQVTATYSKNLFFASISPPSDGTEVKCTSTKESLTLSCQVGY
PALRQNQEVTFGINFDFNLNQLQTEADVSFEALSDSTEANPSDNQASISVPVHYDSEISL
SREANLNFYVVDMDNEAKTAVNTFNDIGPEFKFSLKVSTGNFPVSLAYLTVSLPSATARG
NPLLYVTGVKTEPAGEVSCEVTSLVNPLKISEKPYTASFSKENLMGTEDLNCKTAKCQPM
KCVLKDMGIKSDFFVNVTTRIWNGTFAASSFQSTVLTVSTEIETSEPELLVVSHKHLTVG
VTISKPGVKGEVPVGVIAGSVIGGLLLLALVIGLLWKFGFFRRKYKQLMQNTEEDDAETE
GLENTAE
NT seq 3624 nt   +upstreamnt  +downstreamnt
atggagttgaatccaaagaggactgttttgacgttgcttttgatccaatgttggagcatc
ccccggtccctatcctttaatgtggggacggcaggagccaaggtattctctggacctgca
ctcgaggagtttggatacaccgtgaaacagttcagaaatcaccagggaaaatggttgctg
gttggttctccctggagtggatacaaccaggacaggaaaggagacatctacaagtgtgag
atcagagggtccagttcaggctgccagagactcaacctgcagaactcagtcagcatgtca
acagtgaagaacatcaatgtcaacatgagtctggggctaaccctcacccacacagctaca
gaagataagttcatgacatgtggacccctgtgggctcagaagtgtggcagccagtattat
tacccagggatctgtgcagaagtgaaccctctcttcaaccccctgtcttcgttctcaccc
gcccttcaaacttgtgggggtccaatggatattgctattattgtggatggatccaacagt
atatatccctggccacccattgtggctttcctcaagaaactgttggagaatttagatatt
ggaccagataatactcaggcaagtattatacagtacggggttgagccagtcgttgaattc
catctgaacgcctacaaaaccaaagactcgatcattgcggctgcagccaacattctacag
agggaaggcctggagacaaacaccttccgcgccattgaatttgctcgacagaacgcgttc
ctgcccgggaacggagctcgacccggagccagcaaagtgatggtggtggtgacggacgga
gagtctcacgacaagaacctccgagacgacgtcatcaggaagtgtgagagtgagaagatc
acccgctttggtattgctgtccttgggtattacataagaaatgacattgacactaagaac
ctgattgcggagatcaagtccatcgccagcaccccgacagataggtatttcttcaacgta
tcagctgaggaggctctgctcgagatcgctggatctctgggagaccgcatcttcaacatt
gagggtactgggaaaggtggtgactttcagatggagatgtcccaagtgggattcagtgcc
caccaaaccaagaagcagaacatgattatgctgggtgcagtgggggcctatggctggagt
ggtactgtggttcactacaccacccagaaatcggacatcttccccaagacggcctttgag
agaattctagaggacagaaaccacagctcactattaggctactctgtgactagcgctgga
cattgttacacgtttgtccataatatcccgtcaggctactctgtgacaacactgaatgat
ggcagcatagagtactatgtggctggcgctcctcggtccaaccacactggacaggtcata
gtgtacatcatcaacggcaagggacaacccaccgtcatcgactcccagaggggagaccag
attggctcctactacggcagcgtactctgtcctctggatgtggataaagatggtgtgtct
gatctactactggttggagctcccatgttcatgaacgaacagcagaaggagattgggaaa
gtccatctcctctccttcacaaagggcatcctaagtgttcaggggttcctgaagggtccg
tccccagtggagaacgctcgttttgggatgtctgtctcagcggtgcctgacctcaacatg
gatggctacagtgatgtggtggtgggagccccactggaagacaacaataaaggtgtaatc
tatgtcttcaacggggacaagaagagactcaggacacagtattcccagaaaatcctgggc
tccaagctggaccctgcgttgcagtacttcgggaggtccatggacgccagctccgactta
aacgatgacaccataccagatgtctcagtgggggcttatggaatggtggtccagctctgg
tctcggggtatggccgtggtgacagcgagggcaaccttcaaccctgacacggtcagcatc
ctgagtaagacgtgcagggtcagtgggaggctggtgtcctgcttcaacacctcagtctgt
ttcagcgccaccttcaggcccaagatacctgtaggacctgtggctatcaggttcaacctg
accctagatgctgagctccagtcgtctcgtgtcacctccagaggtcagttcaggaactca
gagagagtcctgcagaaagacatccgggtttccaccagggaggtctgtgagacactagag
gtctttgtccaggaggcccctgactttgtgagctcaatcggtctgcgtgtggacatcact
ctgcaggacccagactccagtcctgttctggatgttctcagtcccactgcctgggagttc
tttatcccattctccaaagactgtggctctgacgatgtgtgtttgagtgacctgctcttg
aagttgaagaaaggagagatgattcccagctcgtctaggatgctggtcagctttaaggac
aagaggctctccttcactgtgtctgtgaccaacaagaaggagaatgcgtacaacacccaa
gtcacggccacgtactccaaaaacctcttcttcgcatccatcagtcctccaagtgatgga
acagaggtaaagtgcacctccaccaaggagtctcttaccctctcatgccaggtggggtac
ccagctttaaggcagaaccaagaggtgacatttggaatcaactttgacttcaacctgaat
caactgcagaccgaagccgacgtgagctttgaagctctaagtgacagcacagaggcgaac
ccgtcagacaaccaagcctctatctccgtccctgtccactatgactcagagatctccctc
tccagggaagccaatctcaacttctatgtggttgacatggacaatgaagcgaagaccgca
gttaataccttcaatgacatcggtcctgagttcaaattctctctgaaggtctctacaggg
aacttcccagtcagtctggcctacctcacagtctcactgcccagtgctacagcaagaggg
aacccattgctgtatgtgacaggagtcaaaacagaacctgctggcgaagtgagctgtgaa
gtaaccagcctcgtcaaccctctgaagatcagtgagaagccttacacagcatccttctcc
aaggagaacctaatgggcacagaggatctgaactgtaagacagccaagtgccagcctatg
aagtgtgtcctgaaagacatggggataaagagcgatttcttcgtgaacgtgaccacgcgg
atatggaacggtacctttgctgcttcatccttccagtccactgtgctgactgtgagcaca
gagatagagacctccgagcctgaactgctggtcgtctctcacaagcacctgacggttggc
gtcaccatcagtaaaccaggggtgaaaggagaggtgcctgtaggcgttattgcgggcagt
gtgattggaggcctgcttctattggctctggtcattggcctgctttggaagtttggcttc
ttccggagaaagtacaagcagctgatgcagaacactgaggaggatgatgcagagaccgag
ggactggagaacacagcagagtga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112220187
Entry
112220187         CDS       T05605                                 

Definition
(RefSeq) integrin alpha-4-like
  KO
K06483  integrin alpha 4
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
otw04514  Cell adhesion molecules
otw04672  Intestinal immune network for IgA production
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112220187
   04514 Cell adhesion molecules
    112220187
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112220187
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112220187
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    112220187
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112220187
   04515 Cell adhesion molecules [BR:otw04515]
    112220187
   04090 CD molecules [BR:otw04090]
    112220187
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112220187
  Exosomal proteins of other cancer cells
   112220187
Cell adhesion molecules [BR:otw04515]
 Integrins
  Integrin alpha subunits
   112220187
CD molecules [BR:otw04090]
 Proteins
  112220187
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS
Other DBs
NCBI-GeneID: 112220187
NCBI-ProteinID: XP_024237643
LinkDB
Position
20
AA seq 1079 aa
MTTYGLGLHSIGLNMLFCFLLRHADLYNLDIPHAIPLSGPNGTFFGYSVLLHKHQQQTWV
IVGAPVANSRFNQAVRNPGAIYKCKITDKKDCEQIQLGVMLDMPCGRHCSAEVENQWLGV
SLSRRQQDGLVLACGHRWKNVYFTKKEDLNKLPHGVCYKLESDLNQSSPLIPCYRDHENK
FGNDFASCQAGISNVLIGDLIVMGAPGTLYWTGSVFVHNISSQITSAYLDDNVVLYGSYL
GYSVSAGHFLHPNSTEVVGGAPQYGQTGRAYIFSIESSTLSIISEVKGQKLGSYFGGTVC
AVDLNTDGLSDLLVGAPMFSTVREEGRVYIYMNQGQANMKEMEFTLAGRDSYAARFGESI
TSLGDIDDDGYPDVAVGAPQEDDLHGAIYIYNGRKTGLGQYFSQRIAGSALGSAFKMFGQ
SVSGGIDVDGNGYPDVAVGAFLSDSAVVLRTRAVVVVEAMILLPPSVNRTHALCTENGQP
AICLKTSVCFQLYAKRVSGLIEILYNLTADVKHIEGLQSRFFFNTNGTELSNATAGSIKT
RHGHMTCVTHLAFLRRDIRDIFTPIHFELQYELGEHNVVRDNSKSFPPLRPMLQRGEEYS
NLLTNKTVFTRYCAWANCSTNLQVSAQLLLLRTHRDMPYVALGEGKTILLNVTLSNAGDA
AFLPMLHLRYPSNLYFIKVLDAEEKYVSCKIAEEEKRSVGLDCSVGNLFFNTLAKVNISF
LLDVSADSEPGDLNIIINATRENLENEDLLHDNIVNLTLLLRYGVNLNIHGFVSRTEFVF
GDFEEPHCSAERFKYTFKVVNVGPSISHGTRVEIDIPKALAPYPYRLLNILDIQSSSGWC
YIRNSTDGTRSTHGTMYGSQRASTIDSVWLNVTTTTDSYWTNRSSTTHPYWTNISSTTDT
NWTSISYWANVRNWTTVIEDECDLPDSNPLNDFFFFFSKSSRRHMYCMKEDALCLYAVCE
LGDMDIGKDVTIEMEVEMNSGVLDISPGRHSVMLLETTAVISPKKDPFIWFLKEDPITVV
VLEAHHSHKLKRVIELSIIVASLLLGLFILALLVICMWKSGFFKREDKMENIQRLSWDY
NT seq 3240 nt   +upstreamnt  +downstreamnt
atgactacatacgggctaggcttacacagcatagggctaaacatgttgttttgctttctc
ttacgtcatgccgatttgtacaatttagacataccgcacgctattccactcagtggtccg
aatggaacattttttggatattctgtgttgctacacaagcatcagcaacagacatgggta
atagttggcgcaccagttgcaaattcaaggttcaaccaggctgtcaggaatcctggagca
atctacaagtgcaaaattacagacaagaaggactgtgaacagattcaactcggtgtaatg
cttgacatgccctgtggcagacactgttctgctgaggttgaaaaccagtggcttggtgtg
agcctctccaggcggcagcaggatggacttgtgttggcctgtggacatcgttggaaaaat
gtctacttcaccaaaaaagaagatctaaataagttgccacatggcgtatgctacaaattg
gagtctgacttgaatcaatcaagtcctttgattccatgctacagagatcacgaaaataag
tttggcaatgactttgcatcatgtcaagcagggatttcaaatgtccttattggggacctc
atagtaatgggagcccctggaaccttgtattggactgggtctgtttttgtccacaacata
tccagtcagatcacttctgcctacttggatgataacgttgtcctctatggaagttatttg
gggtactcagtcagcgctggccacttcctgcacccaaactccactgaggtagtgggtgga
gccccccagtacgggcagactggaagagcctacatctttagcatagagtccagcacactg
agcatcatctctgaggttaaaggtcaaaagctgggttcctattttgggggcactgtgtgt
gcagtggacctgaacactgatggcctgtctgacctgctggtgggagctccaatgttcagc
actgtgagggaggagggccgtgtgtacatctacatgaaccagggacaggctaacatgaag
gagatggagtttacattagcagggagagattcatatgcagcccggtttggggaaagtatc
acaagtcttggagatattgatgatgatggctatccagatgttgcagttggggcaccacaa
gaggatgacctacatggtgctatttatatctacaatgggaggaagacgggacttggacaa
tacttttctcaaaggattgctgggtctgccttgggtagtgctttcaagatgtttggccag
tctgtgtctgggggcattgatgttgatggaaacggttacccagatgtggccgtgggagcc
tttctgtccgactctgctgttgttctgaggacacgggcggttgttgtggtggaggcgatg
atacttcttcctcctagtgtgaaccgcacccatgccctgtgtacagagaacggccagcct
gccatttgcctcaaaacctctgtgtgcttccagttgtatgcgaaacgtgtctctgggctt
atcgaaatactgtacaacctgacggctgatgtcaagcacatagaggggctccagtccaga
ttcttcttcaacaccaacggcacagagttatcaaatgccacagcaggcagcatcaagacc
aggcatggccacatgacctgtgttacccatctggcctttctgaggagagacattcgggac
atcttcacccccatccactttgagctgcagtatgagctgggagagcacaatgtggtgagg
gataactccaagagctttccccctctcaggcctatgctccagaggggagaggagtacagc
aacttgctgaccaacaagactgtattcaccaggtactgtgcctgggccaactgttccacc
aatctgcaagtgtctgcacagctgctgttactgaggacacatagagacatgccatacgtt
gccctgggggaggggaagaccattctactgaatgttacgctgtccaatgctggcgacgcc
gccttcctccccatgcttcacctgagataccccagcaatctctacttcatcaaagtgttg
gacgctgaggagaaatacgtgagctgtaaaattgctgaggaagagaagagaagtgtcggg
ctagattgcagcgtgggaaatttgtttttcaacaccttagccaaagttaatatcagcttt
ctgctggatgtcagtgctgacagtgaacctggtgacctgaacattataatcaatgcaacc
cgggagaatttagaaaatgaagatcttctccatgacaatattgttaatctgactctgcta
ttgagatatggagtgaatctaaacatccacggttttgtatcccgaacagagtttgtgttt
ggggactttgaggagccacactgctccgctgagaggttcaaatacaccttcaaggttgtc
aatgttggtccaagcatatctcacggcacaagagtggaaattgatatccccaaagcttta
gcaccgtatccatacagactgctcaacattttggacatacagtcatcttctgggtggtgt
tacattcgaaactccactgatgggaccagaagtacacatggcaccatgtatggaagccag
agagccagtaccattgacagtgtttggttaaatgtgacaactaccactgacagctattgg
acgaataggtccagcaccacacacccttattggactaatatttccagtaccactgacacc
aattggactagtatatcctattgggccaatgtgagaaactggaccactgttattgaggat
gagtgtgatctgcctgactccaatcccttgaatgatttcttcttcttcttctcaaaaagc
agtagaagacatatgtattgtatgaaagaggatgctctgtgtctgtacgcggtgtgtgag
cttggagacatggacattgggaaagatgtcaccattgaaatggaggtcgaaatgaattcg
ggagttttagacatctcaccgggaagacatagtgtcatgctgttagagaccactgctgtc
atatcacccaagaaggacccatttatttggttcttaaaagaagaccccatcacagtggtt
gtcctggaggcccatcatagccacaaactgaaacgagtcattgagctgtccatcatcgtg
gccagtctcttactaggcctcttcatccttgccttgctggtcatctgcatgtggaagagt
ggcttctttaagcgtgaggataagatggagaatatacaaaggctcagctgggactactga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112220515
Entry
112220515         CDS       T05605                                 

Definition
(RefSeq) integrin alpha-6-like
  KO
K06485  integrin alpha 6
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
otw04514  Cell adhesion molecules
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112220515
   04514 Cell adhesion molecules
    112220515
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112220515
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112220515
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112220515
   04515 Cell adhesion molecules [BR:otw04515]
    112220515
   04090 CD molecules [BR:otw04090]
    112220515
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112220515
  Exosomal proteins of breast milk
   112220515
Cell adhesion molecules [BR:otw04515]
 Integrins
  Integrin alpha subunits
   112220515
CD molecules [BR:otw04090]
 Proteins
  112220515
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS
Other DBs
NCBI-GeneID: 112220515
NCBI-ProteinID: XP_024238145
LinkDB
Position
21
AA seq 772 aa
MSIQWLGLLVDLWFLLSCLPFHISAFNLDTDTKHVLRKNGDPGSLFGFSLALHQQLNPVN
KKLLLVGAPRAKSLTKAEVTGGIYQCELTTDSKSCERVKLDNDEFVKSKDVKDQWMGVRV
TSQGPGQSVMTCAHRYQEWSTNPDTPNLVFGQCYILGEDLHKSDAHRIWRRVICDDRKHI
KDKPKNPDWFGYCQQGHSAAFAKDNTSLLFGGPGAYQWKGIVRMESLDNLEVSNEEPCET
GDVDRLDRDLIPLLNNSYLGFSIDSGMALTKKGQLTIVSGAPRGGFSGEVAFLKRDPLAE
RSLSVENILKGPGLASSFGYDIAVVDLNADGWDDLAVGAPEFFLKEGVVGGAVYIYINNR
GRQWEKIEPVRLDGNKDSMFGLAVENIGDVNQDGYEDIAVGAPYDGVGRVYLYYGSSGGI
HKKTAQIITAESCELGNPFKRDAEVTFYVILSTSRISLSTTDVNVTLQLETTSVQKIQAS
EAKAKVVFELHLQVFGLARPSQVSFGGAVKGESAMKSEDDIGTLVEYEFRIWNLGRPLKS
FANASLNIYWPKENAVGKWLLYLVQIHSEGIQNVPCSPLKEISPVQHIKGSRDNSRKRRD
AHQEAFSSEDGFSFLSKKRKYKTLTCSDELKCVEIRCPLLGLDSTAVVFLQARLWNSTFL
EDYSSLNYLDIVLDATLSLTDSAENIGLRKTEKSGTQVRLTVFPERKAAIWAKVAWWVIF
LSVMVGLLLLALLGFLLWKCIKYPVAKKYYVMQKNTEERHPIRGNSSLGPTA
NT seq 2319 nt   +upstreamnt  +downstreamnt
atgtcaattcaatggttgggcctcctagtggacctgtggtttcttttgtcctgcctacca
tttcacatctcagctttcaatctggacacggacacaaagcatgttctgaggaaaaacggt
gatccaggaagcctgtttggattctccctggcactgcatcaacaactgaatcctgtcaat
aagaaactattgctggttggagcaccacgcgccaagtcattgaccaaagctgaagttaca
ggaggaatctaccagtgtgagctcaccactgattctaagagctgtgagcgtgtcaagctt
gacaatgatgagtttgttaaaagcaaggatgtcaaagaccaatggatgggtgtacgagtg
acaagccaaggccctggtcaaagcgttatgacctgcgcacatcgataccaggagtggagc
accaatcctgacacccctaacctcgtattcggtcagtgctatatcctgggggaagatctc
cacaagagtgatgcccatagaatctggaggagggtgatctgtgatgacagaaaacacatc
aaggataagcctaagaatcctgattggttcggatactgtcaacaaggtcattctgccgcc
ttcgccaaggacaacacatctctgctgtttgggggccccggagcttaccagtggaaagga
attgtgagaatggagtccctagacaaccttgaagtgtcaaatgaagagccctgtgaaact
ggggatgtggacagacttgaccgtgacctcatccctctccttaacaacagttatctaggg
ttctcaatcgactctggaatggccctcaccaagaagggccagctgactatagtgtctggg
gcaccacgaggcggtttcagtggggaggtggcatttctgaagagagacccattggctgaa
agaagtctatctgtggaaaacatccttaaaggcccaggcctggcctcctcctttggctac
gacatagccgtagtggacctcaatgctgatgggtgggacgaccttgctgtgggggcaccc
gagtttttcttaaaagaaggggtggtcggaggggcagtgtacatctacatcaacaacagg
ggaagacagtgggagaagattgagcctgtccgtctggatgggaacaaagactccatgttc
ggtctcgcagttgagaacattggagacgtcaatcaggacggttatgaagatattgctgtg
ggggctccctatgatggtgtaggtcgagtgtacctttactatggttcctcaggtggaatc
cacaaaaagacagcacagattataacagcagaatcctgtgaactgggaaacccattcaaa
agagatgctgaagttactttctatgtaatattgtccacttcccgcatctctctgagcaca
actgatgtaaatgttaccttgcagcttgaaacgacaagtgtgcagaagatacaagcaagt
gaagcaaaggccaaagtagtttttgagctgcacctacaagtatttggactggccaggccc
tcccaggtcagctttggaggagctgtaaagggagagagcgccatgaaatcagaggatgat
attggaacccttgtggagtatgaattcaggatatggaatttgggcaggccactgaaatcc
tttgccaatgcgtcgctgaatatctactggcccaaggagaatgcagtggggaaatggctg
ctgtacctggtgcagatccacagtgaaggcatccagaacgttccctgctctccgctaaag
gagatcagtcctgtccaacatataaagggctctcgtgataattcaagaaaaagacgagat
gctcatcaggaagcgttctcatctgaggatggattctccttcctgtcaaagaaaagaaaa
tacaaaactctgacatgctcagacgagttaaaatgtgtagagatacggtgccctctgctg
ggtttggacagtactgcagtggtgtttcttcaagctcgcctttggaacagtactttcctt
gaggactacagttcattaaactacctggacattgtgctggatgccactctcagcttgaca
gactctgcagagaatattgggcttaggaagactgagaaatctggaacccaggtgaggctg
acagtgttccctgagaggaaggctgccatctgggctaaggtcgcctggtgggtcatcttc
ctctctgtaatggtaggactgctacttctggctctgctcggctttctgctgtggaagtgc
atcaagtaccctgtggctaagaagtactatgtcatgcagaagaacacagaggaacgtcac
ccaattagaggaaactcatctttgggtccaactgcatag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112220540
Entry
112220540         CDS       T05605                                 

Definition
(RefSeq) integrin alpha-6-like
  KO
K06485  integrin alpha 6
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
otw04514  Cell adhesion molecules
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112220540
   04514 Cell adhesion molecules
    112220540
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112220540
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112220540
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112220540
   04515 Cell adhesion molecules [BR:otw04515]
    112220540
   04090 CD molecules [BR:otw04090]
    112220540
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112220540
  Exosomal proteins of breast milk
   112220540
Cell adhesion molecules [BR:otw04515]
 Integrins
  Integrin alpha subunits
   112220540
CD molecules [BR:otw04090]
 Proteins
  112220540
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS
Other DBs
NCBI-GeneID: 112220540
NCBI-ProteinID: XP_024238166
LinkDB
Position
21
AA seq 842 aa
MSIQWLGLLVDLWFLLSCLPFHISAFNLDTDTKHVLRKNGDPGSLFGFSLALHQQLNPVN
KKLLLVGAPRAKSLTKAEVTGGIYQCELTTDSKSCERVKLDNDEFVKSKDVKDQWMGVRV
TSQGPGQSVMTCAHRYQEWSTNPDTPNLVFGQCYILGEDLHKSDAHRIWRRVICDDRKHI
KDKPKNPDWFGYCQQGHSAAFAKDNTSLLFGGPGAYQWKGIVRMESLDNLEVSNEEPCET
GDVDRLDRDLIPLLNNSYLGFSIDSGMALTKKGQLTIVSGAPRGGFSGEVAFLKRDPLAE
RSLSVENILKGPGLASSFGYDIAVVDLNADGWDDLAVGAPEFFLKEGVVGGAVYIYINNR
GRQWEKIEPVRLDGNKDSMFGLAVENIGDVNQDGYEDIAVGAPYDGVGRVYLYYGSSGGI
HKKTAQIITAESTFKARACFTYTAQPPSYNPRLTVNYAFEADAETRKQRRSSRMQFLFQS
QGVLELAGQGEEKCTETNSSYCCELGNPFKRDAEVTFYVILSTSRISLSTTDVNVTLQLE
TTSVQKIQASEAKAKVVFELHLQVFGLARPSQVSFGGAVKGESAMKSEDDIGTLVEYEFR
IWNLGRPLKSFANASLNIYWPKENAVGKWLLYLVQIHSEGIQNVPCSPLKEISPVQHIKG
SRDNSRKRRDAHQEAFSSEDGFSFLSKKRKYKTLTCSDELKCVEIRCPLLGLDSTAVVFL
QARLWNSTFLEDYSSLNYLDIVLDATLSLTDSAENIGLRKTEKSGTQVRLTVFPERKAAI
WAKVAWWVIFLSVMVGLLLLALLGFLLWKCIKYPVAKKYYVMQKNTEERHPIRGNSSLGP
TA
NT seq 2529 nt   +upstreamnt  +downstreamnt
atgtcaattcaatggttgggcctcctagtggacctgtggtttcttttgtcctgcctacca
tttcacatctcagctttcaatctggacacggacacaaagcatgttctgaggaaaaacggt
gatccaggaagcctgtttggattctccctggcactgcatcaacaactgaatcctgtcaat
aagaaactattgctggttggagcaccacgcgccaagtcattgaccaaagctgaagttaca
ggaggaatctaccagtgtgagctcaccactgattctaagagctgtgagcgtgtcaagctt
gacaatgatgagtttgttaaaagcaaggatgtcaaagaccaatggatgggtgtacgagtg
acaagccaaggccctggtcaaagcgttatgacctgcgcacatcgataccaggagtggagc
accaatcctgacacccctaacctcgtattcggtcagtgctatatcctgggggaagatctc
cacaagagtgatgcccatagaatctggaggagggtgatctgtgatgacagaaaacacatc
aaggataagcctaagaatcctgattggttcggatactgtcaacaaggtcattctgccgcc
ttcgccaaggacaacacatctctgctgtttgggggccccggagcttaccagtggaaagga
attgtgagaatggagtccctagacaaccttgaagtgtcaaatgaagagccctgtgaaact
ggggatgtggacagacttgaccgtgacctcatccctctccttaacaacagttatctaggg
ttctcaatcgactctggaatggccctcaccaagaagggccagctgactatagtgtctggg
gcaccacgaggcggtttcagtggggaggtggcatttctgaagagagacccattggctgaa
agaagtctatctgtggaaaacatccttaaaggcccaggcctggcctcctcctttggctac
gacatagccgtagtggacctcaatgctgatgggtgggacgaccttgctgtgggggcaccc
gagtttttcttaaaagaaggggtggtcggaggggcagtgtacatctacatcaacaacagg
ggaagacagtgggagaagattgagcctgtccgtctggatgggaacaaagactccatgttc
ggtctcgcagttgagaacattggagacgtcaatcaggacggttatgaagatattgctgtg
ggggctccctatgatggtgtaggtcgagtgtacctttactatggttcctcaggtggaatc
cacaaaaagacagcacagattataacagcagaatctacattcaaggcacgggcatgcttt
acctacacagcacagccgccatcctacaaccccagactgactgtcaactatgccttcgag
gctgacgctgagacgaggaaacagaggcgttcctccaggatgcagtttctgtttcagtcc
cagggagtcctggagctagcagggcagggcgaagagaagtgcactgagaccaactcaagc
tattgctgtgaactgggaaacccattcaaaagagatgctgaagttactttctatgtaata
ttgtccacttcccgcatctctctgagcacaactgatgtaaatgttaccttgcagcttgaa
acgacaagtgtgcagaagatacaagcaagtgaagcaaaggccaaagtagtttttgagctg
cacctacaagtatttggactggccaggccctcccaggtcagctttggaggagctgtaaag
ggagagagcgccatgaaatcagaggatgatattggaacccttgtggagtatgaattcagg
atatggaatttgggcaggccactgaaatcctttgccaatgcgtcgctgaatatctactgg
cccaaggagaatgcagtggggaaatggctgctgtacctggtgcagatccacagtgaaggc
atccagaacgttccctgctctccgctaaaggagatcagtcctgtccaacatataaagggc
tctcgtgataattcaagaaaaagacgagatgctcatcaggaagcgttctcatctgaggat
ggattctccttcctgtcaaagaaaagaaaatacaaaactctgacatgctcagacgagtta
aaatgtgtagagatacggtgccctctgctgggtttggacagtactgcagtggtgtttctt
caagctcgcctttggaacagtactttccttgaggactacagttcattaaactacctggac
attgtgctggatgccactctcagcttgacagactctgcagagaatattgggcttaggaag
actgagaaatctggaacccaggtgaggctgacagtgttccctgagaggaaggctgccatc
tgggctaaggtcgcctggtgggtcatcttcctctctgtaatggtaggactgctacttctg
gctctgctcggctttctgctgtggaagtgcatcaagtaccctgtggctaagaagtactat
gtcatgcagaagaacacagaggaacgtcacccaattagaggaaactcatctttgggtcca
actgcatag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112222541
Entry
112222541         CDS       T05605                                 

Definition
(RefSeq) integrin alpha-8-like
  KO
K06584  integrin alpha 8
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
otw04514  Cell adhesion molecules
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112222541
   04514 Cell adhesion molecules
    112222541
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112222541
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112222541
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:otw04515]
    112222541
Cell adhesion molecules [BR:otw04515]
 Integrins
  Integrin alpha subunits
   112222541
SSDB
Motif
Pfam: Integrin_alpha2
Other DBs
NCBI-GeneID: 112222541
NCBI-ProteinID: XP_024241066
LinkDB
Position
23
AA seq 239 aa
MVTCLRVDICAKVSGVGIPDSVVLNAELQLDWLKGVRGGVKRVYFLDSHQPQHTGVLTLG
HSRPHSCLNYTVYLRGEDEFRDKLTPISLALNYSLAPPSNLDLPPVLNRYSSTFLQEQAY
ILLDCGEDNECIPDLQLTASIDRTELVVGDDNLVMLTINAVNKGEGAYETELHTLLPPEA
DYIGVERRIEALSRLNCEYRMVNDSRLVVCDLGNPMVAGTEVSVGLRFAVHRQHKHIDD
NT seq 720 nt   +upstreamnt  +downstreamnt
atggtgacctgtctaagggtagatatttgtgcaaaggtgagcggtgtggggatcccagac
tctgtagtcctgaatgcagagctgcaactggattggcttaaaggtgtgaggggcggagtt
aagagagtttatttcctggattcccatcagccccagcacacaggggtcctaacgcttggc
cacagccgtcctcactcctgcctgaactatactgtctacctacgaggggaggatgagttt
agggataaattgactcccatctcattggctctgaactacagtttagcccctccttccaac
ctggacctcccccctgttctcaaccgttacagcagtaccttcctgcaggaacaggcatat
attctgctggactgtggggaagacaacgagtgtattccagacctccagctaactgcaagc
atagaccgtacagagctggtggtcggggatgacaatctggtcatgttgaccataaacgcg
gttaacaaaggagagggggcatatgagacagagttacacacactcctaccccctgaggct
gattacataggagtggaacgcaggatagaggctctatccaggttgaactgtgagtacagg
atggtgaatgactccagactggtggtgtgtgacctggggaaccctatggttgccggaaca
gaagtatctgtaggtttaaggtttgctgtccacagacaacataaacacatagatgattaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112223646
Entry
112223646         CDS       T05605                                 

Gene name
itga3
Definition
(RefSeq) integrin alpha-3 isoform X1
  KO
K06482  integrin alpha 3
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112223646 (itga3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112223646 (itga3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112223646 (itga3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112223646 (itga3)
   04515 Cell adhesion molecules [BR:otw04515]
    112223646 (itga3)
   04090 CD molecules [BR:otw04090]
    112223646 (itga3)
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112223646 (itga3)
Cell adhesion molecules [BR:otw04515]
 Integrins
  Integrin alpha subunits
   112223646 (itga3)
CD molecules [BR:otw04090]
 Proteins
  112223646 (itga3)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Collectrin FG-GAP_2 Fer4_22 LYRIC PsbJ
Other DBs
NCBI-GeneID: 112223646
NCBI-ProteinID: XP_024242505
LinkDB
Position
24
AA seq 1051 aa
MAPSLYLHGALAVFCVTLTCNGFNIDSRFPVIKEGKTKGSFFGFAVALHKQTEGSTKYLL
LSGAPKEKALALRNVNETGAIYSCPVTTELNDCERMDLVSSTDSSEMVEGMWLGVTVASQ
RDLPGGRVLACGHRYVKVVRGGAEEQLRMVGKCYVRGNDLTFDPNDEWQDHSYEVCNPNF
DMELEGLCNMGISGGMTDTDVYIGSVGSYVWQGNVHVTWRDPDPGNAWDSSDKDFGQLNR
RYGYMGYSVNEDKKLLSQDYFTVVTGSPRDESKGSVMLAKKGNTALVTKFIIPGEQVGSY
FGNSLAVTDLNNDNWNDLIVGAPFYFDRQKEEGGAVYVFMNENGSFQKTPSMVLKGPTAS
GFGFAVAAIGDVNQDGFQDFAVGAPFHETGNVYIWMGSKKGISEEPSQVIEGKSVGSGGF
QTFGYSISGGMDMDENSYPDLLVGSLDDRIALLRARPVIHLSKNFTVLPEIVDPNLCPRG
NKSCVTVTVCFSYTLSNGNKDFKKNIMVKYTVEADMHRRSPRVLFLVNKLATYTGLLTMP
SPKTECQVLELRLEDPVRDKLEPVVFSLNVSLDEQKPKVRKALQNLDSYPVLSHKQKVTE
RKEINFQKECGSDNRCTSNLQLTAAFANELLKPYPSQGKRQLLQYSSNVKKVVLLVEITN
VPGPGKVAEDAHQAMLNISTPSTLRYSGVRSHDTGVECRAGETVMCELGNPLRSNEKVSL
QLIFETTGINLQTREIESQLLLSTLSEQNDLYPVSVALLIETSIQTSFSIENPLVQTYFS
GEVMGESAMNTTSDVGSLVEYTFKVSVEGEPLGALGILAVEFEWPFEVTSGKWLLYLTEI
VTKGTTETHCVPPGDIVNLLNLTLSKNRSKRPKRAVEGEHPRIIEPQAVLTVLTPRKETY
LLDCSKWTARCVTFTCPLINMSTSAKIIVRSRVWNSTMLEDYKNALRIKVRGQATLKLVT
DNPTIKMENETREFIVDIDPVLGVETPYEVPLWIIIVAVVAGILLLGVISIILWKCGFFR
RASRREMYEAKGQKAEMKSQPSETERLTEDY
NT seq 3156 nt   +upstreamnt  +downstreamnt
atggccccaagtctatatctccacggggccttggctgtgttttgtgtgactctaacctgc
aatggatttaatatagactcacggtttccagttatcaaagaagggaaaaccaagggcagt
ttctttggatttgctgttgccttacacaaacagacggaagggtccacgaaataccttctc
ctgtcaggagcacccaaggagaaagccctggctctgaggaacgtcaatgagacgggcgcc
atctactcctgtcctgtcaccacagagcttaacgactgtgaaaggatggacttggtcagc
tccacggactcgtctgagatggtggaggggatgtggctgggagtgactgtggccagccag
agagacctgccagggggtcgagtgctggcttgtgggcatcgctacgtgaaggtggtgcgg
gggggcgcggaggagcagctgcggatggtggggaagtgctacgtcaggggcaatgacctg
accttcgaccccaacgacgaatggcaggaccacagctatgaggtgtgcaaccccaacttc
gacatggagctggagggcttgtgcaacatgggcatctcggggggcatgaccgacacggac
gtctacatcggctctgtgggcagctacgtgtggcaaggcaacgttcatgtaacgtggaga
gaccctgatccaggaaacgcatgggactcaagtgacaaagactttgggcaactgaacaga
cgatacggctacatgggttactctgtcaatgaggacaagaagctgctgagtcaagactac
ttcacggtagtgacggggtctcccagagatgaatccaagggctcagtgatgctggctaag
aagggcaacacagcgttggtgaccaagttcatcatcccaggagagcaagtgggctcgtac
tttgggaacagcctagctgtcaccgacctcaacaatgacaactggaatgacctgatcgta
ggtgccccattctactttgaccgtcagaaggaggagggaggagcggtgtacgtcttcatg
aatgagaacggctctttccagaagacacctagcatggtactgaagggtcctacggcatct
ggctttggattcgccgtggcagccattggcgacgtcaaccaagatggattccaagacttt
gcagtaggagccccattccatgagactgggaatgtctacatctggatgggaagcaagaag
ggaatctctgaggagcctagtcaggttattgaggggaagtcagtgggtagtggtgggttc
cagacttttggctattccatcagtggaggtatggacatggatgagaacagttaccctgac
ctcctggttggttctctggatgaccgcatcgctctgctcagggctcgtccagttatccat
ctctctaagaacttcaccgtgctgccagagattgtggaccctaacctttgtccccgtgga
aacaaatcctgtgtgactgtgacagtgtgtttctcctacacactcagcaatggaaacaaa
gatttcaagaaaaacatcatggtgaagtacacagtggaagccgacatgcatcgccggagc
cctcgagttctcttccttgtcaataagcttgccacctacacaggcctccttaccatgcca
tctcccaagaccgagtgtcaggtgctggagctcagactagaggatcctgtgagggacaaa
ctggagccggtggttttctccctcaacgtgtccctggatgagcagaaacccaaagttaga
aaggccctgcagaacctggactcctaccctgtactgagccacaaacagaaagtgactgag
aggaaagagatcaacttccagaaggagtgtggctcagacaacaggtgcaccagtaacctg
cagctaacagctgcgtttgcgaacgagttactgaagccttaccccagtcaggggaaacgc
caattgctgcagtacagcagtaatgtgaaaaaggtggtgctacttgtggagataactaac
gtgccaggccctgggaaggtagctgaggacgcccaccaggccatgctcaacatctccacc
ccctccacgctccgttactctggcgtgcgctcccatgatactggtgtagaatgtcgtgct
ggagagactgttatgtgtgagctggggaatccactgaggagcaatgagaaggtctctctg
cagctcatctttgaaacaacagggatcaacctccaaaccagggagattgagtctcagttg
ctgttgtccacgttgagtgagcagaatgacctgtacccggtgtctgtggctctgttgata
gagacctccatccagacctccttctccatagagaatcccctggtccagacctacttcagc
ggggaggtgatgggagaatcagctatgaacacgaccagtgatgtgggcagtcttgtggaa
tacaccttcaaggtgtcagtggagggagagcctctgggggcgctggggatcctggccgta
gagtttgagtggcccttcgaggtgaccagtgggaagtggcttctctacctgactgagatc
gtcaccaaggggacaactgagacccactgtgtccctccaggggacatcgtcaatcttctc
aacctcacattgtccaagaacaggagcaaacgtcccaagcgagcggtggagggcgaacac
cctcgcatcatcgagccacaggctgtccttaccgtgctgactcctcgtaaagagacctac
ctactggattgttcaaagtggacagcccgctgtgtgacgttcacctgtcccttgatcaac
atgtctacctctgccaagatcattgtgaggtcacgggtgtggaacagcactatgctagag
gactataaaaatgctttgaggattaaggttagaggtcaggccacactgaaacttgtgacg
gacaaccccaccatcaagatggaaaatgagaccagagagttcatagtggacattgaccca
gtccttggggtggaaacaccttacgaggttcccctgtggatcatcatcgttgccgtggta
gcaggaatcctgctgttaggagtcatcagcatcatactgtggaagtgtggcttcttcagg
agggccagcaggagggagatgtacgaggccaaaggccagaaggctgagatgaagagccag
ccctcagagacggagaggctgactgaggactactga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112224592
Entry
112224592         CDS       T05605                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: integrin alpha-9-like
  KO
K06585  integrin alpha 9
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
otw04514  Cell adhesion molecules
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112224592
   04514 Cell adhesion molecules
    112224592
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112224592
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112224592
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:otw04515]
    112224592
Cell adhesion molecules [BR:otw04515]
 Integrins
  Integrin alpha subunits
   112224592
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS FG-GAP_2 Integrin_alpha GerE SARA
Other DBs
NCBI-GeneID: 112224592
NCBI-ProteinID: XP_024243998
LinkDB
Position
25
AA seq 1030 aa
MRKKMAHFLNQKRSLLNVLYVYLSVSVVHSYNIDLEHPIVFRGPDSSFFGYSVLEHYHDN
TRWVLVGAPKANSSHSSSVHTPGAVFKCRVHSNPERRCTEMDLGRGNKPRESCGKTCQGD
RDDEWMGVSLARQDKSNGKILACAHRWKNVYYDSELILPHGYCSIIPPTLQGRTQALIPC
YEDYKQKYGEEHGSCQAGIAGVFTEELVVMGAPGSYYWTGTVKVYNLTSSTFYNPNKEEV
DSHRYSYLGYAVTAGHFSSPNFIDVAAGAPQHSGGGKVYIFRIDGGSLVKIFQASGKMMG
SYFGSSLCAVDLNRDGLSDLLVGAPMHSTLRDEGQVSVYLSKGNGVMEQAELLNGDDAYN
AHFGECITAIGDIDDDGYQDVAIGAPKEDDYGGAVYIYHGDATGIVNKYSMRLSGRSVNP
AFQMFGQSISGNVDMDGNGYLDITIGAFMADSVVLLRSRPVITVDVSIYLPVSINISVPQ
CHEGPQHLNCFNATVCLLFRGKHLPGQIELLYNLTADVDKRQRSQPSRVYLVQNGAQMSS
VSNELSLDINTVECHQYTAYVKVNVKDVFTAITFEVAYTLGKHVVGXHLDNDLPGSTPVL
RGKKGDKIAAKNETWFEKNCLSDDCAADLRLHGKLLLSGLHVHPHLALGGVRNVSLNVTI
SNAGDDAYDTNIYFNFSREVFYINYWQREEKGISCGLVDLDFLKCSVGFPFMRAQTKYHL
AVIFDTSRLSGENETLQFVVHAKSANPEHRLLDNKLDLSIPLVHEVDTTITGVVNPTSFE
YGNSIDASRFVQLEDMECNFQPLNFTFQVINNGPSRLPGSIVDIRIPNRLAGNGGDMFLI
MDSQVAEGRGNCTXHRNPQPCTXPQDRENIFHTIFAFFTKSGRRVLDCDRPGRACLTISC
TLGSQTKEDAISIDVKLLLNTEILNRDSSSLIQFVTRGNVRVDGRAMEVPEGLSEDTSLV
FEALHSQEPRGYVVGWIIAISLLVGILIFLLLAVLLWKMGFFRRRYREIIEAEKNRKDSD
ESWDWVEKNH
NT seq 3093 nt   +upstreamnt  +downstreamnt
atgcgcaaaaagatggcccattttctgaatcagaagaggagccttttgaatgtgctctac
gtgtatttgtctgtttctgtagttcactcctacaacattgacttagaacatcctattgtg
ttccgtggacctgactcgagtttctttggatattctgttctggagcactatcatgacaat
acgcgctgggtgctggtaggggcccccaaggccaactcttcccacagcagctctgttcac
actcctggagccgtgttcaagtgccgtgtccacagcaacccagagagacgctgcactgag
atggacctaggcagagggaacaagcccagggagtcttgtgggaagacgtgccagggagac
agggatgatgagtggatgggggtcagcctcgcccggcaggacaaatccaatggaaaaata
ctggcctgtgcccaccgttggaagaacgtctactatgactctgagctcatccttccccat
ggttactgttccatcatccctcctacgctacagggccggacccaagccctcatcccctgc
tatgaagactataagcagaagtatggggaagagcacggctcgtgccaagcagggatagcg
ggcgtttttactgaggagctggtggtgatgggagctccaggatcatactactggacagga
acagtcaaggtctacaacctgacctccagcaccttctacaaccccaacaaagaagaagtc
gactcacacagatacagctatctaggctatgctgtgactgctggacacttctcctctcct
aacttcatagatgtggctgcaggagctccacaacacagtggaggaggaaaagtttacatt
ttcagaatagatggtgggtctttggtgaagatctttcaagcctcagggaaaatgatgggc
tcttactttggctcctcattgtgtgcagttgacctgaaccgggatggcctgtcggacctg
ctggttggagcgcccatgcacagcacgctacgggacgagggacaggtctctgtctacctc
agcaagggcaatggggtgatggagcaggctgaactcttaaatggagatgatgcctacaat
gcacactttggagagtgcatcactgcaatcggagacatcgatgacgatgggtaccaagat
gtggccataggagcacccaaagaagatgactacggtggagcagtctacatttaccatggc
gatgccacaggaatcgtcaacaaatattctatgaggctgtctggacggagtgtaaacccc
gccttccagatgttcggccaatcaatatctggcaatgtggacatggacggcaatggatat
ctagacattaccattggtgcttttatggctgatagtgtggtgttattgaggtcccgaccg
gtgatcactgtggatgtgtccatctacctacctgtctccatcaacatctctgttcctcag
tgtcacgagggaccacagcacctcaactgtttcaacgctacagtctgcctgctcttcaga
ggaaaacacctgcctggacagatagagttgctgtataacctgacagctgatgtggataag
agacagaggagccagccttctagagtgtacttggttcagaacggagcccagatgagctct
gtgagcaacgagctcagtctggacatcaacacagtggagtgccaccagtacactgcatac
gttaaggtgaacgtgaaagacgtgttcacagccatcacctttgaagtggcctacaccctg
gggaagcatgtggtggggngacatcttgacaatgacctgcctggctccacacctgtacta
cgcgggaagaaaggagacaagatagcagcaaagaatgagacatggtttgagaagaactgc
ctgtctgatgactgtgctgctgacctgagactccatgggaaactgctgctttctgggctc
cacgtccatccccaccttgccctaggaggagtgaggaacgtctctctgaatgtgaccatc
tccaacgcaggggacgatgcctacgacaccaatatctacttcaacttctccagagaggtc
ttctatatcaactactggcagagggaagagaagggtatttcctgtggtcttgttgattta
gacttcctcaaatgcagcgtgggatttcccttcatgagagcacagactaagtatcatctt
gcagtgatcttcgacacaagccggctttcaggggaaaatgagacattgcagtttgtagtt
catgcaaaaagtgccaaccctgagcataggctgttggacaacaagttggatctgtctatc
ccactggtccatgaggtagacacaactatcactggtgtggtgaacccgacatcctttgag
tatgggaactccatcgatgcctctcgcttcgtccagctggaggacatggagtgtaacttc
cagccactcaacttcacctttcaggtgatcaacaatggccccagtaggctccctggctcc
atagtggacatcaggatccccaaccggctggctggcaatgggggcgacatgttcctcatc
atggactcgcaggtggcggaggggcgagggaactgtaccncccacaggaacccccagccc
tgtaccnatccccaggacagagagaatatcttccacaccatattcgccttcttcaccaag
tctggccgcagggtcctggattgtgaccggccaggaagagcatgtttaactatctcatgt
actctaggctcccagaccaaagaggatgctatcagtatagatgtgaaacttctactaaac
acagagatactgaatcgggacagctcgtcgttgatccagttcgtgacaaggggtaatgtg
agagtggacgggagggccatggaggtaccagagggcctatcagaagacacttcactggtg
ttcgaggcgctccacagccaggagccaaggggctatgttgttggttggatcattgccatc
agcctgctggtgggaatactcatcttcctactgctggctgtgctgctctggaagatgggt
ttcttccgccggcgctaccgggaaatcatcgaggctgagaaaaacaggaaggacagtgac
gagagctgggattgggtggaaaagaaccactga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112225238
Entry
112225238         CDS       T05605                                 

Definition
(RefSeq) integrin alpha-6-like isoform X1
  KO
K06485  integrin alpha 6
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
otw04514  Cell adhesion molecules
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112225238
   04514 Cell adhesion molecules
    112225238
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112225238
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112225238
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112225238
   04515 Cell adhesion molecules [BR:otw04515]
    112225238
   04090 CD molecules [BR:otw04090]
    112225238
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112225238
  Exosomal proteins of breast milk
   112225238
Cell adhesion molecules [BR:otw04515]
 Integrins
  Integrin alpha subunits
   112225238
CD molecules [BR:otw04090]
 Proteins
  112225238
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha
Other DBs
NCBI-GeneID: 112225238
NCBI-ProteinID: XP_024244759
LinkDB
Position
26
AA seq 1093 aa
MVHPRIYFPIHVVLICLLEWTHISGFNLDTLNVLRKDGEPGSLFGFSLAMHRQLNPSDKT
ILLIGAPRAKALANQRANITGGLYSCDITTESDDCHRIDFDNEEDVRVENKENQWMGVTV
NSQGPGGKIVTCAHRYQRRLFVDTAQESRDITGRCYILSQDLTIDESSDEDGGNWRFCEG
RARGHERFGSCQQGLAATFTKDYHYVVFGAPGAYNWKGIVRVEQKNNTLLERGFYDDGPY
EVGDENRLDPDLVPVPANSYLGFSIDSGHSITKGRGLTIVSGAPRANHCGAVVLLRKENE
ASARLSPEYILEGPGLASSFGYDVAVVDLNGDGWQDIVVGAPQFFMKERDFGGAVYVYIN
QAGKWDKITPIRLNGTKDSMFGLAVENIGDINQDSYQDIAVGAPYADAGAGKVYIYHGSA
IGINTKPAQILEGMPNIIRLFGYSLAGNMDLDKNSYPDIAIGSLSDTVLVYRARPIISIQ
KDVKITPKEIDLTKKTCGNSICLTVEACFTYKANPVSYSPKLTIRYAFEGEADRRKQGLP
SRILFLDKSRTDQDFQSTGTLDLRGQNKRACTKTKIKLQDNIRDKLHGIPIEVSLGIQGT
KRQKRQNALPQLVPILDNSQPSKVVTEVNFLKEGCGNDNICQSSLQLEYRFCSKGLNQDI
FPPLPMENGLPVISLSDQKDIALEVTVKNRNGDDAHEAKLVGMFPNALSYSGFRSQKMTR
DKPVLCLANQNGSQTECELGNPFKRDSEVTFYIILSTAGISLDTAEINIDLELQTTSTQD
KMGRVKAKAKVVIELLLSVAGVARPSQVYFGGDVKGESAIKTEEEIGGLIDYEFKIINLG
KPLKSFGTASLNIQWPKENVDGKWLLYLVKISSTGLEEIPCSPETEINPLKHIQESSTSR
KKREVGGKKSGSKMTLLDQKKHKILMCGNGYDARCVVIKCPLQGLDSSAVIALRCRLWNA
TFLENYANLNYLDIIVKASISLDAPAKNMVLRNAETQVRVTVFPEKAVTQYGGVPWWIIL
VAVLAGILMLALLVFLLWKCGFFKRSEHDDSVPIYHAVRIRKGARQFKDRKAKLHSFEKK
QWVTRWNENENYS
NT seq 3282 nt   +upstreamnt  +downstreamnt
atggtgcacccgagaatatattttccaattcacgtggtacttatttgtttgctagaatgg
acccatatatcaggcttcaacctggataccttgaatgtcctgaggaaagacggagaaccg
ggcagtttatttggattctctctagccatgcaccggcaacttaatccttcagataaaaca
atactgttgattggagcaccaagagccaaagcactggctaaccagagagccaacataacc
ggtggcctgtacagttgtgacatcaccaccgaatccgatgactgtcaccgaatcgatttt
gacaatgaagaggatgtgagagttgagaacaaggagaaccagtggatgggggtgacagtt
aacagccagggccccggagggaagattgtgacctgtgctcaccgctatcagagacgtctg
tttgtggacactgctcaggagtcccgtgacatcacaggtcgctgctacatcctgagtcag
gacctcactattgatgaatcctctgatgaagatggagggaactggaggttctgtgagggg
agagccagaggccatgagaggtttggctcctgtcagcagggtctggctgccactttcacc
aaggactaccattacgtggtgtttggagcgcctggcgcctacaactggaaaggcattgta
cgtgtagagcaaaagaacaacactttgttggaaaggggattttatgatgacggaccttat
gaagttggagatgagaaccgcttggatcctgacctggtgcctgtgcctgctaacagctac
ttagggttttccattgattctgggcatagcatcaccaaggggcgtggcctgaccattgtg
tctggggcaccgcgagccaatcactgtggggctgtggtcctgttgagaaaggagaatgaa
gcgtccgcaagactctccccggagtacattctagaagggcctggacttgcatcttctttt
ggatatgatgtagctgtggtcgacctgaatggagatgggtggcaggatattgttgtggga
gcccctcagttctttatgaaagagagagactttggaggagctgtttatgtctacatcaac
caggcaggaaagtgggacaagatcaccccaatccgcctcaatggaaccaaagactcaatg
tttgggctggcagtggaaaacatcggtgacatcaatcaggattcctatcaagacattgct
gttggagcgccctacgctgatgccggggcaggaaaagtgtacatttaccacggttctgct
attggaatcaacaccaagccggcacagatccttgagggaatgcccaacatcatcagatta
tttggatattctctggctgggaacatggatttagataagaattcctatcctgatatagct
attgggtctctctcagatactgttctcgtttaccgggcaaggccaattattagcattcag
aaggatgtcaaaattactccaaaggaaattgacctcacaaagaaaacctgtggcaacagt
atctgcttgaccgtggaggcatgtttcacctataaagcaaaccctgtatcctacagccca
aaactaactatccgctacgcatttgagggtgaggcagatcgcaggaagcaagggcttccc
tccaggatcctcttcctcgacaagtctcgcaccgaccaggacttccaatcgaccggaact
ctggacctccggggacaaaacaaaagagcttgcaccaagacaaaaatcaaactgcaggat
aacattagggacaagctgcatggtattcccattgaggtgtcgttgggaatccagggtacc
aagcggcagaagaggcagaacgctctcccccagcttgtgcctattcttgacaactcccag
ccaagcaaggtcgtcactgaggtgaacttcttaaaggagggatgcggaaatgataatatt
tgccagagtagcttacaactggagtacagattctgctccaaagggctcaaccaagatata
tttccccctttacctatggagaatgggctaccagtgatctccctcagtgatcagaaggac
atagctctggaggtgacagtgaagaacagaaatggggatgatgcccatgaggctaaactg
gtggggatgttccccaacgctctctcatactccggtttccgctctcagaaaatgacaagg
gataaaccggttctctgtttagccaatcagaatggctcccaaacagagtgtgaactgggg
aatccattcaaaagagattcagaggttactttctacataatcttgagcactgctggtatc
tctctcgatacggcagaaattaatattgaccttgagcttcaaacgaccagtacacaggac
aaaatgggaagagtgaaagcaaaggcgaaagtcgtgattgagctgttactttctgttgca
ggagttgcgagaccctcccaggtgtattttgggggtgatgtgaaaggagagagtgccatc
aagacagaagaggagattggcggtttgattgattatgaatttaagataatcaatttgggt
aagccgttgaagtcctttggcacagcctcgttgaacatccagtggcccaaagagaatgtg
gatgggaaatggctgttatatctggttaagatcagcagtactggcctggaagagatcccc
tgctccccagagactgagatcaaccctctcaaacacattcaggagtccagcacatctagg
aaaaagcgtgaagttggaggcaaaaaatctggaagcaaaatgactttattggaccaaaaa
aagcacaagattttgatgtgtggcaatggctatgacgctagatgtgtggtgatcaagtgc
cctctacagggcttggacagtagtgcagtgattgcgctgcgatgccgcctgtggaacgct
accttccttgagaattatgccaatttgaactatcttgatataattgtgaaagcatccatc
agccttgatgctcctgcaaagaatatggttctcaggaatgctgagactcaggtgagagtc
acggtgtttccagagaaggcagtaacccagtatggtggagttccctggtggatcatcctt
gtggctgtcctggctggtattctgatgttggcattgctagtgtttctactctggaagtgt
ggatttttcaaacgttctgaacacgatgacagcgttccaatataccatgctgtacggata
aggaaaggggctcgtcagttcaaagacaggaaagccaagctgcattcctttgagaaaaag
cagtgggtgacacgctggaatgagaatgagaactactcataa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112226606
Entry
112226606         CDS       T05605                                 

Definition
(RefSeq) integrin alpha-6-like isoform X1
  KO
K06485  integrin alpha 6
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
otw04514  Cell adhesion molecules
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112226606
   04514 Cell adhesion molecules
    112226606
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112226606
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112226606
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112226606
   04515 Cell adhesion molecules [BR:otw04515]
    112226606
   04090 CD molecules [BR:otw04090]
    112226606
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112226606
  Exosomal proteins of breast milk
   112226606
Cell adhesion molecules [BR:otw04515]
 Integrins
  Integrin alpha subunits
   112226606
CD molecules [BR:otw04090]
 Proteins
  112226606
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS DUF11 Integrin_alpha
Other DBs
NCBI-GeneID: 112226606
NCBI-ProteinID: XP_024246814
LinkDB
Position
28
AA seq 1084 aa
MGLRFIQCISYLSLLLHLEWTHVSAFNLDTENVIEKKGEPGSLFGFSLAMHWQLSPLDKR
MLLVGAPRAKALRGQKAKITGGLYNCDTASTSSSCSRVQFDNDEDVNTESKENQWMGVTV
NSQGPGGKIVTCAHRYQRRLFVNTAQESRDITGRCYVLSQDLTIGTESDEDGGNWRFCEG
RARGHERFGSCQQGLSATFTRDYHYLVFGAPGAYNWKGVVRVEQKNNTLLEMGFYDDGPL
RWAMRIGLDPDLVPVPANSYLGFSLDSGKAITKKGQLTVVAGAPRANHSGAVVLLKKETE
ASTMLSPEHILEGEGLASSFGYDLAVVDLTGDGWEDIVVGARSFLRRGEVGGAIYVYVNK
GGDWSKVTPTRIDGPRDSMFGLAVENLGDLNLDGYQDIAVGAPYYDSGSGKVFIYHGSAQ
GINIKPAQVLSGVPSETKLFGYSLAGNMDLDRNSYPDLAVGSLSDSVFVYRTRPVISIQK
VVKTTPKEIDLTKKNCGNSICLEVEACFSYTANPKSYSPRLTVAYSFEVEAERRKKGLPP
RVTFSTRSSDDNDYQSTGVLILSGQGKKECITARLTLQENIKDKLRGIPIDVTVEIKNSK
RKRRALPELPPILDSNEPITARAEVSFLKEGCGSDNVCQSNVQLQHRFCYREPNKDVFHP
LPVEDGVPVVSLSDQKDIALEITVTNQNGDDAHEAALVASFPPSLSYSASRSAPNADKQV
ICVTNTNGSQADCELGNPFKRGSEATFYIILSTAGISLNTTELEIDLKLETTSDQQNVAR
VKAKAKVVIELLLSLTGVAKPSQVYFTGEVKGESAMHSEGDIGSPIEYEFRVINLGKPLK
TYGSAALIVNWPKETVEGKWLLYLMKIDSRGLEQITCSPEREINSLAVKEEQSSTRRRRA
VVETDKPQEGTIARLTDKRKYTTLSCEDGAKCVEIRCPLQGLDSNAVILLRSRLWNSTFL
EEYSKLNYLDVIVKASLRVDGAAKNMVLRNAETQVRVTVFPERRVAQYGGLPWWIILVAI
LLGLLLLGLLVFLLWKCGFFRRSKYDDSVPSYNAVRIQKEEKDQLGSLEKKAWITSWSEN
ESYS
NT seq 3255 nt   +upstreamnt  +downstreamnt
atggggttgagatttatacaatgtatctcatatctttcgcttctccttcacctggaatgg
acgcacgtatcggctttcaacctggacacagaaaacgtcattgaaaagaaaggagagccc
gggagccttttcggcttctctctggctatgcattggcaattaagtccgttggataaaaga
atgttgctggttggtgctccaagggccaaagctctgagaggtcagaaggcaaagatcaca
ggaggactctacaactgcgacaccgcttccacttcctccagctgtagccgagtgcagttc
gacaacgatgaggacgtgaacaccgagagtaaggagaaccaatggatgggtgtaacagta
aacagccaggggccgggaggaaagattgtgacgtgtgcccaccgctaccagcggcgtctg
tttgtgaacacagcccaggagtcacgtgacatcacagggcggtgttacgtgctgagccag
gacctgaccatcggtaccgagtctgatgaggacggagggaactggaggttctgtgagggg
cgggcacgcggccatgagaggtttggttcatgccaacagggtctgtctgccaccttcact
agggactaccactacctggtatttggtgcccctggagcgtacaactggaaaggtgtggtg
agagtagagcagaagaacaacactctgttggagatgggcttctatgacgacgggcccttg
aggtgggcgatgagaatcggtttagacccagacctggtccccgtgcccgctaacagttac
ttgggcttctctctggactcggggaaggccatcactaagaagggtcagctgaccgtggtc
gccggtgccccgagagccaatcacagcggggcagtggtgttgctaaagaaggagaccgaa
gcgtccaccatgttgtcaccagagcacatcctggaaggggaggggctggcctcgtcgttc
ggctacgacctcgctgtggtggatctgaccggcgacgggtgggaggacatcgtggtggga
gcccgcagttttttgagaaggggggaggtaggcggagccatttatgtctatgttaacaag
ggcggagactggagtaaggtcacgcccaccaggatagatggacctcgggactccatgttt
ggactggccgtagaaaacctgggagatctcaacctggacggctatcaggacatcgctgtg
ggagcaccctattatgacagtgggtcagggaaggtgttcatctaccacggctcagctcag
ggcatcaacatcaaaccggcgcaggtgttgtcaggggtgccatcggagacaaagctgttt
ggttattctctagctggtaacatggacttggacaggaactcgtaccctgacctggccgta
ggatctctctccgactctgtgttcgtctacaggactcggccagtcattagcatccagaag
gttgtcaagacaaccccaaaggagatcgatctgactaagaaaaactgtggcaacagcatc
tgcttggaggtagaagcctgcttctcctacaccgccaacccaaaatcctacagccccaga
ctgacggtggcgtactcctttgaggtggaggcggagcgtcggaagaagggtctccctccc
agagtgaccttctccacgcgttccagcgacgacaacgactaccagtccaccggtgttctc
atcctcagtgggcagggcaagaaggagtgtatcaccgccagactcacactacaggagaac
attaaggacaagctcaggggaatccccatcgacgttaccgtggagataaagaactccaaa
aggaaaagaagagcgctcccagaactcccgcccatcctcgactccaacgagcctatcacg
gcccgcgctgaggtgagcttcctgaaggagggctgtggcagtgataatgtgtgtcagagc
aacgtacagctccagcatcgcttctgctacagagagcccaacaaggacgtcttccatcca
ctacctgtggaggatggggtgccggtagtctcccttagcgaccagaaggacatcgccctg
gagatcacggtgaccaaccagaatggagatgatgcccacgaggcggcattggttgcctcc
ttccccccctcgctctcctactctgcctcccgctctgcacccaacgcggacaagcaggtg
atctgtgtgaccaatacgaacggctctcaggcagactgtgagctggggaaccccttcaag
cgaggctcagaggcgacgttctacatcatcttgagcacagcaggcatctctctgaacacc
acagagctggagatagacctgaagctggagacaacgagtgaccagcaaaacgtggccaga
gtcaaggccaaggccaaagtggtgatcgagctgctgctgtccctcacaggagtggccaag
ccctcccaggtctactttactggagaggtcaaaggtgagagcgccatgcattccgaagga
gacatcggcagccccatcgagtacgagttcagggtgattaacctggggaagcccctgaag
acatacggcagcgccgccctgatcgtcaattggccaaaggagacggtggaggggaagtgg
ctcctgtacctcatgaagatcgactccaggggtctggaacagatcacctgctcccctgag
agagagatcaactcacttgccgtcaaagaggagcagagcagcacccggagaagacgagcc
gtagtggagacagacaaacctcaggagggaaccatcgcacgactgactgacaagaggaaa
tacactactttgtcgtgtgaggacggggcaaagtgtgtggagattcgctgcccccttcag
ggcctggacagtaatgcagtcatcctgctcagatctcgcctctggaacagcacattcctg
gaggagtactccaagctgaactatctggacgtgatcgtgaaagcctctctcagagtggac
ggagcagccaaaaacatggtcctgaggaacgcagagacacaggtgagagtgacggtgttc
ccagagcgtcgtgtggctcagtacggaggactcccatggtggatcatcctggtagccatc
ttgttagggctgctgctgctcggcctgctggtcttcctgctgtggaagtgtgggtttttc
agacgctccaagtacgacgacagcgttcccagttataatgcggtgcggatacaaaaggag
gagaaagaccaactgggaagcctggaaaagaaagcctggataacgagctggagtgagaac
gagagttactcttaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112226662
Entry
112226662         CDS       T05605                                 

Definition
(RefSeq) integrin alpha-6-like isoform X1
  KO
K06485  integrin alpha 6
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
otw04514  Cell adhesion molecules
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112226662
   04514 Cell adhesion molecules
    112226662
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112226662
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112226662
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112226662
   04515 Cell adhesion molecules [BR:otw04515]
    112226662
   04090 CD molecules [BR:otw04090]
    112226662
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112226662
  Exosomal proteins of breast milk
   112226662
Cell adhesion molecules [BR:otw04515]
 Integrins
  Integrin alpha subunits
   112226662
CD molecules [BR:otw04090]
 Proteins
  112226662
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS DUF11 Integrin_alpha
Other DBs
NCBI-GeneID: 112226662
NCBI-ProteinID: XP_024246896
LinkDB
Position
28
AA seq 1084 aa
MGLRFIQCISYLSLLLHLEWTHVSAFNLDTENVIEKKGEPGSLFGFSLAMHWQLSPLDKR
MLLVGAPRAKALRGQKAKITGGLYNCDTASTSSSCSRVQFDNDEDVNTESKENQWMGVTV
NSQGPGGKIVTCAHRYQRRLFVNTAQESRDITGRCYVLSQDLTIGTESDEDGGNWRFCEG
RARGHERFGSCQQGLSATFTRDYHYLVFGAPGAYNWKGVVRVEQKNNTLLEMGFYDDGPL
RWAMRIGLDPDLVPVPANSYLGFSLDSGKAITKKGQLTVVAGAPRANHSGAVVLLKKETE
ASTMLSPEHILEGEGLASSFGYDLAVVDLTGDGWEDIVVGARSFLRRGEVGGAIYVYVNK
GGDWSKVTPTRIDGPRDSMFGLAVENLGDLNLDGYQDIAVGAPYYDSGSGKVFIYHGSAQ
GINIKPAQVLSGVPSETKLFGYSLAGNMDLDRNSYPDLAVGSLSDSVFVYRTRPVISIQK
VVKTTPKEIDLTKKNCGNSICLEVEACFSYTANPKSYSPRLTVAYSFEVEAERRKKGLPP
RVTFSTRSSDDNDYQSTGVLILSGQGKKECITARLTLQENIKDKLRGIPIDVTVEIKNSK
RKRRALPELPPILDSNEPITARAEVSFLKEGCGSDNVCQSNVQLQHRFCYREPNKDVFHP
LPVEDGVPVVSLSDQKDIALEITVTNQNGDDAHEAALVASFPPSLSYSASRSAPNADKQV
ICVTNTNGSQADCELGNPFKRGSEATFYIILSTAGISLNTTELEIDLKLETTSDQQNVAR
VKAKAKVVIELLLSLTGVAKPSQVYFTGEVKGESAMHSEGDIGSPIEYEFRVINLGKPLK
TYGSAALIVNWPKETVEGKWLLYLMKIDSRGLEQITCSPEREINSLAVKEEQSSTRRRRA
VVETDKPQEGTIARLTDKRKYTTLSCEDGAKCVEIRCPLQGLDSNAVILLRSRLWNSTFL
EEYSKLNYLDVIVKASLRVDGAAKNMVLRNAETQVRVTVFPERRVAQYGGLPWWIILVAI
LLGLLLLGLLVFLLWKCGFFRRSKYDDSVPSYNAVRIQKEEKDQLGSLEKKAWITSWSEN
ESYS
NT seq 3255 nt   +upstreamnt  +downstreamnt
atggggttgagatttatacaatgtatctcatatctttcgcttctccttcacctggaatgg
acgcacgtatcggctttcaacctggacacagaaaacgtcattgaaaagaaaggagagccc
gggagccttttcggcttctctctggctatgcattggcaattaagtccgttggataaaaga
atgttgctggttggtgctccaagggccaaagctctgagaggtcagaaggcaaagatcaca
ggaggactctacaactgcgacaccgcttccacttcctccagctgtagccgagtgcagttc
gacaacgatgaggacgtgaacaccgagagtaaggagaaccaatggatgggtgtaacagta
aacagccaggggccgggaggaaagattgtgacgtgtgcccaccgctaccagcggcgtctg
tttgtgaacacagcccaggagtcacgtgacatcacagggcggtgttacgtgctgagccag
gacctgaccatcggtaccgagtctgatgaggacggagggaactggaggttctgtgagggg
cgggcacgcggccatgagaggtttggttcatgccaacagggtctgtctgccaccttcact
agggactaccactacctggtatttggtgcccctggagcgtacaactggaaaggtgtggtg
agagtagagcagaagaacaacactctgttggagatgggcttctatgacgacgggcccttg
aggtgggcgatgagaatcggtttagacccagacctggtccccgtgcccgctaacagttac
ttgggcttctctctggactcggggaaggccatcactaagaagggtcagctgaccgtggtc
gccggtgccccgagagccaatcacagcggggcagtggtgttgctaaagaaggagaccgaa
gcgtccaccatgttgtcaccagagcacatcctggaaggggaggggctggcctcgtcgttc
ggctacgacctcgctgtggtggatctgaccggcgacgggtgggaggacatcgtggtggga
gcccgcagttttttgagaaggggggaggtaggcggagccatttatgtctatgttaacaag
ggcggagactggagtaaggtcacgcccaccaggatagatggacctcgggactccatgttt
ggactggccgtagaaaacctgggagatctcaacctggacggctatcaggacatcgctgtg
ggagcaccctattatgacagtgggtcagggaaggtgttcatctaccacggctcagctcag
ggcatcaacatcaaaccggcgcaggtgttgtcaggggtgccatcggagacaaagctgttt
ggttattctctagctggtaacatggacttggacaggaactcgtaccctgacctggccgta
ggatctctctccgactctgtgttcgtctacaggactcggccagtcattagcatccagaag
gttgtcaagacaaccccaaaggagatcgatctgactaagaaaaactgtggcaacagcatc
tgcttggaggtagaagcctgcttctcctacaccgccaacccaaaatcctacagccccaga
ctgacggtggcgtactcctttgaggtggaggcggagcgtcggaagaagggtctccctccc
agagtgaccttctccacgcgttccagcgacgacaacgactaccagtccaccggtgttctc
atcctcagtgggcagggcaagaaggagtgtatcaccgccagactcacactacaggagaac
attaaggacaagctcaggggaatccccatcgacgttaccgtggagataaagaactccaaa
aggaaaagaagagcgctcccagaactcccgcccatcctcgactccaacgagcctatcacg
gcccgcgctgaggtgagcttcctgaaggagggctgtggcagtgataatgtgtgtcagagc
aacgtacagctccagcatcgcttctgctacagagagcccaacaaggacgtcttccatcca
ctacctgtggaggatggggtgccggtagtctcccttagcgaccagaaggacatcgccctg
gagatcacggtgaccaaccagaatggagatgatgcccacgaggcggcattggttgcctcc
ttccccccctcgctctcctactctgcctcccgctctgcacccaacgcggacaagcaggtg
atctgtgtgaccaatacgaacggctctcaggcagactgtgagctggggaaccccttcaag
cgaggctcagaggcgacgttctacatcatcttgagcacagcaggcatctctctgaacacc
acagagctggagatagacctgaagctggagacaacgagtgaccagcaaaacgtggccaga
gtcaaggccaaggccaaagtggtgatcgagctgctgctgtccctcacaggagtggccaag
ccctcccaggtctactttactggagaggtcaaaggtgagagcgccatgcattccgaagga
gacatcggcagccccatcgagtacgagttcagggtgattaacctggggaagcccctgaag
acatacggcagcgccgccctgatcgtcaattggccaaaggagacggtggaggggaagtgg
ctcctgtacctcatgaagatcgactccaggggtctggaacagatcacctgctcccctgag
agagagatcaactcacttgccgtcaaagaggagcagagcagcacccggagaagacgagcc
gtagtggagacagacaaacctcaggagggaaccatcgcacgactgactgacaagaggaaa
tacactactttgtcgtgtgaggacggggcaaagtgtgtggagattcgctgcccccttcag
ggcctggacagtaatgcagtcatcctgctcagatctcgcctctggaacagcacattcctg
gaggagtactccaagctgaactatctggacgtgatcgtgaaagcctctctcagagtggac
ggagcagccaaaaacatggtcctgaggaacgcagagacacaggtgagagtgacggtgttc
ccagagcgtcgtgtggctcagtacggaggactcccatggtggatcatcctggtagccatc
ttgttagggctgctgctgctcggcctgctggtcttcctgctgtggaagtgtgggtttttc
agacgctccaagtacgacgacagcgttcccagttataatgcggtgcggatacaaaaggag
gagaaagaccaactgggaagcctggaaaagaaagcctggataacgagctggagtgagaac
gagagttactcttaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112232316
Entry
112232316         CDS       T05605                                 

Definition
(RefSeq) integrin alpha-4-like
  KO
K06483  integrin alpha 4
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
otw04514  Cell adhesion molecules
otw04672  Intestinal immune network for IgA production
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112232316
   04514 Cell adhesion molecules
    112232316
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112232316
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112232316
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    112232316
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112232316
   04515 Cell adhesion molecules [BR:otw04515]
    112232316
   04090 CD molecules [BR:otw04090]
    112232316
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112232316
  Exosomal proteins of other cancer cells
   112232316
Cell adhesion molecules [BR:otw04515]
 Integrins
  Integrin alpha subunits
   112232316
CD molecules [BR:otw04090]
 Proteins
  112232316
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS
Other DBs
NCBI-GeneID: 112232316
NCBI-ProteinID: XP_024255043
LinkDB
Position
Unknown
AA seq 1079 aa
MTTYGLGLHSIGLNMLFCFLLRHADLYNLDIPHAIPLSGPNGTFFGYSVLLHKHQQQTWV
IVGAPVANSRFNQAVRNPGAIYKCKITDKKDCEQIQLGVMLDMPCGRHCSAEVENQWLGV
SLSRRQQDGLVLACGHRWKNVYFTKKEDLNKLPHGVCYKLESDLNQSSPLIPCYRDHENK
FGNDFASCQAGISNVLIGDLIVMGAPGTLYWTGSVFVHNISSQITSAYLDDNVVLYGSYL
GYSVSAGHFLHPNSTEVVGGAPQYGQTGRAYIFSIESSTLSIISEVKGQKLGSYFGGTVC
AVDLNTDGLSDLLVGAPMFSTVREEGRVYIYMNQGQANMKEMEFTLAGRDSYAARFGESI
TSLGDIDDDGYPDVAVGAPQEDDLHGAIYIYNGRKTGLGQYFSQRIAGSALGSAFKMFGQ
SVSGGIDVDGNGYPDVAVGAFLSDSAVVLRTRAVVVVEAMILLPPSVNRTHALCTENGQP
AICLKTSVCFQLYAKRVSGLIEILYNLTADVKHIEGLQSRFFFNTNGTELSNATAGSIKT
RHGHMTCVTHLAFLRRDIRDIFTPIHFELQYELGEHNVVRDNSKSFPPLRPMLQRGEEYS
NLLTNKTVFTRYCAWANCSTNLQVSAQLLLLRTHRDMPYVALGEGKTILLNVTLSNAGDA
AFLPMLHLRYPSNLYFIKVLDAEEKYVSCKIAEEEKRSVGLDCSVGNLFFNTLAKVNISF
LLDVSADSEPGDLNIIINATRENLENEDLLHDNIVNLTLLLRYGVNLNIHGFVSRTEFVF
GDFEEPHCSAERFKYTFKVVNVGPSISHGTRVEIDIPKALAPYPYRLLNILDIQSSSGWC
YIRNSTDGTRSTHGTMYGSQRASTIDSVWLNVTTTTDSYWTNRSSTTHPYWTNISSTTDT
NWTSISYWANVRNWTTVIEDECDLPDSNPLNDFFFFFSKSSRRHMYCMKEDALCLYAVCE
LGDMDIGKDVTIEMEVEMNSGVLDISPGRHSVMLLETTAVISPKKDPFIWFLKEDPITVV
VLEAHHSHKLKRVIELSIIVASLLLGLFILALLVICMWKSGFFKREDKMENIQRLSWDY
NT seq 3240 nt   +upstreamnt  +downstreamnt
atgactacatacgggctaggcttacacagcatagggctaaacatgttgttttgctttctc
ttacgtcatgccgatttgtacaatttagacataccgcacgctattccactcagtggtccg
aatggaacattttttggatattctgtgttgctacacaagcatcagcaacagacatgggta
atagttggcgcaccagttgcaaattcaaggttcaaccaggctgtcaggaatcctggagca
atctacaagtgcaaaattacagacaagaaggactgtgaacagattcaactcggtgtaatg
cttgacatgccctgtggcagacactgttctgctgaggttgaaaaccagtggcttggtgtg
agcctctccaggcggcagcaggatggacttgtgttggcctgtggacatcgttggaaaaat
gtctacttcaccaaaaaagaagatctaaataagttgccacatggcgtatgctacaaattg
gagtctgacttgaatcaatcaagtcctttgattccatgctacagagatcacgaaaataag
tttggcaatgactttgcatcatgtcaagcagggatttcaaatgtccttattggggacctc
atagtaatgggagcccctggaaccttgtattggactgggtctgtttttgtccacaacata
tccagtcagatcacttctgcctacttggatgataacgttgtcctctatggaagttatttg
gggtactcagtcagcgctggccacttcctgcacccaaactccactgaggtagtgggtgga
gccccccagtacgggcagactggaagagcctacatctttagcatagagtccagcacactg
agcatcatctctgaggttaaaggtcaaaagctgggttcctattttgggggcactgtgtgt
gcagtggacctgaacactgatggcctgtctgacctgctggtgggagctccaatgttcagc
actgtgagggaggagggccgtgtgtacatctacatgaaccagggacaggctaacatgaag
gagatggagtttacattagcagggagagattcatatgcagcccggtttggggaaagtatc
acaagtcttggagatattgatgatgatggctatccagatgttgcagttggggcaccacaa
gaggatgacctacatggtgctatttatatctacaatgggaggaagacgggacttggacaa
tacttttctcaaaggattgctgggtctgccttgggtagtgctttcaagatgtttggccag
tctgtgtctgggggcattgatgttgatggaaacggttacccagatgtggccgtgggagcc
tttctgtccgactctgctgttgttctgaggacacgggcggttgttgtggtggaggcgatg
atacttcttcctcctagtgtgaaccgcacccatgccctgtgtacagagaacggccagcct
gccatttgcctcaaaacctctgtgtgcttccagttgtatgcgaaacgtgtctctgggctt
atcgaaatactgtacaacctgacggctgatgtcaagcacatagaggggctccagtccaga
ttcttcttcaacaccaacggcacagagttatcaaatgccacagcaggcagcatcaagacc
aggcatggccacatgacctgtgttacccatctggcctttctgaggagagacattcgggac
atcttcacccccatccactttgagctgcagtatgagctgggagagcacaatgtggtgagg
gataactccaagagctttccccctctcaggcctatgctccagaggggagaggagtacagc
aacttgctgaccaacaagactgtattcaccaggtactgtgcctgggccaactgttccacc
aatctgcaagtgtctgcacagctgctgttactgaggacacatagagacatgccatacgtt
gccctgggggaggggaagaccattctactgaatgttacgctgtccaatgctggcgacgcc
gccttcctccccatgcttcacctgagataccccagcaatctctacttcatcaaagtgttg
gacgctgaggagaaatacgtgagctgtaaaattgctgaggaagagaagagaagtgtcggg
ctagattgcagcgtgggaaatttgtttttcaacaccttagccaaagttaatatcagcttt
ctgctggatgtcagtgctgacagtgaacctggtgacctgaacattataatcaatgcaacc
cgggagaatttagaaaatgaagatcttctccatgacaatattgttaatctgactctgcta
ttgagatatggagtgaatctaaacatccacggttttgtatcccgaacagagtttgtgttt
ggggactttgaggagccacactgctccgctgagaggttcaaatacaccttcaaggttgtc
aatgttggtccaagcatatctcacggcacaagagtggaaattgatatccccaaagcttta
gcaccgtatccatacagactgctcaacattttggacatacagtcatcttctgggtggtgt
tacattcgaaactccactgatgggaccagaagtacacatggcaccatgtatggaagccag
agagccagtaccattgacagtgtttggttaaatgtgacaactaccactgacagctattgg
acgaataggtccagcaccacacacccttattggactaatatttccagtaccactgacacc
aattggactagtatatcctattgggccaatgtgagaaactggaccactgttattgaggat
gagtgtgatctgcctgactccaatcccttgaatgatttcttcttcttcttctcaaaaagc
agtagaagacatatgtattgtatgaaagaggatgctctgtgtctgtacgcggtgtgtgag
cttggagacatggacattgggaaagatgtcaccattgaaatggaggtcgaaatgaattcg
ggagttttagacatctcaccgggaagacatagtgtcatgctgttagagaccactgctgtc
atatcacccaagaaggacccatttatttggttcttaaaagaagaccccatcacagtggtt
gtcctggaggcccatcatagccacaaactgaaacgagtcattgagctgtccatcatcgtg
gccagtctcttactaggcctcttcatccttgccttgctggtcatctgcatgtggaagagt
ggcttctttaagcgtgaggataagatggagaatatacaaaggctcagctgggactactga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112232498
Entry
112232498         CDS       T05605                                 

Definition
(RefSeq) integrin alpha-4-like
  KO
K06483  integrin alpha 4
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
otw04514  Cell adhesion molecules
otw04672  Intestinal immune network for IgA production
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112232498
   04514 Cell adhesion molecules
    112232498
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112232498
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112232498
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    112232498
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112232498
   04515 Cell adhesion molecules [BR:otw04515]
    112232498
   04090 CD molecules [BR:otw04090]
    112232498
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112232498
  Exosomal proteins of other cancer cells
   112232498
Cell adhesion molecules [BR:otw04515]
 Integrins
  Integrin alpha subunits
   112232498
CD molecules [BR:otw04090]
 Proteins
  112232498
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS
Other DBs
NCBI-GeneID: 112232498
NCBI-ProteinID: XP_024255307
LinkDB
Position
Unknown
AA seq 1079 aa
MTTYGLGLHSIGLNMLFCFLLRHADLYNLDIPHAIPLSGPNGTFFGYSVLLHKHQQQTWV
IVGAPVANSRFNQAVRNPGAIYKCKITDKKDCEQIQLGVMLDMPCGRHCSAEVENQWLGV
SLSRRQQDGLVLACGHRWKNVYFTKKEDLNKLPHGVCYKLESDLNQSSPLIPCYRDHENK
FGNDFASCQAGISNVLIGDLIVMGAPGTLYWTGSVFVHNISSQITSAYLDDNVVLYGSYL
GYSVSAGHFLHPNSTEVVGGAPQYGQTGRAYIFSIESSTLSIISEVKGQKLGSYFGGTVC
AVDLNTDGLSDLLVGAPMFSTVREEGRVYIYMNQGQANMKEMEFTLAGRDSYAARFGESI
TSLGDIDDDGYPDVAVGAPQEDDLHGAIYIYNGRKTGLGQYFSQRIAGSALGSAFKMFGQ
SVSGGIDVDGNGYPDVAVGAFLSDSAVVLRTRAVVVVEAMILLPPSVNRTHALCTENGQP
AICLKTSVCFQLYAKRVSGLIEILYNLTADVKHIEGLQSRFFFNTNGTELSNATAGSIKT
RHGHMTCVTHLAFLRRDIRDIFTPIHFELQYELGEHNVVRDNSKSFPPLRPMLQRGEEYS
NLLTNKTVFTRYCAWANCSTNLQVSAQLLLLRTHRDMPYVALGEGKTILLNVTLSNAGDA
AFLPMLHLRYPSNLYFIKVLDAEEKYVSCKIAEEEKRSVGLDCSVGNLFFNTLAKVNISF
LLDVSADSEPGDLNIIINATRENLENEDLLHDNIVNLTLLLRYGVNLNIHGFVSRTEFVF
GDFEEPHCSAERFKYTFKVVNVGPSISHGTRVEIDIPKALAPYPYRLLNILDIQSSSGWC
YIRNSTDGTRSTHGTMYGSQRASTIDSVWLNVTTTTDSYWTNRSSTTHPYWTNISSTTDT
NWTSISYWANVRNWTTVIEDECDLPDSNPLNDFFFFFSKSSRRHMYCMKEDALCLYAVCE
LGDMDIGKDVTIEMEVEMNSGVLDISPGRHSVMLLETTAVISPKKDPFIWFLKEDPITVV
VLEAHHSHKLKRVIELSIIVASLLLGLFILALLVICMWKSGFFKREDKMENIQRLSWDY
NT seq 3240 nt   +upstreamnt  +downstreamnt
atgactacatacgggctaggcttacacagcatagggctaaacatgttgttttgctttctc
ttacgtcatgccgatttgtacaatttagacataccgcacgctattccactcagtggtccg
aatggaacattttttggatattctgtgttgctacacaagcatcagcaacagacatgggta
atagttggcgcaccagttgcaaattcaaggttcaaccaggctgtcaggaatcctggagca
atctacaagtgcaaaattacagacaagaaggactgtgaacagattcaactcggtgtaatg
cttgacatgccctgtggcagacactgttctgctgaggttgaaaaccagtggcttggtgtg
agcctctccaggcggcagcaggatggacttgtgttggcctgtggacatcgttggaaaaat
gtctacttcaccaaaaaagaagatctaaataagttgccacatggcgtatgctacaaattg
gagtctgacttgaatcaatcaagtcctttgattccatgctacagagatcacgaaaataag
tttggcaatgactttgcatcatgtcaagcagggatttcaaatgtccttattggggacctc
atagtaatgggagcccctggaaccttgtattggactgggtctgtttttgtccacaacata
tccagtcagatcacttctgcctacttggatgataacgttgtcctctatggaagttatttg
gggtactcagtcagcgctggccacttcctgcacccaaactccactgaggtagtgggtgga
gccccccagtacgggcagactggaagagcctacatctttagcatagagtccagcacactg
agcatcatctctgaggttaaaggtcaaaagctgggttcctattttgggggcactgtgtgt
gcagtggacctgaacactgatggcctgtctgacctgctggtgggagctccaatgttcagc
actgtgagggaggagggccgtgtgtacatctacatgaaccagggacaggctaacatgaag
gagatggagtttacattagcagggagagattcatatgcagcccggtttggggaaagtatc
acaagtcttggagatattgatgatgatggctatccagatgttgcagttggggcaccacaa
gaggatgacctacatggtgctatttatatctacaatgggaggaagacgggacttggacaa
tacttttctcaaaggattgctgggtctgccttgggtagtgctttcaagatgtttggccag
tctgtgtctgggggcattgatgttgatggaaacggttacccagatgtggccgtgggagcc
tttctgtccgactctgctgttgttctgaggacacgggcggttgttgtggtggaggcgatg
atacttcttcctcctagtgtgaaccgcacccatgccctgtgtacagagaacggccagcct
gccatttgcctcaaaacctctgtgtgcttccagttgtatgcgaaacgtgtctctgggctt
atcgaaatactgtacaacctgacggctgatgtcaagcacatagaggggctccagtccaga
ttcttcttcaacaccaacggcacagagttatcaaatgccacagcaggcagcatcaagacc
aggcatggccacatgacctgtgttacccatctggcctttctgaggagagacattcgggac
atcttcacccccatccactttgagctgcagtatgagctgggagagcacaatgtggtgagg
gataactccaagagctttccccctctcaggcctatgctccagaggggagaggagtacagc
aacttgctgaccaacaagactgtattcaccaggtactgtgcctgggccaactgttccacc
aatctgcaagtgtctgcacagctgctgttactgaggacacatagagacatgccatacgtt
gccctgggggaggggaagaccattctactgaatgttacgctgtccaatgctggcgacgcc
gccttcctccccatgcttcacctgagataccccagcaatctctacttcatcaaagtgttg
gacgctgaggagaaatacgtgagctgtaaaattgctgaggaagagaagagaagtgtcggg
ctagattgcagcgtgggaaatttgtttttcaacaccttagccaaagttaatatcagcttt
ctgctggatgtcagtgctgacagtgaacctggtgacctgaacattataatcaatgcaacc
cgggagaatttagaaaatgaagatcttctccatgacaatattgttaatctgactctgcta
ttgagatatggagtgaatctaaacatccacggttttgtatcccgaacagagtttgtgttt
ggggactttgaggagccacactgctccgctgagaggttcaaatacaccttcaaggttgtc
aatgttggtccaagcatatctcacggcacaagagtggaaattgatatccccaaagcttta
gcaccgtatccatacagactgctcaacattttggacatacagtcatcttctgggtggtgt
tacattcgaaactccactgatgggaccagaagtacacatggcaccatgtatggaagccag
agagccagtaccattgacagtgtttggttaaatgtgacaactaccactgacagctattgg
acgaataggtccagcaccacacacccttattggactaatatttccagtaccactgacacc
aattggactagtatatcctattgggccaatgtgagaaactggaccactgttattgaggat
gagtgtgatctgcctgactccaatcccttgaatgatttcttcttcttcttctcaaaaagc
agtagaagacatatgtattgtatgaaagaggatgctctgtgtctgtacgcggtgtgtgag
cttggagacatggacattgggaaagatgtcaccattgaaatggaggtcgaaatgaattcg
ggagttttagacatctcaccgggaagacatagtgtcatgctgttagagaccactgctgtc
atatcacccaagaaggacccatttatttggttcttaaaagaagaccccatcacagtggtt
gtcctggaggcccatcatagccacaaactgaaacgagtcattgagctgtccatcatcgtg
gccagtctcttactaggcctcttcatccttgccttgctggtcatctgcatgtggaagagt
ggcttctttaagcgtgaggataagatggagaatatacaaaggctcagctgggactactga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112235545
Entry
112235545         CDS       T05605                                 

Definition
(RefSeq) integrin alpha-10-like
  KO
K06586  integrin alpha 10
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112235545
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112235545
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112235545
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:otw04515]
    112235545
Cell adhesion molecules [BR:otw04515]
 Integrins
  Integrin alpha subunits
   112235545
SSDB
Motif
Pfam: Integrin_alpha2 Metallopep
Other DBs
NCBI-GeneID: 112235545
NCBI-ProteinID: XP_024259767
LinkDB
Position
Unknown
AA seq 531 aa
MSFSLPLSSSRIIVQIKLSLSFQPHPSTSSRRRVREEGGVCLSQHYSLLLALSLPLETPS
SSFDLSVVAMLDERKLTARALFDDSNQRQTQLGVRVHTGQTVCHNLPFHVFDTADYIRPI
SFSLRFKINDTESGPVLDEGWPTTFKRSIAFFKDCGEDDVCVTDLVLQAHMDISGTRQQP
YVIRSPRRRLAVEVQLQNRLENAYNTSLTLHYSRNLHFSSLSIREDTQLKIECXSLSSNS
HSCNVSYPVFRSHSKVNFMLEFEFSCTSLLSKVQMKLTVASDSVEREATLGDNSVQLQTV
VQYEPDLFITSDSNLNRYEVHPTRTISEAIGPEFYTHFRLQNLGCYSVSNLELRLSLPSV
AAGDRVFMAVTEVFSYNVTGVNCSVDSDVSQXKDRQRDVRPLHPEDMQQTDLLNCSRSWC
VEVVCEVQQLHRGQTALIRVSRRVHDNFFRQAKFKVVRIVSAYRLAAQESNLVTLGSGAI
WRETVLEVLKGRAIPISLWILIVASLEASAIGPHPLRNVEGTPSHLTIQYL
NT seq 1596 nt   +upstreamnt  +downstreamnt
atgtcattctccctccctctctccagttctcgtattatagtccagatcaaactgagtctg
tccttccagccccacccatcaacgtcatccagaagacgtgtcagagaggagggaggagtc
tgcctgtctcaacactacagcctgctcctggctctgtcccttcccctggaaactcccagc
agcagcttcgatctgtcggtggtggccatgttggatgagagaaagttgacagcgagggcg
ttgtttgacgacagcaaccagagacagacacagctgggggtcagagttcacacaggacag
accgtctgccacaacctgcccttccatgtgtttgacacagcagactacatccgtccaatc
agcttctccctgcgctttaagatcaacgacacagagagcggcccagtgctggacgaaggc
tggcccaccaccttcaagagatcgattgcgttcttcaaagactgtggtgaggatgatgtg
tgtgtcactgatctggtgctgcaggctcatatggacatctctgggacaagacagcagccc
tatgtgatccgtagccctcgcagacgtctggctgtagaagtccagctgcagaacagactg
gagaacgcctacaacaccagcctgacactgcactactcacgcaacctccacttctctagt
ctcagtatacgggaggatacccagttgaaaattgagtgtwcatctctcagttccaacagt
cattcctgtaatgtcagctatcctgtgttccgctcccactccaaggtgaacttcatgtta
gagtttgagttcagctgtacgtctctgctcagtaaagtccagatgaaactcacagttgcc
agtgacagtgtggagagagaggctacgttgggagacaacagtgttcagctccagactgtg
gttcagtacgaacctgacctcttcatcaccagtgactccaatctgaaccgttatgaggtc
cacccaaccagaaccatatcagaggcaataggaccagagttctacacacacttcaggctg
cagaacctgggctgttacagtgtgagtaacctggagttgaggctgagcctgccctctgta
gcagctggagacagagtcttcatggctgttactgaggtcttctcttacaacgtgacaggg
gtgaactgcagtgtagacagtgacgtgtcccagcwgaaggacagacagagagatgtacga
ccactacatcctgaagacatgcaacagactgacctactgaactgcagcaggtcgtggtgt
gtggaggtggtgtgtgaggtacagcagctgcatcgaggacagactgctctcatacgagtc
agccgcagggtccacgacaacttcttcagacaggctaagtttaaggtggtgaggatagtg
agtgcctatcgtctggctgctcaggaatctaacctggtcactctggggagtggcgccatc
tggagggagacggtgttggaggtactaaaggggcgggccatccctatttctctctggatt
ctgatagtagcatcattggaggcttctgctattggccctcatcctcttcgcaatgtggaa
ggtacaccatcacacctcaccatacagtacctctga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112236612
Entry
112236612         CDS       T05605                                 

Gene name
itga6
Definition
(RefSeq) integrin alpha-6 isoform X1
  KO
K06485  integrin alpha 6
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
otw04514  Cell adhesion molecules
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112236612 (itga6)
   04514 Cell adhesion molecules
    112236612 (itga6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112236612 (itga6)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112236612 (itga6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112236612 (itga6)
   04515 Cell adhesion molecules [BR:otw04515]
    112236612 (itga6)
   04090 CD molecules [BR:otw04090]
    112236612 (itga6)
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112236612 (itga6)
  Exosomal proteins of breast milk
   112236612 (itga6)
Cell adhesion molecules [BR:otw04515]
 Integrins
  Integrin alpha subunits
   112236612 (itga6)
CD molecules [BR:otw04090]
 Proteins
  112236612 (itga6)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS FG-GAP_2 Integrin_alpha
Other DBs
NCBI-GeneID: 112236612
NCBI-ProteinID: XP_024260976
LinkDB
Position
3
AA seq 1094 aa
MVLPIRYFPIHVALFCLLEWTPISAFNLDTLNVLRKDGEPGSLFGFSLAMHRQLIPSDKR
ILLIGAPRAKALANQRANITGGLYSCDITTESDDCDRIDFDNEEDVRVENKENQWMGVTV
NSQGPGGKIVTCAHRYQRRLFVDTAQESRDITGRCYVLSQDLTIDTSSDEDGGNWKFCEG
RARGHERFGSCQQGLAATFTKDYHYVVFGAPGAYNWKGIVRVEQKNNTLLEKGFYDDGPY
EVGDENRLDPDLVPVPANSYLGFSLDSGFSITKGHGLTIVSGAPRANHCGAVVLLRKENE
ASARLSPEYILEGPGLASSFGYDVAVVDLNGDGWQDIVVGAPQFFMKEGDIGGAVYVYIN
QAGKWAKITPIRLNGTKDSMFGLAVENIGDINQDSYQDIAVGAPYADTGAGKVYIYHGSA
NGINTMPAQILEGKTNNIRLFGYSLAGNMDLDKNSYPDIAIGSLSDTVLVYRARPIISIK
KDVKITPKEIDFTKKTCGNSICLTVEACFTYKANPASYSPKLTIRYAFEAEADRRKQGLI
SRVLFLNKSRTDQDFQSTGFLDLRGQNKRACTKTKIRLQDNIRDKLRGIPIEVSVGIQGT
KRQKRQNALPQLVPILDNSQPSKVVTEVNFLKEGCGNDNICQSNLQLEYRFCSKEPNQEV
FHPLQMQNGLPVISLSDQKDIALEVTVKNRNGDDAHEAKLVGMFPNALSFSGFRSQKTTR
DKPVLCLANQNGSQTECELGNPFKRDSEVTFYIILSTAGISLNTTEIDIDLELQTTSTQE
RTGSLKARAKVVIEMLLSVAGVARPSQVYFGGDVQGESAIKTEEEIGSLIDYEFRIINLG
KPLKSFGTASLNIQWPKENVDGKWLLYLVKISTTGLEEIPCSPETEINSLKHIQESSTSR
KKREAGGKTSGGKISLVSDQRKHKILMCGNGYDSRCVVIKCPLLGLDSSAVISLRSRLWN
ATFLENYASLNYLDIIVKASISLDAPAKNMVLRNAETQVRVTVFPEKAVAQFGGVPWWII
LVAVLAGILMLALLVFLLWKCGFFKRSKHDDSVPRYHAVRIKKEACQFKDGKAKLDSFEK
KQWMTSWNENESYS
NT seq 3285 nt   +upstreamnt  +downstreamnt
atggttctcccaataagatattttccaattcatgtggcacttttttgtttgctagaatgg
actcctatatcagccttcaacctggataccttgaatgtcctgaggaaagacggggaaccg
ggcagtttatttggattctctctagccatgcaccggcaacttattccttcagataagaga
atactgttgattggagcaccaagagccaaagctctggccaaccagagagccaacataacc
ggaggcctgtacagttgtgacatcaccacagaatccgatgactgtgatcgcatcgatttt
gacaatgaagaggatgtgagagttgagaacaaggagaaccagtggatgggggtgacagtt
aacagccagggccccggagggaagattgtgacctgtgctcatcgctaccagagacgtctg
tttgtggacactgctcaggagtcccgtgacatcacaggccgctgctacgtcctgagtcag
gacctcactattgatacgtcctctgatgaagacggagggaactggaagttctgtgaggga
cgtgccagaggccatgagaggtttggctcatgccagcagggtctggctgccacgttcacc
aaagactaccattacgtggtgtttggagcgcctggcgcctacaactggaaaggcattgta
cgtgtagagcaaaagaacaacactttgttggaaaagggattttatgatgacggaccttat
gaagttggagatgagaaccgcttggatcctgacctggtgcctgtgcctgctaacagctac
ctaggattttcccttgattctggctttagcatcaccaaggggcatggcctaactattgtg
tctggagcaccacgagccaatcactgtggggctgtggtcctgttgcgaaaagagaatgaa
gcgtcagcaagactctccccagagtacattctagaagggcctggactggcatcgtctttt
ggatatgatgtagctgtggtcgacctgaatggagatgggtggcaggatattgttgtggga
gcccctcagttcttcatgaaagagggagacattggaggagctgtttatgtctacatcaac
caggcaggaaagtgggccaagatcaccccaatccgcctcaatggaaccaaggactcaatg
tttgggctggcagtggaaaacatcggtgacatcaatcaggactcctatcaagacattgct
gttggagcgccctacgctgacactggtgcaggaaaagtgtacatttaccatggttctgct
aatggaatcaacaccatgcctgcacagatccttgagggaaagaccaacaacatcagatta
tttggatattctctggctgggaacatggatttagataagaattcctatcctgatatagcc
attgggtcgctctcagatacagtactcgtttacagggcaaggccaattattagtatcaag
aaggatgtcaaaattactccgaaggaaattgacttcacaaagaaaacctgtggcaacagt
atctgtttgaccgtggaagcatgcttcacctataaagcaaaccctgcatcctacagccca
aaactaactatccgctatgcatttgaggctgaagcagatcgcaggaagcaagggctgatc
tctagggtcctgtttctgaacaagtctcgcaccgaccaggacttccagtccaccggattt
ctggacctccggggacaaaacaaaagagcgtgtaccaagacaaaaatcagactgcaggat
aacattagggacaagctgcgtggtattcccattgaggtgtcagtgggaatccagggtacc
aagcgtcagaagaggcagaatgctctcccccagcttgtgcctattcttgacaactcccag
ccaagcaaggtcgtcactgaggttaacttcttaaaggaaggatgtggaaatgataatatt
tgccagagtaatttacaactggagtacagattctgctccaaagagcccaaccaagaggta
ttccacccgttacagatgcagaatggtctaccagtgatctccctcagtgatcagaaggac
atagctctggaggtgacagtgaagaacagaaatggggatgatgcccatgaggctaagctg
gtggggatgttccctaatgctctctcattctccggctttcgctctcagaaaactacgagg
gataaaccggtgctttgtttagccaatcagaatggttcccagacagagtgtgaactgggg
aatccattcaaaagagattcagaggttactttctacataatcttgagcactgctggtatc
tctctcaataccacagaaatcgacattgaccttgagcttcaaacgaccagtacacaggaa
agaacaggcagtctgaaagcaagggcaaaagtagtgattgagatgttactttctgttgca
ggagttgcgagaccttcccaggtgtattttgggggcgatgtgcaaggagagagtgccatc
aagacagaagaggagatcggcagtttgatcgattatgaatttaggataatcaatttgggt
aagccgttgaagtcctttggcacagcctcgttgaacattcagtggcccaaagagaatgtg
gatgggaagtggctgttatatctggttaagatcagcaccactggcctggaagagatcccc
tgctccccagaaactgagatcaactctctcaaacacattcaggagtctagcacatctagg
aaaaagcgtgaagctggaggcaaaacatctggaggcaaaatctctttggtatcagaccaa
agaaagcacaagattttgatgtgtggcaatggctatgactctagatgtgtggtgatcaag
tgccctctactgggcttggacagtagtgcagtgatttctctaaggtcccgtctgtggaat
gctaccttccttgagaattacgcgtctttgaactatcttgatataattgtgaaagcttcc
atcagccttgatgctcctgcaaagaatatggttctcaggaatgctgagactcaggtgaga
gtcacagtgtttccggagaaggcagtagcccagtttggtggagtcccatggtggatcatc
ctcgtggctgtcctggctggtattctgatgttggcgttgctagtgtttctactctggaag
tgtggatttttcaaacgctcaaaacatgatgacagcgttccaagataccatgccgtacgg
atcaagaaggaggcttgtcagtttaaagacggaaaagccaagctggattcctttgagaaa
aagcagtggatgacaagctggaatgagaacgagagctactcatga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112237229
Entry
112237229         CDS       T05605                                 

Definition
(RefSeq) integrin alpha-V-like
  KO
K06487  integrin alpha V
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04145  Phagosome
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
otw04514  Cell adhesion molecules
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112237229
   04514 Cell adhesion molecules
    112237229
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    112237229
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112237229
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112237229
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112237229
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112237229
   04515 Cell adhesion molecules [BR:otw04515]
    112237229
   04090 CD molecules [BR:otw04090]
    112237229
Membrane trafficking [BR:otw04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    112237229
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112237229
  Exosomal proteins of epithelial cells
   112237229
Cell adhesion molecules [BR:otw04515]
 Integrins
  Integrin alpha subunits
   112237229
CD molecules [BR:otw04090]
 Proteins
  112237229
SSDB
Motif
Pfam: FG-GAP VCBS
Other DBs
NCBI-GeneID: 112237229
NCBI-ProteinID: XP_024261596
LinkDB
Position
Unknown
AA seq 401 aa
MERRRKLGLSLALILSYLQWTTSFNLDIDKPYVFSGPKGSYFGFSVDFFQPNNKQSNILI
GAPRANTSSASTVVERGAVYTCPWQKSSDCTQVQFDNTDDRENIDGVQMEFKSNQWFGAT
VRSDGEHILACAPLYQWSTFSLSEREPVGTCFLKKGGEVVEYSPCRSDGNSPERQGFCQA
GFSIDFVKNNRVVVGGPGSFYWQGQLISDDISEIIARFDNNYYTPYSNQLTTKSASAQYD
DSYLGYSVTVGDFNEDGEDDYVTGVPRGDKALGYVNIFNGRNMESMLNFTGTQMAAYFGH
SVAATDLNNDGLVDLFVGAPLFMDRGSDGKLREVGQVSVFLGKGGFSFHTPITLSGTEIY
SRFGSSIATLGDLDMDGFNGMYEFSTTLPYLRTLRRAEDRG
NT seq 1206 nt   +upstreamnt  +downstreamnt
atggaaagacgtcgcaaacttggtttatctttggctttgatcctgtcttatttacagtgg
acaacctctttcaatctggatattgacaaaccctatgtattctctggacctaaaggaagt
tattttggattttctgtggattttttccagccaaataataagcagtcaaacattcttata
ggagctcccagagccaacacctcctcagcttccacagtggtggagcgaggggcagtctat
acctgcccatggcagaagagtagtgactgtacccaagtacagtttgacaatactgatgat
cgtgagaatatagacggagtccagatggagttcaagtccaaccagtggtttggagccacg
gtacggtcagatggtgaacacatcctggcctgtgctcctctctaccagtggagcacgttc
agcttatccgagcgagagcctgttggtacgtgtttcctgaagaaaggaggagaggtggtg
gagtattctccctgtcgatctgatggtaactccccagaaaggcaaggattctgtcaggct
ggattcagtattgactttgtcaagaacaacagggtggttgttggaggccctggtagtttc
tattggcaaggtcagctgatcagcgacgacatctctgagatcatcgcccggttcgacaac
aactactacactccttacagtaaccagctgaccaccaagtctgccagcgctcaatacgat
gacagttatttaggttactctgtgaccgtcggagacttcaatgaggatggagaagatgac
tatgttactggggtacccaggggagacaaagctctgggctatgtgaacatcttcaatggg
aggaacatggagtcaatgctgaatttcacaggaacgcagatggctgcctactttggccat
tcagtggcagcgaccgacctcaataatgatgggctggtggatctgtttgtaggggcccct
ctgttcatggaccgtggtagtgatgggaagctgagggaggtgggccaggtgtctgtgttc
ctggggaagggaggcttctccttccacacacccatcacactgagtgggacagagatctac
tcacgcttcggcagttctatcgccacactgggggacctggatatggatggcttcaacggt
atgtatgagttctcaaccacgttgccatacctgcgcaccctacggcgggccgaagacagg
ggctag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112238315
Entry
112238315         CDS       T05605                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: integrin alpha-9-like
  KO
K06585  integrin alpha 9
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
otw04514  Cell adhesion molecules
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112238315
   04514 Cell adhesion molecules
    112238315
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112238315
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112238315
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:otw04515]
    112238315
Cell adhesion molecules [BR:otw04515]
 Integrins
  Integrin alpha subunits
   112238315
SSDB
Motif
Pfam: Integrin_alpha2 Integrin_alpha
Other DBs
NCBI-GeneID: 112238315
NCBI-ProteinID: XP_024262661
LinkDB
Position
Unknown
AA seq 612 aa
LVVGPLTLLYCIRCRSIDTILYCIGCRSIDTMLYLVFRSRPVITVDVSIYLPVSINISVP
QCHEGPQHLNCFNARVCLLFRGKHLPGQIELLYNLTADVDKRQRSQSSRVYFIQNGAQIS
FMSNELSLDINREDCQQYTAYVKKDVKDVFTAITFEVAYTLGKHVVNGHLDKDLPALTPV
LRWRKGDQMAAKNETWFERNCLSDDCAADLRLHGKLLLSGLHVRSHLALGGVRNVSLNVT
ISNAGDDAYDTNIYFNFSRDVFYINYWQKEEKGISCGLVALDFLQCSVGFPFMRAKTKYH
LAVIFDTSRLSGENETLQFLVHAKSANPEHRLLDQQLDLSIPLVHEVDTALTGLVTPTSF
LYGNSIDASRFIQLEDMECNFQPLNFTFQVINNGPSRLPGSIVDIRIPNRLAGNGADMFH
IMDTQVAGGQGNCTPHRNPQPCSISQDRESIFHTIFAFFTKSGRRVLDCDRPGRACLTIS
CTLGSQSKEEVVSIHVKLLLNTEILKRDSSSLIQFVTRGNVRVDGRAIEVPQGLSEDTSL
VFEALHSQEPRGYVVGWIIAISLLVGILIFLLLAVLLWKMGFFRRRYQEIIEAEKNRKDR
ADESWDWVEKNH
NT seq 1839 nt   +upstreamnt  +downstreamnt
ttggttgtaggtccattgacactgttgtattgtattcgttgtaggtccattgacaccata
ttgtattgtattggttgtaggtccattgacaccatgttatatttggtgtttaggtcccgg
ccggtgatcactgtggacgtgtctatctacctgcctgtctccatcaacatctctgtgcct
cagtgtcacgagggaccccaacacctcaactgtttcaacgcaagagtctgcctgctcttc
agaggaaaacacctgccaggacagatagagttgttgtataacctgacagctgatgtggat
aagaggcagaggagccagtcttccagagtgtacttcattcagaacggagcccagatcagc
ttcatgagcaacgagctcagtctggacatcaacagagaggattgccaacagtacactgca
tatgttaagaaggacgtgaaagacgtattcacagccatcacctttgaggtggcctacacc
ctggggaagcatgtggtgaacggtcacctggacaaagacctgcctgctcttacacctgta
ctgcgctggaggaaaggagaccagatggcagcaaagaatgagacatggttcgagaggaac
tgcctgtctgatgactgtgctgctgacctgagactccatgggaaactactgctttctggg
ctccacgtgcggtcccatctggccctaggaggagtgaggaatgtctctctgaacgtgacc
atctccaacgcaggggacgatgcctacgacaccaacatctacttcaacttctccagagat
gtcttctatatcaactactggcagaaggaagagaagggcatttcctgtggtcttgttgct
ttagacttcctccaatgcagcgtgggatttcccttcatgagagcaaagactaagtatcat
cttgcagtgatcttcgacacaagtcggctttcaggggaaaatgagacattgcagttttta
gttcatgcaaaaagtgccaaccctgagcataggctgttggaccaacagttggatctgtct
atcccactggtccatgaggtggacacagctctaactggtttagtgactccaacatccttt
ctgtatgggaactccatcgatgcctctcgcttcatccagctggaggacatggagtgtaac
ttccagcctttaaacttcacctttcaggtgatcaacaacggccccagcaggttacctggc
tccatagtggacatcaggatcccaaaccgactggctggcaatggggccgacatgttccac
atcatggacacacaggtggcgggggggcaagggaactgcacccctcataggaacccccag
ccctgttccatctcccaggacagagagagtatcttccacaccatctttgccttcttcacc
aagtccggacgcagggtcctggactgtgaccggccagggagagcatgtttaaccatctca
tgtactctgggctcccagtccaaagaggaagttgtcagtatacatgtgaaactcctacta
aacacagagatactgaagagggacagctcatcgctgatccagttcgtgactaggggtaat
gtgagagtggacgggagggccatagaggtaccgcaggggctatcagaagacacttcactg
gtgttcgaggcgctccacagccaggagccaagaggatatgttgttggttggatcattgcc
atcagcctgctggtgggaatactcatcttcctactgctggctgtgctgctctggaagatg
ggtttcttccgccggcgctaccaggagatcatcgaggccgagaaaaacaggaaggacaga
gctgacgagagctgggattgggtggaaaagaaccactga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112239204
Entry
112239204         CDS       T05605                                 

Definition
(RefSeq) integrin alpha-4-like
  KO
K06483  integrin alpha 4
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
otw04514  Cell adhesion molecules
otw04672  Intestinal immune network for IgA production
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112239204
   04514 Cell adhesion molecules
    112239204
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112239204
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112239204
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    112239204
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112239204
   04515 Cell adhesion molecules [BR:otw04515]
    112239204
   04090 CD molecules [BR:otw04090]
    112239204
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112239204
  Exosomal proteins of other cancer cells
   112239204
Cell adhesion molecules [BR:otw04515]
 Integrins
  Integrin alpha subunits
   112239204
CD molecules [BR:otw04090]
 Proteins
  112239204
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS DUF5370
Other DBs
NCBI-GeneID: 112239204
NCBI-ProteinID: XP_024263463
LinkDB
Position
3
AA seq 1023 aa
MERKTPGNLSCCWSFLLAYFWCCNLTECYNLDVDHPISFSGPNGSLFGYSVLLHKNQKNT
WLLVGAPVANSSSYPAVKKPGAIYKCSISDKRECQQISTGVDSCGKTCFSESDNQWLGVS
LSRQPRDGHVLACGHRWKNVFYSRKENQNKLPHGVCYRYESDLKQSQPLIPCYKDHQRKF
GEDYGSCQAGISNFLTEDLIIMGAPGTSYWTGSVLVYNTSSRVLSAYVDDSSTVLYGSYL
GYSVGAGHFLHPDSTEIVGGAPQHGQTGKAYLFRAEENMLKIISEVKGSKLGSYFGASVC
AVDLNGDGLSDLLVGSPMYSTVREEGQVHVYINQGAANMKEAEFQLVGSNSYAARFGETI
TDLGDIDDDGFADVAVGAPQEEELRGAIYIYNGRKTGISQTFSQRITGSVLGIELKMFGQ
SVSGAIDVDENGYQDVAVGAFLSDSAVVLRTRPVIVVEAFMPLPVSVDRYVALCSDNGLP
AVCINATVCFRVHARHFTSSIVLQYNLTADTQHKESFPSRFHFHGNGTSNATTGRVKTRH
DQLTCVPHQAFIRKDVRDIFTPIHFEVSYTLREHTVHNGGSTFPALKPILQQRGGHGNLV
ANKTEFARYCSLANCSTNLQVSAQLVLPQRHNNMPYFALGNGKTIMLNTTLVNTGDDAFL
PRLQLRFPSNLHYIKVLDAEEKFVSCDISEENKTIVGVDCSVGNLYLSSGAKVNISFLLD
VNQSSSVGDASISINASGDNYENEDLLHDNSATLMLPLRYGVDVNIHGFMTPTSFVFGDQ
APIPVDCYTETFNYTYKVVNIGPSKSLNTIVEIDIPKILSPYPYRLLHVTDFHTSLGECS
IQNDSIAVEDDCEVPQSSFIKELVFFFSKISKRKMFCAYGDDLCLTLECRLGDMDIGKEA
TIHMEVKLNPTVLQLSPGRHGVMLMESTGVITSPREDPQTIILQKIPIAQVVLEAHFSQK
PQAAVEVFIIVVSLLVGLLILALLIFALWKIGFFKRQFKKEDEIRRDSWDYVPKHLTKTE
SRS
NT seq 3072 nt   +upstreamnt  +downstreamnt
atggagcgaaaaacgccgggcaatctttcttgctgttggagctttcttctcgcgtacttc
tggtgctgtaatctcaccgagtgttacaatttggatgtagaccaccccattagtttcagt
ggaccaaatggatctttatttggatattctgtattgttacacaagaaccagaaaaacaca
tggttattagtcggagctccagttgcgaattcatcttcctacccagccgtaaaaaaacca
ggagcaatttataagtgcagcatctcggacaagagagaatgtcaacaaatatcaacaggt
gtggacagttgtgggaagacatgcttctctgagagtgacaaccagtggctcggagtcagc
ctgtccagacagcctcgtgatggccatgtattggcatgtgggcatcgttggaagaacgtg
ttctattccaggaaagaaaaccagaacaagctgcctcatggtgtctgttacagatacgag
tctgacctcaaacagtctcaaccactcatcccatgctacaaagatcaccaacggaagttt
ggtgaagactatggatcatgccaagcagggatatccaactttctgactgaggacttgata
attatgggagccccagggacatcgtactggactggatctgtcctggtctacaacacctcc
agcagagtcctgtctgcctatgtggatgacagcagcactgtcctctatggcagttacctg
ggctactcggttggggccggccacttcctccaccctgactccacagagattgttggcggt
gcgccccagcacgggcagactggtaaggcctacctattcagagctgaagaaaacatgctg
aagataatcagtgaagtcaagggcagcaagcttggctcgtattttggtgccagtgtgtgt
gctgtggacctgaatggagatggcctgtctgatctactggtaggatctcccatgtacagc
accgtgagagaggaaggacaagtccatgtctacataaaccaaggagccgctaatatgaag
gaagcagagtttcagttggtgggaagcaactcgtatgctgccagatttggggagaccata
actgatctgggagatattgatgacgatggctttgctgatgtggcagtgggggctccgcag
gaagaagagctgcgtggggctatatatatctacaatgggaggaaaacagggatctctcag
accttctctcaaaggatcactggctctgttctgggtattgagttaaagatgttcggacag
tctgtgtcaggagccatcgatgttgatgaaaacggttaccaagatgtagcagtaggggcc
ttcctctcagactcggctgttgttctgaggactcgtccagtaatagtggtagaagccttc
atgcccctgcctgtcagtgtagaccgctatgtagcgctgtgttctgacaacggtcttcct
gctgtctgcatcaatgctacagtctgcttcagggtccatgctcgacacttcacctcttca
atagtgctccagtataatctgacagcagacacgcagcacaaggagtccttcccctcacgt
ttccatttccacggaaacgggacgtccaacgctacaacagggcgggtcaaaaccagacac
gaccagctgacctgcgtcccccaccaggccttcataaggaaagatgtccgagatatcttc
acacccatccattttgaggtttcgtacactctcagagagcacactgtccataacggagga
tccactttccctgctctgaaacccatactgcagcagagaggggggcacggtaacctggtg
gccaataagacagagtttgctcggtactgttcattggccaactgctcaaccaatctgcag
gtctctgctcaactggtgttaccacagagacacaacaacatgccgtactttgcacttggc
aatgggaagaccatcatgttgaacacaaccctggtgaacacgggagatgatgcattcctc
cccagactccagctccgattccccagtaacctgcactacatcaaagtgcttgacgcagag
gagaagtttgtgagctgtgacatttcagaggagaacaagacaatagtaggagtggattgc
agtgtgggaaacctatacctcagctctggggccaaggtcaatatcagttttctgttggat
gtgaaccagagtagtagtgttggtgacgctagcatctccatcaacgctagtggggacaat
tatgaaaacgaggatcttctgcatgacaactctgccactctgatgttacccctgagatat
ggagtagatgtcaacattcatgggtttatgactccaacatcctttgtatttggtgaccag
gcacctattccagttgattgctacacagagacattcaactacacttacaaggttgtcaat
attggtccaagcaaatctctcaacacgatagtggagattgatattcccaagatcctgtca
ccatatccatacagattactccatgtcacagacttccatacgtctcttggagaatgctcc
attcaaaacgactccattgcggtggaggatgactgtgaggtgccacagtcctctttcatc
aaagaactggtcttcttcttctccaaaatcagcaaacgcaaaatgttctgtgcctatggt
gatgacctgtgcctgactctggagtgtagactaggagatatggacattgggaaagaagcc
accattcacatggaagtgaagctgaatcctaccgttctacagctctcacctggacgtcat
ggagtgatgctgatggagagtactggcgtcatcacatcaccaagggaggaccctcaaacc
atcatcctacagaagatccctatcgctcaggttgtgttggaggcccacttcagccagaag
cctcaggcagcagtggaggtgtttatcattgtagtgagtctactggtgggactcctgatc
ctggccctgctcatcttcgccctctggaagattggtttctttaaaaggcagtttaagaag
gaggatgagatcaggagggatagctgggactatgtaccaaaacatttgactaagactgag
agtagatcctaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112239256
Entry
112239256         CDS       T05605                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: integrin alpha-V-like
  KO
K06487  integrin alpha V
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04145  Phagosome
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
otw04514  Cell adhesion molecules
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112239256
   04514 Cell adhesion molecules
    112239256
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    112239256
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112239256
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112239256
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112239256
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112239256
   04515 Cell adhesion molecules [BR:otw04515]
    112239256
   04090 CD molecules [BR:otw04090]
    112239256
Membrane trafficking [BR:otw04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    112239256
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112239256
  Exosomal proteins of epithelial cells
   112239256
Cell adhesion molecules [BR:otw04515]
 Integrins
  Integrin alpha subunits
   112239256
CD molecules [BR:otw04090]
 Proteins
  112239256
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha LYRIC
Other DBs
NCBI-GeneID: 112239256
NCBI-ProteinID: XP_024263510
LinkDB
Position
Unknown
AA seq 1074 aa
MERLRKLCISLALILPCLQWTTCFNLDIDKPYVFSGPEGSYFGFSVDFFQPDAKQSNILI
GAPKANTSSASTVVERGAVYTCPWQKSSDCTQVQFDNTDDRKNNEGLQMEFKSNQWFGAT
VRSHGEHILACAPLYQWSTYSVSEREPVGTCFLKKGQEVVEYSPCRSKANSPEGQGFCQA
GFSIDFVKVRMCVLXXPGSFYWQGQLISDDISEIITRFNRQYYTPYSNQLTTKSASAQYD
DSYLGYSVTVGDFNADGEDDYITGVPGRQALGYVNIFNGRNMQSVLNFTGTQMAAYFGHS
VAATDINNDGLVDLFVGAPLFMDRGSDGKLREVGQVSVFLGKGGFSFXTPITLSGTEIYS
RFGSSIATLGDLDMDGFNDIAIAAPYGGPKHRGLVYIHNGRAAGPDPVPSQVLEGRWASS
YMPPSFGYSLHGATDIDQNGYPDLIVGLFGGRQQFYTVTVGCVFSFDVPHASNIAHAAPS
AGTKQRGPNYIHNGRAAGPDPGCFSGPEGRPHVYRLSVYLSEFQVHLVLDRLKHKGATKR
VLFLHSKTSQYTKNMTVSNGXGPACEEQEAFLIDDSEFRDKITPISVFMEFSLDYQQAAD
KTGLLPILEQTTPTNISKQWGGQRSDLQNDLLFWSVEAGNFVNAISDFPSDQKQIYIGDD
NPLTLEVTAENRGEGAYEAELHVFLPPQADFTGVVRNSETLSRLSCAYKTENQTGVVDTG
LGTPMKGGTKVLAGLRFSVHQLSEQDTFVKFDLQIQSSNQFNSTSSLVSSITTLAVLANV
DIRGYVVFSNEGHLARPDQVFLPIANWKPKENPVQRRNEHRTGNYTSVIQLRNRGPSNLS
KAILDIEWPYRFNNGSLPLITKLEVDGGMNCSTDMEINPLTQVSNPLSAETNGSASTSGD
NTEGRNRNHVHRRELAKKEMEGDLETLDCSKAQCLKIRCQVGRVERGQSTTLYVHSRLGV
ATFLKTESQNRSFTVRSSASFSVIEMPYNKNLVSELPSNAITVSMSVIWLKSDPEPVPGW
VVALAVLAGLLLLALLIFIMYKLGFFKRVRPPQEDNTEKEQLAPQENGDGNNEA
NT seq 3225 nt   +upstreamnt  +downstreamnt
atggaacgacttcgaaaactttgtatatctttggctttgatcctgccttgtttacaatgg
acaacttgtttcaatctggacattgacaaaccctatgtattctctggtcctgaaggaagt
tattttggattttctgtggatttcttccagccagatgccaagcagtcaaacattcttata
ggagctcccaaagccaacacctcctcagcttctacagtggtggagcgaggggcagtctat
acctgcccatggcagaagagtagtgactgtacccaagtacagtttgacaatactgatgat
cgtaagaataacgaggggctccagatggaatttaagtccaaccagtggtttggtgccacg
gtacggtcacatggtgaacacatcctggcctgtgctcctctctaccagtggagcacgtac
agcgtgtcagagagagagcctgttggaacgtgtttcctgaagaaaggacaagaagttgtg
gagtactctccttgtcgatctaaagccaactctccagagggacaaggcttctgtcaggct
ggattcagtattgactttgtcaaggtgcgtatgtgtgttttgnnnnnncctggtagtttc
tactggcaaggtcagctgataagtgatgatatctctgagatcatcaccaggttcaataga
caatactacactccttacagtaaccagctgaccactaagtctgccagcgctcagtacgat
gacagctatttaggttattctgtgactgtcggtgacttcaatgctgatggagaagatgat
tacattaccggggtcccagggagacaagctctgggctatgtgaacatcttcaatgggagg
aacatgcagtccgtcctgaacttcacaggaacacagatggctgcctacttcggccattct
gtggcagcgaccgacatcaataacgatgggctggtggatctgtttgtaggggcccctctg
ttcatggaccgtggtagtgatgggaagctgagggaggtgggccaggtgtctgtgttcctg
gggaarggaggcttctccttcmacacacccatcacactgagtgggacagagatctactca
cgcttcggcagttctatcgccacactgggggacctggatatggatggcttcaacgacatt
gccatagctgcaccctacggcgggccgaagcacaggggcctagtgtacatccacaatggg
agggctgcagggcctgacccagtgccttctcaggtcctagaggggaggtgggcctcctct
tacatgccccccagctttggatactccctgcacggagccaccgatattgaccagaatgga
tacccagacttaatagtgggtttatttggtggcagacaacagttctataccgttacagta
ggctgtgtgttttcctttgatgttccacatgcttcaaacattgcccatgctgcaccctcg
gcgggcacgaagcaacgggggcctaattacatccacaatgggagggctgcagggcctgac
ccaggttgcttctcaggtcctgaggggaggcctcatgtttaccgtctgtctgtgtacttg
tcagagttccaggttcaccttgtcctggatagactcaaacacaagggggcgacaaagaga
gttctgttcctccacagcaaaacttcccagtacacgaaaaacatgacggtcagcaacggc
craggaccagcctgcgaggagcaagaagccttcctcatagatgactctgagttccgggac
aagatcactcccatctctgtgttcatggagtttagtctggactaccagcaggcagcagat
aagaccggcctactgcctatcctggagcagactacccccaccaacatctccaaacagtgg
ggaggtcagagatcagacttacagaatgacctgctcttctggtcagtggaagcaggtaat
tttgttaatgcaatctctgacttccccagtgaccagaagcagatctacataggagatgat
aaccccttgaccctggaggtgacagcggagaacagaggagagggggcgtacgaggcagag
ctacatgtcttccttcctccccaggctgacttcactggggtggtacgcaacagtgagact
ctgtcaagattgtcctgtgcatacaagacagagaaccagaccggggtggttgacactggc
ctgggaacacccatgaaaggaggaactaaggtgctggccggactccgcttcagtgttcat
cagctctcagagcaggacacgtttgtgaagtttgacctgcagatacagagttccaaccag
ttcaacagcaccagcagtctggtctccagcatcacaacactggctgttctggccaatgtg
gatatcagagggtatgttgtcttctccaatgaaggccatttggcgcgtccggaccaggtc
ttcctgcccatcgctaactggaagcccaaagagaaccctgttcagaggaggaacgaacat
cgtaccggtaactacacatctgtcattcagttgcgtaacagaggtcccagtaacctcagc
aaggccatactggacatcgagtggccctacaggttcaacaacggctctctgcctctaatc
actaaactagaggtggacggaggcatgaactgcagtacagacatggagatcaacccactc
actcaagtctcaaatcctttgtcagcagagacaaatggttcagcttccaccagtggagac
aatacagaagggaggaacaggaaccatgttcaccgcagagagctggcgaagaaagagatg
gagggagacctggaaactctggactgttccaaggcccagtgcctgaagatccggtgtcag
gtgggccgtgtggagagaggtcagagtactaccctctacgtccactccagactgggtgtg
gccaccttcctcaagactgagagccagaaccgatcgttcaccgtgagatcctccgcttcc
ttcagcgtcatagagatgccttataacaagaacctggtgtctgagctgccctccaacgca
attacggtgagtatgtcagtgatctggttgaaatctgatcctgaacctgttcccgggtgg
gtggtggcgctggctgtgctggctggactactgctgctggctctgctaatcttcatcatg
tataagctgggtttcttcaagcgtgtacgcccccctcaggaggacaacacggagaaggaa
cagctggcaccgcaggagaacggtgacgggaacaatgaagcctga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112244635
Entry
112244635         CDS       T05605                                 

Gene name
itga8
Definition
(RefSeq) LOW QUALITY PROTEIN: integrin alpha-8
  KO
K06584  integrin alpha 8
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
otw04514  Cell adhesion molecules
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112244635 (itga8)
   04514 Cell adhesion molecules
    112244635 (itga8)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112244635 (itga8)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112244635 (itga8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:otw04515]
    112244635 (itga8)
Cell adhesion molecules [BR:otw04515]
 Integrins
  Integrin alpha subunits
   112244635 (itga8)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS
Other DBs
NCBI-GeneID: 112244635
NCBI-ProteinID: XP_024268131
LinkDB
Position
3
AA seq 992 aa
MCAYRMCTFGGMLCRVVPVLWLVLSVVSGFNLHAERPAVYGGPEGSYFGYSVDFYRPTPE
SSTLSVLVGAPKANTSQPGIIEGGAVYYCPYPPNPDSTKQPYSCTQIPFDNTNNRMIKVN
GTREPLEFKSHQWFGASVRTHKGKVVACAPLYHWRAVKVNGEKDPVGTXLFCTCRTSRLC
STSPCRPVNDPDPEGQGFCQAGFSVDFTKEGTLVVGGPGSFYWQGQVMTAGVAEILNGYS
LKAVLRRVHGEKQTHAAADTHDDSYLGYSVAVGEFTGDSEQELIAGVPRGAQNFGYVAVI
NSTNLTFIMNFTGEQMASYFGYSVAVTDLNGDGYDDVLVGAPLYMERERESKPKEVGRVY
LYLQHSPLTFSEPLLLTGTHTFGRFGTAIAPLGDLNQDGYNGKLCVCVCISPLFLPWPLR
LRLHPEGEQRLDNNHYPDLIVGAFGKGEVSVYRARPVVSVEAEMILTPRILNPDDRSCLL
TESDTMVTCLRVDICAKVSGVGIPDSVVLNAELQLDWLKGVRGGVKRVHFLDSHQPQHTG
VLTLGHSRPHSCLNYTVYLREEDEFRDKLTPISLALNYSLAPPSNLDLPPILNRYSSTFL
QEQAYILLDCGEDNECIPDLQLSASMDRTELVVGDDNLVMLTINAVNKGEGAYETELHTL
LPPEADYIGVERRIESLSKLNCEYRMVNDSRLVVCDLGNPMVAGTEVSVGLRFAVQRLDD
AGPHIDFDLQIHSSNKDNSKSNPVSLSLSISARAQLDLRGVCHPSQVVLPFPHWEPKEKP
VKEDDVGPQVTHIYELHNSGPSSIREAELQVGWPSRFRDEHLLYALEVLTEGPISCRSNT
SLNLLGLQMSSVQDTPELLGFLRNSSSPHRYRRATSAAQPYISKTLNCSNIICLRVLCVV
GRLDRGQSAVVKIRSRLWAHTFLQRRNDPYLLNSTVSFRVTALPYRLQPSSLPQHTTSMG
TLVLWGTPDVAFAVPLWVIILAILLGLLVLAC
NT seq 2979 nt   +upstreamnt  +downstreamnt
atgtgtgcttataggatgtgcacgttcggtgggatgttgtgtcgcgtggtgccggtgctg
tggctggtcctttcggtggtctcggggttcaacctgcatgcggagcgcccggccgtgtac
ggaggaccagaggggagctactttggttactccgtggacttctaccgaccgacccccgaa
agcagcacgttgagtgtgttggtgggagcgcccaaggccaacacatcccagccaggcatc
atagagggaggagctgtctactactgtccctatcccccaaaccccgactccaccaagcaa
ccctacagctgcacacagatacccttcgacaacaccaataacaggatgattaaggttaat
ggcaccagggagcctctggagttcaagtctcaccagtggtttggagcctcagttagaact
cacaaaggcaaagtggtggcctgtgctcctctctaccactggcgtgctgtgaaggtgaac
ggtgagaaggacccggtaggaacctgactattttgcacgtgcagaacttcacgcctatgc
agtacttccccgtgtagaccagtgaatgatccagacccggagggacagggtttctgccag
gccgggttcagtgtggacttcaccaaggaggggacactggtggtgggtggacctggaagc
ttctactggcaaggtcaggtgatgactgcaggcgtagcagagatattgaatggttactct
ctgaaagctgtgctcaggagagtccatggagagaaacagacacacgctgcagctgatacc
catgacgacagctacctaggttactctgtggcagtgggggaattcacaggagactcagag
caagagctgatagctggggttccgagaggggcacagaactttggatatgtagctgtgatt
aactccactaatctgacattcatcatgaacttcacaggagagcagatggcttcctacttt
ggctattctgtggctgttactgacctcaatggagacgggtatgatgatgtactggtagga
gcccctctctacatggagagagagagggagagtaagcccaaggaggtgggccgtgtctac
ctgtacctccagcactccccgctcaccttctccgagccccttctcctgacgggaacacac
acctttggacgctttggcactgccatcgccccgctaggagacctcaaccaggacggatac
aatggtaagctgtgtgtgtgtgtgtgtatttcccctctctttcttccctggcctctccgg
ctacggcttcaccctgagggggaacagagactggacaacaaccattaccctgatctgata
gtgggagcatttggtaaaggggaggtgtcggtgtacagggctcgtcctgtagtgtcagtg
gaggctgagatgatcctgactcctagaatcctgaaccctgacgaccgatcctgcctcctg
acagaatctgataccatggtaacctgtctcagggtagatatttgtgcaaaggtgagcggt
gtggggatcccagactctgtagtcttgaatgcagagctgcaactggattggctgaaaggt
gtgaggggcggagtaaaaagagttcatttcctggattcccatcagccccagcacacaggg
gtcctaactcttggccacagccgtccacactcctgcctgaactacacggtctacctacga
gaggaggatgaatttagggataaattgactcccatctcattggctctgaactacagttta
gcccctccttccaacctggacctcccccctatcctcaaccgctacagcagtaccttcctg
caggaacaggcgtatattctgctggactgtggggaagacaacgagtgtattccagacctc
cagctgtctgcaagcatggaccgtacagagctggtggtcggggatgacaacctggtcatg
ttgaccataaacgcggttaacaaaggagagggggcatatgagacagagctacacacactc
ctaccccctgaggctgattacataggagtggaacgcaggatagagtctctatccaagttg
aactgtgagtacaggatggtgaatgactccagactagtggtgtgtgacctggggaaccct
atggttgctggaacagaagtatctgtaggtttaaggtttgctgtccaaaggctggatgat
gccggtcctcacattgactttgacctacagatccacagttcaaacaaagacaactccaag
agcaacccagtcagtctgtctctctccatctctgccagagctcagctagacctgaggggg
gtgtgtcatccctctcaggtggttcttccgtttcctcactgggagcccaaagagaagccg
gtcaaagaggatgacgtaggaccccaggtcacacacatctacgagctccataactcaggt
cccagcagtattcgggaggcggagctccaggtgggctggccctctcgtttccgtgacgaa
cacctgctctacgctctggaggttctaacggaaggaccaatcagctgccggagcaacacc
agcctcaacctcctgggcctacagatgtcctctgtccaggacactccagaattgttgggc
tttctgagaaacagtagctctcctcaccgctacagacgagccaccagcgctgcccagccc
tacatcagcaagaccctgaactgcagtaacatcatttgtctaagagttctgtgtgtggtt
gggcggttggaccgtggtcagagcgctgtagtcaagatccgttcccgactctgggctcac
accttcctccagagacgtaacgacccatacctcctcaactccaccgtgtccttcagagtg
acggccctgccctaccgcctccagccctcctccttaccccaacacaccacttcaatgggt
acactggtgctgtgggggactcctgatgtggcgtttgctgttcctctgtgggtcatcatc
ctggccatcctactgggactgctggtcctggcttgctaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112246216
Entry
112246216         CDS       T05605                                 

Definition
(RefSeq) integrin alpha-5-like isoform X1
  KO
K06484  integrin alpha 5
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04145  Phagosome
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
otw04810  Regulation of actin cytoskeleton
otw05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112246216
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    112246216
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112246216
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112246216
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    112246216
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112246216
   04515 Cell adhesion molecules [BR:otw04515]
    112246216
   04090 CD molecules [BR:otw04090]
    112246216
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112246216
Cell adhesion molecules [BR:otw04515]
 Integrins
  Integrin alpha subunits
   112246216
CD molecules [BR:otw04090]
 Proteins
  112246216
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS DUF11 Integrin_alpha
Other DBs
NCBI-GeneID: 112246216
NCBI-ProteinID: XP_024270286
LinkDB
Position
Unknown
AA seq 1062 aa
MGTGRRLSSISVNSILRNPGYCARFVVIAVVFIQLCATFNLETENRIVYSGPKGSFFGYS
VDFFYNNASSFSILIGAPKANTSQTNIIEGGSVYLCPWSQDQSDCSVVNFDNEGDRSFYV
NDVDVQVEFKSHQWFGATVRSHGNTVLACAPRYYWRTEHDAPFSDATGTCYLSVDNLKTF
VEYAPCRTERHGPAGQGYCQGGFSADFTKDGKVVLGGPGSFYWQGQLVSATTEEIVKAYF
PSYFLLSVTGQIQTRQVQGSYDDSYLGYSVAGGEFSGDDIEDFITGVPKGQMLHGLVSLL
NGTDLKSMLNLTGEQMGSYFGYAVAATDINNDGLDDLVVGAPMFMQRGSDGLRWEEVGRV
YVYLQQRPLLFEPSLPPLGGSQAFGRFGSSLAPLGDLNQDGFNDIAIGCPFGGDDQQGLV
LIYNGHASGLKNTPTQALAGQWASGTFPASFGYALRGEKDLDQNGYPDLIVGAFGADKAV
LYRARPIVNASASLTVQPTMINSEEKSCMVSNGNKTISVSCVNLSFCLSANGKHLPADLV
FMVEVQLDHLEQKQRESSVRRTLFLDSHQPSLLETITMANGGPTCHDTRIYLRSEGEFRD
KLSPIYITLNFSLDPLAQLDLHGLKPILNYQTTHIIKQKAQIQLDCGEDNICVPDLKLAV
YGDRTEVYLGDENSLTLTFNARNEGEGGAYEAELYVVLPAEADYSGIARNNASLTQLTCS
YEAENQTRSLVCDLGNPMKSGTSLWAGLRFTVLRLKDTHNTVQFELQIRSKNENKSQSDA
ELFNLEVAVVADVILQGVSRPDKLLFPPPNWRMSPSLQEEQDVGPEIQHVYELVNNGPSM
ISQSVLELRCPLKSQGHDLLYPLEVITQGPLDCSSNHTLNALKLKLQPPTTEQPPSPLTA
SPEHHVQRREVYRDPLDEQGNLSCSTAECWRLRCHVGLLERGSSVILTVRSRIWPEAFLE
RAYKQYVLECSVEYRVEKMPYSIAPKLKPSGSKKVLTPVMWNKPDSQYMVPLWIIILAIL
AGLLLLALVIYVLYKLGFFKRSNPYGTAMEKAQLKPQASSEA
NT seq 3189 nt   +upstreamnt  +downstreamnt
atgggcactggacggcgactttcatcaatttcagtcaactcaatcctgcgaaatccaggt
tattgcgcccggttcgttgtaattgcagttgtttttatccagctgtgcgcaacgtttaac
ttagaaacagaaaaccggatcgtctactctggacctaagggatcttttttcggttattcc
gtggattttttctacaataatgcatctagtttcagtattctgattggtgctcccaaagct
aacaccagccaaacgaacatcatcgaaggtggatctgtgtacttgtgtccctggagccag
gaccaatcggattgcagtgttgtcaattttgacaatgaaggggatcgcagtttctacgtc
aacgacgttgacgtccaggtcgagttcaagtcccatcagtggtttggggctacggtgcgt
tcccatggcaacactgtcctggcttgtgccccaagatattactggagaacggaacacgat
gcccccttctcggatgccacaggaacctgctacctctccgtggacaacctcaagacattt
gtggagtacgccccctgtcgcacagagagacatggtcctgcaggacagggctactgtcag
ggtgggttcagtgctgacttcaccaaggatgggaaggttgttctcggaggaccaggaagc
ttttactggcaaggtcaactagtctcagccaccacagaggaaatcgtcaaggcctacttc
ccatcctacttcctgctctctgttactgggcagatccagactcggcaggtgcaggggagc
tatgacgacagctacctcggttactctgttgccggaggggagttcagtggagatgatatt
gaagacttcatcaccggagttcccaaaggacaaatgctgcatggtttagtgtcattactc
aatgggacagatctgaaatccatgctgaacctaactggagaacagatgggttcctatttc
ggctacgcagtggcagccaccgacatcaacaacgatggtctggatgacctggtggtgggc
gctcccatgttcatgcagagggggtctgatggactgcgttgggaggaggtgggccgtgtc
tatgtgtacctacagcagcgtcccttgttgtttgagcccagcctgccccccttgggaggt
agtcaggccttcgggaggttcggaagctccctggccccgctgggagacctcaaccaggac
ggcttcaacgatattgcaattggctgtccctttggaggagacgaccaacagggattggtc
ctcatctataacgggcatgccagtgggctgaagaacacacccactcaggctctagctggc
caatgggcctctggcacctttcctgccagttttggctatgccctccgcggagagaaagat
ctggaccagaatgggtacccagatctcatcgtaggtgcttttggggctgacaaggctgtt
ctgtacagggctcggcctattgtcaacgccagtgcttctcttactgtgcaacctaccatg
atcaactcagaggagaagagttgtatggtgtccaatgggaacaagactatctctgtgtct
tgtgtcaacctcagtttctgcctctcggccaatgggaagcacctccctgctgatctagtt
tttatggtggaggtgcagttggaccatctggagcagaaacagagagagtcatcagtgagg
agaactctgttcttagatagccatcagcccagcctgctggagaccatcaccatggccaac
ggaggaccaacgtgtcacgacacccgcatctacctgcgcagtgaaggggagtttcgggat
aaactgtcccccatttacatcaccctcaactttagcctggatcctctcgctcaactggac
ctccatggcctaaaacccattctaaactaccagacaacacatattataaagcagaaggcc
caaattcagctggactgtggggaggacaacatctgtgttcctgacctcaaactggccgtt
tatggcgataggacagaggtgtatcttggcgacgagaactccctgaccctgaccttcaat
gccaggaacgagggagagggcggggcctacgaggcagagctttacgtggtactgcccgcg
gaggctgactacagtggtatagcccgcaacaatgcgagtctgactcagctgacctgtagc
tacgaggcagagaatcagacccgctctctggtctgtgacctgggcaaccctatgaagtct
ggaacaagtttgtgggcaggcctccgcttcactgtgcttcgactgaaggacactcacaat
acagtacagtttgagctccagatacgcagtaaaaatgagaataaatcccagagtgatgct
gagctctttaatctggaggtggctgtggttgctgatgttatcctacagggcgtttctcgt
ccggacaagctcctcttccctcccccgaactggaggatgagccccagcctacaagaggag
caggatgttgggcctgagatccagcatgtgtacgagttggtgaacaacgggcccagtatg
atcagtcagtcagtgctggagctgcgctgccctctgaaatctcagggtcacgaccttttg
taccctctggaggtcatcactcagggaccactcgactgcagctccaaccacaccctcaat
gcactgaagctcaagctccagcctcctacaacagagcagccaccctcaccactgacagcc
agccctgaacaccacgtccagaggagagaggtctacagggatcctctggatgaacaagga
aacctgtcgtgttccaccgctgagtgctggaggctgcgctgtcatgtggggttactggag
agaggaagcagtgtcattctgaccgtccgctcacgcatctggcctgaggccttccttgag
agggcatacaagcagtatgtgctggagtgttctgtggagtacagagtcgagaagatgccc
tattccatcgctcccaaactcaaacccagtggatccaagaaggtcctgactccagtgatg
tggaacaagccagacagccagtacatggtaccactgtggatcatcattctggccatactg
gctggattgctgctgctcgccctggtcatatatgtactctacaagttgggcttcttcaaa
cgatccaatccttatggtacggccatggagaaagctcaactcaaaccacaggcttcttct
gaggcctaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112246274
Entry
112246274         CDS       T05605                                 

Definition
(RefSeq) integrin alpha-7-like
  KO
K06583  integrin alpha 7
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112246274
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112246274
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112246274
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112246274
   04515 Cell adhesion molecules [BR:otw04515]
    112246274
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112246274
Cell adhesion molecules [BR:otw04515]
 Integrins
  Integrin alpha subunits
   112246274
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS FG-GAP_2 DUF2207
Other DBs
NCBI-GeneID: 112246274
NCBI-ProteinID: XP_024270340
LinkDB
Position
Unknown
AA seq 1123 aa
MAPHLRHGISVSLSQHRCLLLHSLFLSVYFLTVAGFNLDTSMTLTKEGETGSFFGFSLAL
HQQLTPEPHSWILVGAPRARGLGMMQRKRPGALYRCPITGEEFDCERVDIDGDVNLDWES
KDNQWLGVTVKSQGIGGKVVTCAHLYELRQRVGLPSETRDPIGRCYVLSEDLTERDDLDG
GEWKFCEGRPQGHEQFGFCQQGLSAAFTPDNQFIMFGAPGTYNWKGEMRVQLLNQTLLDL
GFYDDGPYEVADEKQLNAQLIPVPYHSYLGFSVDSAQGIMSRGELTFVAGAPRANHTGAV
VLLRKDNMYRLVPQHILWGEELASSFGYSVATADLNSDGWTDLIVGAPNYFDRKAEIGGA
VYIFLNPFGNWEYAQPIRLNGTYDSMFGLTVNNVGDLDRDGYDDIAVGAPFDGDGKVFIY
RGLSSGIDTKPAQILDGVDEGVKRFGYSISGGLDIDGNLYPDLAVGSLGDKLVLYRSRPV
IHVTRDVSIEPQQYIDLEQHNCKGRDGVCVEVKACFTYTAYPETYSPDITLVLLIEADTE
RRKLGLPHRISFLGRSAQVAEYTHTDEVELKGQRHPACQSATFQLNENIRDKLRPISLAI
THTIRPPMFSSETNPEERDTLPPVLSVSTSNTLHSEVNFLREGCGDDKICQSNLKLTYQF
GTRPPTSDLFTPLPRDDEEVAVFSLSDQRSVVLEVTVTNMPSDPLSPEEDGDDAHAAQLL
VTLPDTLSYSGFRGQQVVCQANQNGSQAECELGNPLKRDAILKFYIILSTSAITIETTEL
TVNLLLATISEQRDLATVTAVAKIIIELPLAVSVLARPHQLFFSGAVKGESAMETLDDVG
SAVEFEFTVTNTGPSLQTLGSAFLNIMWPHELSNGKWLLYPTALHFHGHPETPCTPHTSL
NPRKFSHSSPSDDQPQAAGLKARRKGRSNPEEEGHVMTKGSLGRTTPAVAASERRKSLKL
DCLLGSARCVLFQCPLHSFSDSAVLKIQGRLWNSTFLEEFPSVSALELLVRANITVKSSI
KHLVLRDAAAQIPVMIYPEVGLTAQYWIPWWWILIAILAGILVLSLLVCILWKCGFFRRV
QYEDKVPQYHAVKIPRQDRPQFQQKAGILQKKEWATHWSDGSS
NT seq 3372 nt   +upstreamnt  +downstreamnt
atggcaccacatctgagacatggaatctcggtctctctttcacagcaccggtgtctcctc
ctccattctctctttctctccgtctatttcctgactgttgcagggttcaacctggatact
agcatgactctgaccaaggagggggagaccggcagcttttttggattctctttagcgctt
caccagcaactcacaccagaaccacacagttggatcctggtgggggcgccgcgggccaga
ggactgggcatgatgcagaggaagcgccctggcgctctgtaccgctgtccaatcacaggc
gaggagtttgactgcgagcgcgtggacatcgatggagacgtaaacctagactgggaaagc
aaggacaaccagtggctaggagtaacagtcaagagccaggggattggaggaaaggtggtg
acgtgtgcccatctgtacgagctgcgtcagcgcgtgggcctgccgtcggagacgcgggac
cccatcgggcgttgctacgtgctcagtgaggacctgaccgagagggatgacctagatgga
ggggagtggaagttctgtgaggggcgaccccagggacacgaacagtttggcttctgtcag
cagggtctgtctgccgccttcacacccgacaaccaatttatcatgttcggagctcctgga
acgtacaactggaaaggagagatgcgcgtccagctactaaaccagactttactggatctg
ggtttctatgacgacgggccctatgaagtggcggatgagaaacagctgaatgctcagctg
atccctgttccctaccatagttacctgggcttctcagtggactctgctcaaggcataatg
agtcgtggtgagctgaccttcgtggcgggggctccgagagccaatcacacgggagcggtg
gtgctgttgcgtaaagataacatgtaccgcctggtgccacagcacatcctgtggggagag
gagctggcttcttccttcgggtactctgtggctacggctgatctcaacagtgacggctgg
acagacctgatagtgggagctcctaactactttgaccgaaaagcagagattggaggtgct
gtgtacatctttctcaacccattcggtaactgggaatatgctcagccaatcaggctcaat
ggaacctatgactccatgtttggattgaccgtcaacaacgtgggagacttggacagggac
ggatatgacgacatcgctgtcggggctccgttcgatggggatggcaaagtgttcatctac
cgaggcttgtcctcaggcatcgacaccaagcctgcacagatcctggatggagtggacgag
ggggtgaagaggttcggctactccatctcaggaggtctggacatcgatgggaacctgtac
cctgacctggcagtaggctctctcggtgataagctagttctgtacaggtctcgccccgtc
attcacgtgacccgggatgtatccatcgaacctcagcagtatattgacttggagcaacac
aactgcaaggggagagatggagtttgtgtggaggtcaaagcctgcttcacctatactgct
tacccagagacctactcaccagacatcaccctggtcctactcatcgaggctgacacagag
cgcaggaagctcggcctgccccaccgtattagcttcctgggtcgcagtgcacaggtggcg
gagtatacacacactgacgaggtggagctgaaaggtcaacgccatcccgcctgccagagc
gccaccttccaactaaacgagaatatccgtgataagctgcgtcccatctctctggccatc
acccacaccatcagaccccccatgttctcctcagaaactaacccagaggaacgagacacg
ctacctcctgtactgagtgtttccacctccaacaccctacactctgaggtgaatttcctg
agggaaggctgtggcgatgataagatctgtcagagcaacctgaagttgacctaccagttt
ggaacccgacctcccacctctgacctcttcacccctctgccaagggatgatgaagaggtg
gcggtgttttctctgtctgaccagagatctgtggtgttggaggtgaccgtcaccaacatg
ccctcagatcctttgtccccagaggaggatggagatgatgcccatgctgcccagctactg
gtgaccctgccagataccctgtcctactctggcttcaggggacaacaggtggtgtgccag
gccaatcagaacgggtctcaggcggagtgcgagctgggaaaccccctgaagagagatgct
atactgaaattctacatcatcctcagcacgtctgctatcaccatagagaccacggaactc
actgtcaacctcctgttggctaccatcagtgaacagcgagacctggccacagtcacagcc
gtggctaaaatcatcatagagctccccctggcggtcagtgtgctggccagaccacaccag
ctgttcttcagtggggccgtaaagggggagagtgccatggagaccctggacgatgtgggg
agtgctgtggagtttgagtttacggtgaccaacaccgggccatccctgcagactctaggc
tccgccttcctcaacatcatgtggcctcacgagctgtccaatgggaagtggctcctgtac
cccactgctctccacttccatggccatccagaaacaccctgtaccccccacacctccctc
aacccacgcaagttctcccacagttctccttctgacgaccagccacaggcagcaggcctg
aaggccaggaggaaggggcgttccaacccagaagaggagggacatgtgatgaccaagggc
agtctgggtaggactacgcctgctgtggctgcctcagagagacgcaagtcactcaaactg
gactgtctgctgggttcagcgcgctgtgtgctgttccagtgtcctctccacagcttctct
gactctgctgtcctcaagatccagggacgcctttggaacagcacctttctggaggagttc
ccatcagtcagtgctctggagctgctggttagagccaacatcacagtcaagtcgagcatc
aaacacctggtgctgagggatgctgctgcacagatcccagtgatgatttacccagaggtt
ggtctgactgcccagtactggatcccctggtggtggattctcatagccatcctggctggt
atcctggtgttgtctctgctggtctgcatcctctggaagtgtggtttcttccgtcgggtc
cagtatgaagacaaagttcctcagtaccatgcagtgaagatcccccgtcaagaccggccc
cagttccagcagaaggcagggatcctccagaagaaggagtgggccacacactggagtgac
ggaagctcctga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112254036
Entry
112254036         CDS       T05605                                 

Definition
(RefSeq) integrin alpha-4-like
  KO
K06483  integrin alpha 4
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
otw04514  Cell adhesion molecules
otw04672  Intestinal immune network for IgA production
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112254036
   04514 Cell adhesion molecules
    112254036
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112254036
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112254036
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    112254036
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112254036
   04515 Cell adhesion molecules [BR:otw04515]
    112254036
   04090 CD molecules [BR:otw04090]
    112254036
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112254036
  Exosomal proteins of other cancer cells
   112254036
Cell adhesion molecules [BR:otw04515]
 Integrins
  Integrin alpha subunits
   112254036
CD molecules [BR:otw04090]
 Proteins
  112254036
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS
Other DBs
NCBI-GeneID: 112254036
NCBI-ProteinID: XP_024282018
LinkDB
Position
7
AA seq 1079 aa
MTTYGLGLHSIGLNMLFCFLLRHADLYNLDIPHAIPLSGPNGTFFGYSVLLHKHQQQTWV
IVGAPVANSRFNQAVRNPGAIYKCKITDKKDCEQIQLGVMLDMPCGRHCSAEVENQWLGV
SLSRRQQDGLVLACGHRWKNVYFTKKEDLNKLPHGVCYKLESDLNQSSPLIPCYRDHENK
FGNDFASCQAGISNVLIGDLIVMGAPGTLYWTGSVFVHNISSQITSAYLDDNVVLYGSYL
GYSVSAGHFLHPNSTEVVGGAPQYGQTGRAYIFSIESSTLSIISEVKGQKLGSYFGGTVC
AVDLNTDGLSDLLVGAPMFSTVREEGRVYIYMNQGQANMKEMEFTLAGRDSYAARFGESI
TSLGDIDDDGYPDVAVGAPQEDDLHGAIYIYNGRKTGLGQYFSQRIAGSALGSAFKMFGQ
SVSGGIDVDGNGYPDVAVGAFLSDSAVVLRTRAVVVVEAMILLPPSVNRTHALCTENGQP
AICLKTSVCFQLYAKRVSGLIEILYNLTADVKHIEGLQSRFFFNTNGTELSNATAGSIKT
RHGHMTCVTHLAFLRRDIRDIFTPIHFELQYELGEHNVVRDNSKSFPPLRPMLQRGEEYS
NLLTNKTVFTRYCAWANCSTNLQVSAQLLLLRTHRDMPYVALGEGKTILLNVTLSNAGDA
AFLPMLHLRYPSNLYFIKVLDAEEKYVSCKIAEEEKRSVGLDCSVGNLFFNTLAKVNISF
LLDVSADSEPGDLNIIINATRENLENEDLLHDNIVNLTLLLRYGVNLNIHGFVSRTEFVF
GDFEEPHCSAERFKYTFKVVNVGPSISHGTRVEIDIPKALAPYPYRLLNILDIQSSSGWC
YIRNSTDGTRSTHGTMYGSQRASTIDSVWLNVTTTTDSYWTNRSSTTHPYWTNISSTTDT
NWTSISYWANVRNWTTVIEDECDLPDSNPLNDFFFFFSKSSRRHMYCMKEDALCLYAVCE
LGDMDIGKDVTIEMEVEMNSGVLDISPGRHSVMLLETTAVISPKKDPFIWFLKEDPITVV
VLEAHHSHKLKRVIELSIIVASLLLGLFILALLVICMWKSGFFKREDKMENIQRLSWDY
NT seq 3240 nt   +upstreamnt  +downstreamnt
atgactacatacgggctaggcttacacagcatagggctaaacatgttgttttgctttctc
ttacgtcatgccgatttgtacaatttagacataccgcacgctattccactcagtggtccg
aatggaacattttttggatattctgtgttgctacacaagcatcagcaacagacatgggta
atagttggcgcaccagttgcaaattcaaggttcaaccaggctgtcaggaatcctggagca
atctacaagtgcaaaattacagacaagaaggactgtgaacagattcaactcggtgtaatg
cttgacatgccctgtggcagacactgttctgctgaggttgaaaaccagtggcttggtgtg
agcctctccaggcggcagcaggatggacttgtgttggcctgtggacatcgttggaaaaat
gtctacttcaccaaaaaagaagatctaaataagttgccacatggcgtatgctacaaattg
gagtctgacttgaatcaatcaagtcctttgattccatgctacagagatcacgaaaataag
tttggcaatgactttgcatcatgtcaagcagggatttcaaatgtccttattggggacctc
atagtaatgggagcccctggaaccttgtattggactgggtctgtttttgtccacaacata
tccagtcagatcacttctgcctacttggatgataacgttgtcctctatggaagttatttg
gggtactcagtcagcgctggccacttcctgcacccaaactccactgaggtagtgggtgga
gccccccagtacgggcagactggaagagcctacatctttagcatagagtccagcacactg
agcatcatctctgaggttaaaggtcaaaagctgggttcctattttgggggcactgtgtgt
gcagtggacctgaacactgatggcctgtctgacctgctggtgggagctccaatgttcagc
actgtgagggaggagggccgtgtgtacatctacatgaaccagggacaggctaacatgaag
gagatggagtttacattagcagggagagattcatatgcagcccggtttggggaaagtatc
acaagtcttggagatattgatgatgatggctatccagatgttgcagttggggcaccacaa
gaggatgacctacatggtgctatttatatctacaatgggaggaagacgggacttggacaa
tacttttctcaaaggattgctgggtctgccttgggtagtgctttcaagatgtttggccag
tctgtgtctgggggcattgatgttgatggaaacggttacccagatgtggccgtgggagcc
tttctgtccgactctgctgttgttctgaggacacgggcggttgttgtggtggaggcgatg
atacttcttcctcctagtgtgaaccgcacccatgccctgtgtacagagaacggccagcct
gccatttgcctcaaaacctctgtgtgcttccagttgtatgcgaaacgtgtctctgggctt
atcgaaatactgtacaacctgacggctgatgtcaagcacatagaggggctccagtccaga
ttcttcttcaacaccaacggcacagagttatcaaatgccacagcaggcagcatcaagacc
aggcatggccacatgacctgtgttacccatctggcctttctgaggagagacattcgggac
atcttcacccccatccactttgagctgcagtatgagctgggagagcacaatgtggtgagg
gataactccaagagctttccccctctcaggcctatgctccagaggggagaggagtacagc
aacttgctgaccaacaagactgtattcaccaggtactgtgcctgggccaactgttccacc
aatctgcaagtgtctgcacagctgctgttactgaggacacatagagacatgccatacgtt
gccctgggggaggggaagaccattctactgaatgttacgctgtccaatgctggcgacgcc
gccttcctccccatgcttcacctgagataccccagcaatctctacttcatcaaagtgttg
gacgctgaggagaaatacgtgagctgtaaaattgctgaggaagagaagagaagtgtcggg
ctagattgcagcgtgggaaatttgtttttcaacaccttagccaaagttaatatcagcttt
ctgctggatgtcagtgctgacagtgaacctggtgacctgaacattataatcaatgcaacc
cgggagaatttagaaaatgaagatcttctccatgacaatattgttaatctgactctgcta
ttgagatatggagtgaatctaaacatccacggttttgtatcccgaacagagtttgtgttt
ggggactttgaggagccacactgctccgctgagaggttcaaatacaccttcaaggttgtc
aatgttggtccaagcatatctcacggcacaagagtggaaattgatatccccaaagcttta
gcaccgtatccatacagactgctcaacattttggacatacagtcatcttctgggtggtgt
tacattcgaaactccactgatgggaccagaagtacacatggcaccatgtatggaagccag
agagccagtaccattgacagtgtttggttaaatgtgacaactaccactgacagctattgg
acgaataggtccagcaccacacacccttattggactaatatttccagtaccactgacacc
aattggactagtatatcctattgggccaatgtgagaaactggaccactgttattgaggat
gagtgtgatctgcctgactccaatcccttgaatgatttcttcttcttcttctcaaaaagc
agtagaagacatatgtattgtatgaaagaggatgctctgtgtctgtacgcggtgtgtgag
cttggagacatggacattgggaaagatgtcaccattgaaatggaggtcgaaatgaattcg
ggagttttagacatctcaccgggaagacatagtgtcatgctgttagagaccactgctgtc
atatcacccaagaaggacccatttatttggttcttaaaagaagaccccatcacagtggtt
gtcctggaggcccatcatagccacaaactgaaacgagtcattgagctgtccatcatcgtg
gccagtctcttactaggcctcttcatccttgccttgctggtcatctgcatgtggaagagt
ggcttctttaagcgtgaggataagatggagaatatacaaaggctcagctgggactactga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112254061
Entry
112254061         CDS       T05605                                 

Definition
(RefSeq) integrin alpha-4-like
  KO
K06483  integrin alpha 4
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
otw04514  Cell adhesion molecules
otw04672  Intestinal immune network for IgA production
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112254061
   04514 Cell adhesion molecules
    112254061
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112254061
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112254061
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    112254061
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112254061
   04515 Cell adhesion molecules [BR:otw04515]
    112254061
   04090 CD molecules [BR:otw04090]
    112254061
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112254061
  Exosomal proteins of other cancer cells
   112254061
Cell adhesion molecules [BR:otw04515]
 Integrins
  Integrin alpha subunits
   112254061
CD molecules [BR:otw04090]
 Proteins
  112254061
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS
Other DBs
NCBI-GeneID: 112254061
NCBI-ProteinID: XP_024282055
LinkDB
Position
7
AA seq 1079 aa
MTTYGLGLHSIGLNMLFCFLLRHADLYNLDIPHAIPLSGPNGTFFGYSVLLHKHQQQTWV
IVGAPVANSRFNQAVRNPGAIYKCKITDKKDCEQIQLGVMLDMPCGRHCSAEVENQWLGV
SLSRRQQDGLVLACGHRWKNVYFTKKEDLNKLPHGVCYKLESDLNQSSPLIPCYRDHENK
FGNDFASCQAGISNVLIGDLIVMGAPGTLYWTGSVFVHNISSQITSAYLDDNVVLYGSYL
GYSVSAGHFLHPNSTEVVGGAPQYGQTGRAYIFSIESSTLSIISEVKGQKLGSYFGGTVC
AVDLNTDGLSDLLVGAPMFSTVREEGRVYIYMNQGQANMKEMEFTLAGRDSYAARFGESI
TSLGDIDDDGYPDVAVGAPQEDDLHGAIYIYNGRKTGLGQYFSQRIAGSALGSAFKMFGQ
SVSGGIDVDGNGYPDVAVGAFLSDSAVVLRTRAVVVVEAMILLPPSVNRTHALCTENGQP
AICLKTSVCFQLYAKRVSGLIEILYNLTADVKHIEGLQSRFFFNTNGTELSNATAGSIKT
RHGHMTCVTHLAFLRRDIRDIFTPIHFELQYELGEHNVVRDNSKSFPPLRPMLQRGEEYS
NLLTNKTVFTRYCAWANCSTNLQVSAQLLLLRTHRDMPYVALGEGKTILLNVTLSNAGDA
AFLPMLHLRYPSNLYFIKVLDAEEKYVSCKIAEEEKRSVGLDCSVGNLFFNTLAKVNISF
LLDVSADSEPGDLNIIINATRENLENEDLLHDNIVNLTLLLRYGVNLNIHGFVSRTEFVF
GDFEEPHCSAERFKYTFKVVNVGPSISHGTRVEIDIPKALAPYPYRLLNILDIQSSSGWC
YIRNSTDGTRSTHGTMYGSQRASTIDSVWLNVTTTTDSYWTNRSSTTHPYWTNISSTTDT
NWTSISYWANVRNWTTVIEDECDLPDSNPLNDFFFFFSKSSRRHMYCMKEDALCLYAVCE
LGDMDIGKDVTIEMEVEMNSGVLDISPGRHSVMLLETTAVISPKKDPFIWFLKEDPITVV
VLEAHHSHKLKRVIELSIIVASLLLGLFILALLVICMWKSGFFKREDKMENIQRLSWDY
NT seq 3240 nt   +upstreamnt  +downstreamnt
atgactacatacgggctaggcttacacagcatagggctaaacatgttgttttgctttctc
ttacgtcatgccgatttgtacaatttagacataccgcacgctattccactcagtggtccg
aatggaacattttttggatattctgtgttgctacacaagcatcagcaacagacatgggta
atagttggcgcaccagttgcaaattcaaggttcaaccaggctgtcaggaatcctggagca
atctacaagtgcaaaattacagacaagaaggactgtgaacagattcaactcggtgtaatg
cttgacatgccctgtggcagacactgttctgctgaggttgaaaaccagtggcttggtgtg
agcctctccaggcggcagcaggatggacttgtgttggcctgtggacatcgttggaaaaat
gtctacttcaccaaaaaagaagatctaaataagttgccacatggcgtatgctacaaattg
gagtctgacttgaatcaatcaagtcctttgattccatgctacagagatcacgaaaataag
tttggcaatgactttgcatcatgtcaagcagggatttcaaatgtccttattggggacctc
atagtaatgggagcccctggaaccttgtattggactgggtctgtttttgtccacaacata
tccagtcagatcacttctgcctacttggatgataacgttgtcctctatggaagttatttg
gggtactcagtcagcgctggccacttcctgcacccaaactccactgaggtagtgggtgga
gccccccagtacgggcagactggaagagcctacatctttagcatagagtccagcacactg
agcatcatctctgaggttaaaggtcaaaagctgggttcctattttgggggcactgtgtgt
gcagtggacctgaacactgatggcctgtctgacctgctggtgggagctccaatgttcagc
actgtgagggaggagggccgtgtgtacatctacatgaaccagggacaggctaacatgaag
gagatggagtttacattagcagggagagattcatatgcagcccggtttggggaaagtatc
acaagtcttggagatattgatgatgatggctatccagatgttgcagttggggcaccacaa
gaggatgacctacatggtgctatttatatctacaatgggaggaagacgggacttggacaa
tacttttctcaaaggattgctgggtctgccttgggtagtgctttcaagatgtttggccag
tctgtgtctgggggcattgatgttgatggaaacggttacccagatgtggccgtgggagcc
tttctgtccgactctgctgttgttctgaggacacgggcggttgttgtggtggaggcgatg
atacttcttcctcctagtgtgaaccgcacccatgccctgtgtacagagaacggccagcct
gccatttgcctcaaaacctctgtgtgcttccagttgtatgcgaaacgtgtctctgggctt
atcgaaatactgtacaacctgacggctgatgtcaagcacatagaggggctccagtccaga
ttcttcttcaacaccaacggcacagagttatcaaatgccacagcaggcagcatcaagacc
aggcatggccacatgacctgtgttacccatctggcctttctgaggagagacattcgggac
atcttcacccccatccactttgagctgcagtatgagctgggagagcacaatgtggtgagg
gataactccaagagctttccccctctcaggcctatgctccagaggggagaggagtacagc
aacttgctgaccaacaagactgtattcaccaggtactgtgcctgggccaactgttccacc
aatctgcaagtgtctgcacagctgctgttactgaggacacatagagacatgccatacgtt
gccctgggggaggggaagaccattctactgaatgttacgctgtccaatgctggcgacgcc
gccttcctccccatgcttcacctgagataccccagcaatctctacttcatcaaagtgttg
gacgctgaggagaaatacgtgagctgtaaaattgctgaggaagagaagagaagtgtcggg
ctagattgcagcgtgggaaatttgtttttcaacaccttagccaaagttaatatcagcttt
ctgctggatgtcagtgctgacagtgaacctggtgacctgaacattataatcaatgcaacc
cgggagaatttagaaaatgaagatcttctccatgacaatattgttaatctgactctgcta
ttgagatatggagtgaatctaaacatccacggttttgtatcccgaacagagtttgtgttt
ggggactttgaggagccacactgctccgctgagaggttcaaatacaccttcaaggttgtc
aatgttggtccaagcatatctcacggcacaagagtggaaattgatatccccaaagcttta
gcaccgtatccatacagactgctcaacattttggacatacagtcatcttctgggtggtgt
tacattcgaaactccactgatgggaccagaagtacacatggcaccatgtatggaagccag
agagccagtaccattgacagtgtttggttaaatgtgacaactaccactgacagctattgg
acgaataggtccagcaccacacacccttattggactaatatttccagtaccactgacacc
aattggactagtatatcctattgggccaatgtgagaaactggaccactgttattgaggat
gagtgtgatctgcctgactccaatcccttgaatgatttcttcttcttcttctcaaaaagc
agtagaagacatatgtattgtatgaaagaggatgctctgtgtctgtacgcggtgtgtgag
cttggagacatggacattgggaaagatgtcaccattgaaatggaggtcgaaatgaattcg
ggagttttagacatctcaccgggaagacatagtgtcatgctgttagagaccactgctgtc
atatcacccaagaaggacccatttatttggttcttaaaagaagaccccatcacagtggtt
gtcctggaggcccatcatagccacaaactgaaacgagtcattgagctgtccatcatcgtg
gccagtctcttactaggcctcttcatccttgccttgctggtcatctgcatgtggaagagt
ggcttctttaagcgtgaggataagatggagaatatacaaaggctcagctgggactactga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112254975
Entry
112254975         CDS       T05605                                 

Definition
(RefSeq) integrin alpha-5-like isoform X1
  KO
K06484  integrin alpha 5
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04145  Phagosome
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
otw04810  Regulation of actin cytoskeleton
otw05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112254975
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    112254975
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112254975
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112254975
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    112254975
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112254975
   04515 Cell adhesion molecules [BR:otw04515]
    112254975
   04090 CD molecules [BR:otw04090]
    112254975
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112254975
Cell adhesion molecules [BR:otw04515]
 Integrins
  Integrin alpha subunits
   112254975
CD molecules [BR:otw04090]
 Proteins
  112254975
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS DUF11 Integrin_alpha
Other DBs
NCBI-GeneID: 112254975
NCBI-ProteinID: XP_024283754
LinkDB
Position
7
AA seq 1062 aa
MGTGRRLSSISVNSILRNPGYCARFVVIAVVFIQLCATFNLETENRIVYSGPKGSFFGYS
VDFFYNNASSFSILIGAPKANTSQTNIIEGGSVYLCPWSQDQSDCSVVNFDNEGDRSFYV
NDVDVQVEFKSHQWFGATVRSHGNTVLACAPRYYWRTEHDAPFSDATGTCYLSVDNLKTF
VEYAPCRTERHGPAGQGYCQGGFSADFTKDGKVVLGGPGSFYWQGQLVSATTEEIVKAYF
PSYFLLSVTGQIQTRQVQGSYDDSYLGYSVAGGEFSGDDIEDFITGVPKGQMLHGLVSLL
NGTDLKSMLNLTGEQMGSYFGYAVAATDINNDGLDDLVVGAPMFMQRGSDGLRWEEVGRV
YVYLQQRPLLFEPSLPPLGGSQAFGRFGSSLAPLGDLNQDGFNDIAIGCPFGGDDQQGLV
LIYNGHASGLKNTPTQALAGQWASGTFPASFGYALRGEKDLDQNGYPDLIVGAFGADKAV
LYRARPIVNASASLTVQPTMINSEEKSCMVSNGNKTISVSCVNLSFCLSANGKHLPADLV
FMVEVQLDHLEQKQRESSVRRTLFLDSHQPSLLETITMANGGPTCHDTRIYLRSEGEFRD
KLSPIYITLNFSLDPLAQLDLHGLKPILNYQTTHIIKQKAQIQLDCGEDNICVPDLKLAV
YGDRTEVYLGDENSLTLTFNARNEGEGGAYEAELYVVLPAEADYSGIARNNASLTQLTCS
YEAENQTRSLVCDLGNPMKSGTSLWAGLRFTVLRLKDTHNTVQFELQIRSKNENKSQSDA
ELFNLEVAVVADVILQGVSRPDKLLFPPPNWRMSPSLQEEQDVGPEIQHVYELVNNGPSM
ISQSVLELRCPLKSQGHDLLYPLEVITQGPLDCSSNHTLNALKLKLQPPTTEQPPSPLTA
SPEHHVQRREVYRDPLDEQGNLSCSTAECWRLRCHVGLLERGSSVILTVRSRIWPEAFLE
RAYKQYVLECSVEYRVEKMPYSIAPKLKPSGSKKVLTPVMWNKPDSQYMVPLWIIILAIL
AGLLLLALVIYVLYKLGFFKRSNPYGTAMEKAQLKPQASSEA
NT seq 3189 nt   +upstreamnt  +downstreamnt
atgggcactggacggcgactttcatcaatttcagtcaactcaatcctgcgaaatccaggt
tattgcgcccggttcgttgtaattgcagttgtttttatccagctgtgcgcaacgtttaac
ttagaaacagaaaaccggatcgtctactctggacctaagggatcttttttcggttattcc
gtggattttttctacaataatgcatctagtttcagtattctgattggtgctcccaaagct
aacaccagccaaacgaacatcatcgaaggtggatctgtgtacttgtgtccctggagccag
gaccaatcggattgcagtgttgtcaattttgacaatgaaggggatcgcagtttctacgtc
aacgacgttgacgtccaggtcgagttcaagtcccatcagtggtttggggctacggtgcgt
tcccatggcaacactgtcctggcttgtgccccaagatattactggagaacggaacacgat
gcccccttctcggatgccacaggaacctgctacctctccgtggacaacctcaagacattt
gtggagtacgccccctgtcgcacagagagacatggtcctgcaggacagggctactgtcag
ggtgggttcagtgctgacttcaccaaggatgggaaggttgttctcggaggaccaggaagc
ttttactggcaaggtcaactagtctcagccaccacagaggaaatcgtcaaggcctacttc
ccatcctacttcctgctctctgttactgggcagatccagactcggcaggtgcaggggagc
tatgacgacagctacctcggttactctgttgccggaggggagttcagtggagatgatatt
gaagacttcatcaccggagttcccaaaggacaaatgctgcatggtttagtgtcattactc
aatgggacagatctgaaatccatgctgaacctaactggagaacagatgggttcctatttc
ggctacgcagtggcagccaccgacatcaacaacgatggtctggatgacctggtggtgggc
gctcccatgttcatgcagagggggtctgatggactgcgttgggaggaggtgggccgtgtc
tatgtgtacctacagcagcgtcccttgttgtttgagcccagcctgccccccttgggaggt
agtcaggccttcgggaggttcggaagctccctggccccgctgggagacctcaaccaggac
ggcttcaacgatattgcaattggctgtccctttggaggagacgaccaacagggattggtc
ctcatctataacgggcatgccagtgggctgaagaacacacccactcaggctctagctggc
caatgggcctctggcacctttcctgccagttttggctatgccctccgcggagagaaagat
ctggaccagaatgggtacccagatctcatcgtaggtgcttttggggctgacaaggctgtt
ctgtacagggctcggcctattgtcaacgccagtgcttctcttactgtgcaacctaccatg
atcaactcagaggagaagagttgtatggtgtccaatgggaacaagactatctctgtgtct
tgtgtcaacctcagtttctgcctctcggccaatgggaagcacctccctgctgatctagtt
tttatggtggaggtgcagttggaccatctggagcagaaacagagagagtcatcagtgagg
agaactctgttcttagatagccatcagcccagcctgctggagaccatcaccatggccaac
ggaggaccaacgtgtcacgacacccgcatctacctgcgcagtgaaggggagtttcgggat
aaactgtcccccatttacatcaccctcaactttagcctggatcctctcgctcaactggac
ctccatggcctaaaacccattctaaactaccagacaacacatattataaagcagaaggcc
caaattcagctggactgtggggaggacaacatctgtgttcctgacctcaaactggccgtt
tatggcgataggacagaggtgtatcttggcgacgagaactccctgaccctgaccttcaat
gccaggaacgagggagagggcggggcctacgaggcagagctttacgtggtactgcccgcg
gaggctgactacagtggtatagcccgcaacaatgcgagtctgactcagctgacctgtagc
tacgaggcagagaatcagacccgctctctggtctgtgacctgggcaaccctatgaagtct
ggaacaagtttgtgggcaggcctccgcttcactgtgcttcgactgaaggacactcacaat
acagtacagtttgagctccagatacgcagtaaaaatgagaataaatcccagagtgatgct
gagctctttaatctggaggtggctgtggttgctgatgttatcctacagggcgtttctcgt
ccggacaagctcctcttccctcccccgaactggaggatgagccccagcctacaagaggag
caggatgttgggcctgagatccagcatgtgtacgagttggtgaacaacgggcccagtatg
atcagtcagtcagtgctggagctgcgctgccctctgaaatctcagggtcacgaccttttg
taccctctggaggtcatcactcagggaccactcgactgcagctccaaccacaccctcaat
gcactgaagctcaagctccagcctcctacaacagagcagccaccctcaccactgacagcc
agccctgaacaccacgtccagaggagagaggtctacagggatcctctggatgaacaagga
aacctgtcgtgttccaccgctgagtgctggaggctgcgctgtcatgtggggttactggag
agaggaagcagtgtcattctgaccgtccgctcacgcatctggcctgaggccttccttgag
agggcatacaagcagtatgtgctggagtgttctgtggagtacagagtcgagaagatgccc
tattccatcgctcccaaactcaaacccagtggatccaagaaggtcctgactccagtgatg
tggaacaagccagacagccagtacatggtaccactgtggatcatcattctggccatactg
gctggattgctgctgctcgccctggtcatatatgtactctacaagttgggcttcttcaaa
cgatccaatccttatggtacggccatggagaaagctcaactcaaaccacaggcttcttct
gaggcctaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112255075
Entry
112255075         CDS       T05605                                 

Definition
(RefSeq) integrin alpha-7-like
  KO
K06583  integrin alpha 7
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112255075
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112255075
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112255075
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112255075
   04515 Cell adhesion molecules [BR:otw04515]
    112255075
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112255075
Cell adhesion molecules [BR:otw04515]
 Integrins
  Integrin alpha subunits
   112255075
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS FG-GAP_2 DUF2207
Other DBs
NCBI-GeneID: 112255075
NCBI-ProteinID: XP_024283898
LinkDB
Position
7
AA seq 1123 aa
MAPHLRHGISVSLSQHRCLLLHSLFLSVYFLTVAGFNLDTSMTLTKEGETGSFFGFSLAL
HQQLTPEPHSWILVGAPRARGLGMMQRKRPGALYRCPITGEEFDCERVDIDGDVNLDWES
KDNQWLGVTVKSQGIGGKVVTCAHLYELRQRVGLPSETRDPIGRCYVLSEDLTERDDLDG
GEWKFCEGRPQGHEQFGFCQQGLSAAFTPDNQFIMFGAPGTYNWKGEMRVQLLNQTLLDL
GFYDDGPYEVADEKQLNAQLIPVPYHSYLGFSVDSAQGIMSRGELTFVAGAPRANHTGAV
VLLRKDNMYRLVPQHILWGEELASSFGYSVATADLNSDGWTDLIVGAPNYFDRKAEIGGA
VYIFLNPFGNWEYAQPIRLNGTYDSMFGLTVNNVGDLDRDGYDDIAVGAPFDGDGKVFIY
RGLSSGIDTKPAQILDGVDEGVKRFGYSISGGLDIDGNLYPDLAVGSLGDKLVLYRSRPV
IHVTRDVSIEPQQYIDLEQHNCKGRDGVCVEVKACFTYTAYPETYSPDITLVLLIEADTE
RRKLGLPHRISFLGRSAQVAEYTHTDEVELKGQRHPACQSATFQLNENIRDKLRPISLAI
THTIRPPMFSSETNPEERDTLPPVLSVSTSNTLHSEVNFLREGCGDDKICQSNLKLTYQF
GTRPPTSDLFTPLPRDDEEVAVFSLSDQRSVVLEVTVTNMPSDPLSPEEDGDDAHAAQLL
VTLPDTLSYSGFRGQQVVCQANQNGSQAECELGNPLKRDAILKFYIILSTSAITIETTEL
TVNLLLATISEQRDLATVTAVAKIIIELPLAVSVLARPHQLFFSGAVKGESAMETLDDVG
SAVEFEFTVTNTGPSLQTLGSAFLNIMWPHELSNGKWLLYPTALHFHGHPETPCTPHTSL
NPRKFSHSSPSDDQPQAAGLKARRKGRSNPEEEGHVMTKGSLGRTTPAVAASERRKSLKL
DCLLGSARCVLFQCPLHSFSDSAVLKIQGRLWNSTFLEEFPSVSALELLVRANITVKSSI
KHLVLRDAAAQIPVMIYPEVGLTAQYWIPWWWILIAILAGILVLSLLVCILWKCGFFRRV
QYEDKVPQYHAVKIPRQDRPQFQQKAGILQKKEWATHWSDGSS
NT seq 3372 nt   +upstreamnt  +downstreamnt
atggcaccacatctgagacatggaatctcggtctctctttcacagcaccggtgtctcctc
ctccattctctctttctctccgtctatttcctgactgttgcagggttcaacctggatact
agcatgactctgaccaaggagggggagaccggcagcttttttggattctctttagcgctt
caccagcaactcacaccagaaccacacagttggatcctggtgggggcgccgcgggccaga
ggactgggcatgatgcagaggaagcgccctggcgctctgtaccgctgtccaatcacaggc
gaggagtttgactgcgagcgcgtggacatcgatggagacgtaaacctagactgggaaagc
aaggacaaccagtggctaggagtaacagtcaagagccaggggattggaggaaaggtggtg
acgtgtgcccatctgtacgagctgcgtcagcgcgtgggcctgccgtcggagacgcgggac
cccatcgggcgttgctacgtgctcagtgaggacctgaccgagagggatgacctagatgga
ggggagtggaagttctgtgaggggcgaccccagggacacgaacagtttggcttctgtcag
cagggtctgtctgccgccttcacacccgacaaccaatttatcatgttcggagctcctgga
acgtacaactggaaaggagagatgcgcgtccagctactaaaccagactttactggatctg
ggtttctatgacgacgggccctatgaagtggcggatgagaaacagctgaatgctcagctg
atccctgttccctaccatagttacctgggcttctcagtggactctgctcaaggcataatg
agtcgtggtgagctgaccttcgtggcgggggctccgagagccaatcacacgggagcggtg
gtgctgttgcgtaaagataacatgtaccgcctggtgccacagcacatcctgtggggagag
gagctggcttcttccttcgggtactctgtggctacggctgatctcaacagtgacggctgg
acagacctgatagtgggagctcctaactactttgaccgaaaagcagagattggaggtgct
gtgtacatctttctcaacccattcggtaactgggaatatgctcagccaatcaggctcaat
ggaacctatgactccatgtttggattgaccgtcaacaacgtgggagacttggacagggac
ggatatgacgacatcgctgtcggggctccgttcgatggggatggcaaagtgttcatctac
cgaggcttgtcctcaggcatcgacaccaagcctgcacagatcctggatggagtggacgag
ggggtgaagaggttcggctactccatctcaggaggtctggacatcgatgggaacctgtac
cctgacctggcagtaggctctctcggtgataagctagttctgtacaggtctcgccccgtc
attcacgtgacccgggatgtatccatcgaacctcagcagtatattgacttggagcaacac
aactgcaaggggagagatggagtttgtgtggaggtcaaagcctgcttcacctatactgct
tacccagagacctactcaccagacatcaccctggtcctactcatcgaggctgacacagag
cgcaggaagctcggcctgccccaccgtattagcttcctgggtcgcagtgcacaggtggcg
gagtatacacacactgacgaggtggagctgaaaggtcaacgccatcccgcctgccagagc
gccaccttccaactaaacgagaatatccgtgataagctgcgtcccatctctctggccatc
acccacaccatcagaccccccatgttctcctcagaaactaacccagaggaacgagacacg
ctacctcctgtactgagtgtttccacctccaacaccctacactctgaggtgaatttcctg
agggaaggctgtggcgatgataagatctgtcagagcaacctgaagttgacctaccagttt
ggaacccgacctcccacctctgacctcttcacccctctgccaagggatgatgaagaggtg
gcggtgttttctctgtctgaccagagatctgtggtgttggaggtgaccgtcaccaacatg
ccctcagatcctttgtccccagaggaggatggagatgatgcccatgctgcccagctactg
gtgaccctgccagataccctgtcctactctggcttcaggggacaacaggtggtgtgccag
gccaatcagaacgggtctcaggcggagtgcgagctgggaaaccccctgaagagagatgct
atactgaaattctacatcatcctcagcacgtctgctatcaccatagagaccacggaactc
actgtcaacctcctgttggctaccatcagtgaacagcgagacctggccacagtcacagcc
gtggctaaaatcatcatagagctccccctggcggtcagtgtgctggccagaccacaccag
ctgttcttcagtggggccgtaaagggggagagtgccatggagaccctggacgatgtgggg
agtgctgtggagtttgagtttacggtgaccaacaccgggccatccctgcagactctaggc
tccgccttcctcaacatcatgtggcctcacgagctgtccaatgggaagtggctcctgtac
cccactgctctccacttccatggccatccagaaacaccctgtaccccccacacctccctc
aacccacgcaagttctcccacagttctccttctgacgaccagccacaggcagcaggcctg
aaggccaggaggaaggggcgttccaacccagaagaggagggacatgtgatgaccaagggc
agtctgggtaggactacgcctgctgtggctgcctcagagagacgcaagtcactcaaactg
gactgtctgctgggttcagcgcgctgtgtgctgttccagtgtcctctccacagcttctct
gactctgctgtcctcaagatccagggacgcctttggaacagcacctttctggaggagttc
ccatcagtcagtgctctggagctgctggttagagccaacatcacagtcaagtcgagcatc
aaacacctggtgctgagggatgctgctgcacagatcccagtgatgatttacccagaggtt
ggtctgactgcccagtactggatcccctggtggtggattctcatagccatcctggctggt
atcctggtgttgtctctgctggtctgcatcctctggaagtgtggtttcttccgtcgggtc
cagtatgaagacaaagttcctcagtaccatgcagtgaagatcccccgtcaagaccggccc
cagttccagcagaaggcagggatcctccagaagaaggagtgggccacacactggagtgac
ggaagctcctga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112257296
Entry
112257296         CDS       T05605                                 

Definition
(RefSeq) integrin alpha-2-like
  KO
K06481  integrin alpha 2
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04145  Phagosome
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112257296
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    112257296
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112257296
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112257296
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112257296
   04515 Cell adhesion molecules [BR:otw04515]
    112257296
   04090 CD molecules [BR:otw04090]
    112257296
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   112257296
  Exosomal proteins of bladder cancer cells
   112257296
Cell adhesion molecules [BR:otw04515]
 Integrins
  Integrin alpha subunits
   112257296
CD molecules [BR:otw04090]
 Proteins
  112257296
SSDB
Motif
Pfam: Integrin_alpha2 VWA FG-GAP VWA_2 VCBS FG-GAP_2 Integrin_alpha
Other DBs
NCBI-GeneID: 112257296
NCBI-ProteinID: XP_024286557
LinkDB
Position
9
AA seq 1189 aa
MEFNPKRTVLTLIFIQCWNMPGSLSFNVGTAGAKVFSEPSVEEFGYTVQQLKNHQGKWLL
VGSPWSGYNQDRKGDVYKCEIRGASSGCQRLNLQNSVSISTVSNVNVNMSLGLTLTRTAT
EDMFMACGPLWAQKCGSQYYYPGICAEVSPLFNPLSSFSPALQTCGGPMDIAIVLDGSNS
IYPWPPVVAFLKKLLENLDIGPDNTQVSIIQYAVDPDFEFYLNSYKTKDSIIAAAANIPQ
KLGLQTNTFRAIEFARRQAFLPTNGARPGASKVMVVVTDGESHDNGLKDDVIGKCEQEKI
TRFGIAVLGYYIRNDIDTKNLIAEMKSIASTPTDRYFFNVSAEEALLEIAGTLGDRIFNI
EGTGKGGDFQMEMSQVGFSAHQTNKQNMMMLGAVGAYGWSGTVVHYTPQKSDIFPKTAFE
NILEDRNHSSLLGYSVTTLNDGSTEYYVAGAPRSNHTGQVIVYIINSKGQPTVIDSQKGD
QIGSYYGSVLCPLDVDKDGVSDILLVGAPMFMNEQKKETGKVYLLSFTKGILSDQGILRG
PSPADNARFGMSISAVPDLNMDGYSDVVVGAPLEDNNRGVIYVFNGDKKKLRTQCSQRIL
GSKLDPALKYFGRSLDANSDLNDDTIPDVSVGAYGKVVQLWSRGLAVVTARATFNPDKVN
ILSKTCRVSGRLVSCFNTTVCFSATFRPKIPVGPVALRYNLTLDADLQSSRVTSRGQFSN
SERVLQKDIRVSTRELCDAYEVFVQEAPDFVSSIGLRVDIALHDPDSSPVLDVLRPTSWE
FFIPFSKDCGSDELCESDLLLNVKKGEMIPSSSKMLVSFKNKRLSFTVSVTNKKENAYNT
RVMATYSKNLFYASITPPSDETEVKCSSTRETRSLSCQVGYPALRKNQEVTFVINFDFNL
NQLQTEADVSFEALSDSTEVNPSDNHASISIPVHYDSEIALSREANLNFYVVDMDNEVKT
TVNTFNDIGPELKFSLKVSTGNFPVNIAYLTVSLPSDTAGGNPLLYVTGVNTAPAGDVSC
EVASLVNPLKISEKPYTPSFSKENLMSTEELNCKTAKCQPMKCVLKDMGMMSDFFVNVTT
RIWNGTFAASSFQSTVLTVSTEIETSQPELLVISHKHLTVGVTISKPGVKGEIPVGVIVG
SVIGGLLLLALVIGLLWKFGFFRRKYQQLMKNTDEDQAETEGLQENAAA
NT seq 3570 nt   +upstreamnt  +downstreamnt
atggagtttaatccaaagaggactgttttaacgctgattttcatccaatgttggaacatg
cccgggtccttatcctttaatgtgggaactgctggagccaaggtattctctgaaccttct
gtagaggagtttggatacactgtgcaacagttaaagaatcaccagggcaaatggttgctg
gttggttctccctggagtggatacaaccaggacaggaaaggagacgtctacaagtgtgag
atcagaggggccagttcaggatgtcagagactcaacctgcaaaactcagtcagcatatca
acagtgagtaatgtcaatgtcaacatgagcctggggctgaccctaacccgtacagctaca
gaagatatgtttatggcatgtggacctctgtgggctcagaaatgtggcagtcaatattac
tacccagggatctgtgcagaagtcagccctctcttcaaccccctgtcttcattctcacct
gcccttcaaacttgtgggggtcccatggatattgctattgtcttggatggctctaacagt
atatatccctggccaccagttgtggctttcctcaagaaactgttggagaacttggatatt
ggacctgacaatactcaggtaagtattatacagtacgcggttgatccggattttgaattc
tatctgaactcctacaaaaccaaagactcaatcattgcggccgcagcgaacataccccag
aagttaggcctgcagactaacaccttccgggccattgaatttgccagacggcaggcgttc
ctgcctacgaacggtgcccgacctggagccagcaaggtgatggtggtggtgacagatgga
gagtctcatgacaacggcctcaaagacgacgtcatcgggaagtgtgagcaggagaagatc
acccggtttggtattgctgtcctcggctattacataaggaatgacatcgacactaaaaac
ctgattgctgagatgaagtccatcgccagtaccccgacagacaggtacttctttaatgtg
tcagctgaggaagctctgcttgagatcgctggaactctgggagacagaatcttcaatata
gagggtactgggaaagggggtgattttcagatggagatgtcccaagtgggcttcagtgcc
caccaaaccaataagcagaatatgatgatgctgggtgcagtgggggcctatggctggagt
ggtactgtggttcactacactcctcagaaatcagacatcttccccaagacggccttcgag
aacattctagaggacagaaaccacagttcactattaggctactctgtgacaacgctgaat
gatggcagcacggagtactacgtggctggcgctcctcggtccaaccacactggacaggtc
atagtgtacatcatcaacagcaaaggacaacccaccgtcatagactcccagaaaggagat
cagataggctcctactatggcagtgtactctgtcctctggatgtggataaagatggtgtg
tctgatatactgttggtcggcgctcccatgttcatgaatgaacagaagaaggagactggg
aaggtctatctcctctctttcaccaagggcatcctgagtgaccaggggatcctgaggggt
ccgtccccggcggacaacgctcgttttgggatgtccatctcagcggtgcctgacctcaac
atggatggttacagtgatgtagtggtgggagccccgctggaagacaacaacaggggggtc
atttatgtcttcaacggggacaagaagaaactgaggacgcagtgttctcagagaatcctg
ggctccaagctggaccctgcattgaagtattttgggcggtccctagacgccaactctgac
ctaaacgatgacaccatcccagatgtatcagtgggggcttatgggaaggtggtccagctc
tggtctcgaggtctggccgtggtgacagcgagggcgacctttaaccctgacaaggtcaac
atcctgagtaagacgtgcagggtcagtgggaggctggtgtcctgcttcaataccactgtc
tgtttcagtgcaaccttcaggcccaagatacctgtaggacctgtggctctcaggtacaac
ctgaccctggatgctgatctccagtcgtctcgtgtcacctccagaggtcagttcagtaac
tcagagagagtcctgcagaaagacatccgggtttccaccagggagctctgtgacgcctat
gaggtttttgttcaggaggcccctgactttgtgagctccatcggtctgcgtgtggacatc
gctctgcatgacccagactccagtcctgttctagatgtcctccgtcctacttcatgggag
ttctttatcccattctccaaagactgtggctctgatgagctgtgtgagagtgacctgctc
ttgaacgtcaagaaaggagagatgattcccagctcatctaagatgttggtcagctttaag
aacaagaggctgtccttcactgtgtctgtgaccaacaagaaggagaatgcgtacaacacc
cgagtcatggccacatactccaaaaacctcttctacgcctccatcactcctccaagtgac
gaaacagaggtgaagtgtagctccacccgagagactcgtagcctctcgtgccaggtggga
tacccagctttaaggaagaaccaggaggtgacattcgtaatcaactttgacttcaatctg
aatcaactgcagaccgaagccgacgtgagctttgaagctctaagtgacagcacagaggtg
aacccctcagacaaccacgcctctatctccatccctgtccactatgattcagagatcgct
ctctccagggaagcaaatctcaatttctatgtggttgacatggacaatgaggtgaagacc
acagtgaatactttcaatgacatcggtcctgagttaaaattctctctgaaggtttctaca
gggaatttcccagtgaatattgcctacctcacagtctcactgcccagcgatacagcagga
ggcaacccattactgtatgtgacaggagtcaacactgcacctgctggagatgttagctgt
gaagtagccagcctcgtcaatcctctgaagatcagtgagaagccttacacaccatccttc
tccaaggagaacctcatgagcacagaggagctgaactgtaagacagccaagtgccagcct
atgaaatgtgtcctgaaagacatggggatgatgagtgatttctttgtgaacgtgaccacg
cggatatggaacggtacctttgctgcttcctcattccagtccactgtgctgactgtgagc
acagagatagagacttcccaacctgaactgctggtcatctctcacaagcacctgacggtt
ggcgtcaccatcagtaaaccaggggtgaaaggggagatccctgtaggcgttattgtgggc
agtgtgattggaggcctgcttctattggctctcgtcattggcctgctttggaagtttggt
ttcttcaggagaaagtaccagcagctgatgaaaaacactgatgaagaccaggcggagacc
gagggtctgcaggagaacgcagcagcgtga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112258495
Entry
112258495         CDS       T05605                                 

Definition
(RefSeq) integrin alpha-IIb-like
  KO
K06476  integrin alpha 2B
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112258495
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112258495
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112258495
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:otw01009]
    112258495
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112258495
   04515 Cell adhesion molecules [BR:otw04515]
    112258495
   04090 CD molecules [BR:otw04090]
    112258495
Protein phosphatases and associated proteins [BR:otw01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     112258495
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112258495
Cell adhesion molecules [BR:otw04515]
 Integrins
  Integrin alpha subunits
   112258495
CD molecules [BR:otw04090]
 Proteins
  112258495
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha
Other DBs
NCBI-GeneID: 112258495
NCBI-ProteinID: XP_024288671
LinkDB
Position
9
AA seq 1056 aa
MKKMEEHRILRSLQMMGLLLFALPHYSDTLNLNLVNFTEFSGPEGSFFGFSADFYQFSNK
TISVVVGAPRANTSQPRVTEAGAVYLCPWAQTGGACTTMTFDTKGDEVYPHQNLVISSSK
SHQWFGATVRSSGNYIVACAPLFHWNVIDVGEREEAQNTPVGTCLVLNTLTGETVNFSPC
RDVMTEKNYKALKYTTDRRYCEVGFSSDITKEGRLLIGAPGGYYFQGQIISAGLPDIVDS
AKSQNAKPYVAGQTHSPETGGYDHYHGYSVATGEFTGDSIPDYVVGVPNDRNTAGSVKIY
NGNTPDFLGVKRTFLGSQVASYFGHSVAVTDINNDGIDDILIGAPLFMERVSGQQLQEVG
QVSVYLQRERSTFHSKPDQKLTGSQLYGRFGSTIAPLGDLDKDGFNDVAVGAPSSGVEGR
VFVYMGTSDGLSPQYTQVIESPFRSLGSPAQFGFTLRGATDIDSNGYPDLIVGAWGVNKI
AVYRAQAVVMAKTQLSLYPDFLNPDVKECQRPTTNEPVACFTVMMCISVSGHSIPEEIVL
DAELQLDKMKQTMARRTLFLQTNLPQEYFQLTIQRDVGVVCRNQTAYLRHESEFKDKLSP
IFISLNYSLSNSQEAMLHGQRAVVAQTRIILDCGVDNVCVPDLRLTAEAGTDRLLIGDDH
PALLVITAENRGEGAYETELEIRPPANTHYQSMVTDRKGFSKLICAQKKENQTVVMVCEL
GNPMKQGQKLLAGLFFSVGNLEEVESHVSFTLQIKSKNSQNPDSNMAHLRIDVSAEAALE
MRGGSSPPECVLPIAKWEQKEHPADLEEVGPLVEHVYELRNLGPSTVNARVQVEFPTHHH
GDVLLYVFANASEDFLTCHTDSPDIDPYQLVKTGNATVGKVYKVKQNEVAQQEPQRKETV
HVNCTSGDTCLRFVCEATGLERGWSAVVKVMSRLWVQTFLERPYENYVLHSTASFEVIDM
PSKIQPEELPSGQAETQTSVVWRAPDGEKEVPVWWIVVAVVSGLFLLALLALIFWKVGFF
NRNRPPCDDDDDAEHLAGPGQSEYAEMPTNTEDKQA
NT seq 3171 nt   +upstreamnt  +downstreamnt
atgaaaaagatggaggaacaccggattcttagatcattacaaatgatgggtctcctgcta
tttgctctcccacattactctgacaccttaaatctaaacctggttaacttcactgagttc
tctggccccgagggaagcttctttggcttctctgcagatttctatcagtttagcaacaaa
accatcagtgttgtggttggggcccctagagccaacaccagtcagccaagagtcactgag
gccggggctgtgtatctctgtccctgggcacagacaggaggggcctgtactaccatgacc
tttgacacaaaaggtgatgaggtttatcctcaccagaacttagtgataagctcttcaaag
tcccaccagtggtttggtgctactgtgcgatcctccggaaactacattgtggcctgtgcc
cccctgttccactggaacgtaatagacgtgggggaacgtgaggaggcccagaacactcca
gtggggacctgcctagtgttgaatacattgacgggggaaacggtcaacttctccccctgc
agagacgtcatgactgagaaaaattacaaagccctgaagtacactaccgacagacgatac
tgtgaagtgggatttagctctgacataacaaaggagggaaggctccttatcggtgctcct
ggaggctactattttcaaggtcagatcatcagtgcaggactgcctgacatcgtcgacagt
gccaagagccagaatgccaaaccttatgtggcaggacaaacccattcccctgagactggt
ggatacgatcattaccatgggtattctgtggccactggcgagttcactggagactcaata
ccagattatgtggttggagtgcctaatgatcgcaacacagcaggctcagtcaaaatctat
aatggaaacacacctgactttttgggagttaaacgcacattcttaggctctcaggtggcc
tcttacttcggccacagcgttgcagtgactgatattaacaatgatggaatagacgacatc
ctaatcggggcgcccctcttcatggagcgtgtgtcgggccagcagttgcaggaggtgggc
caggtgagtgtgtacctgcagagagagcgctccaccttccactccaagccagaccagaag
ctgacaggttcccagttgtacggacgctttggcagcaccatcgcccccctcggtgaccta
gacaaggacggttttaacgatgttgctgtgggagccccatcctcgggcgttgaagggagg
gttttcgtctacatggggactagtgatggactgtctccccagtatacccaggtcatcgag
agtcccttccggtccctaggctctccagcacagtttggcttcaccctgagaggggccact
gacattgattcaaatggctacccagatctaattgttggtgcatggggagtcaataagatt
gctgtgtacagggctcaagctgtggtgatggccaagacccaactctccctctaccctgac
ttcctgaacccagatgtgaaggagtgtcagcgccccaccaccaacgagcctgtggcctgc
ttcaccgtcatgatgtgcattagtgtgtctggccacagcattccagaggagatagttcta
gatgcagagcttcagctggacaagatgaaacagacaatggccaggaggaccctatttctg
cagaccaatctgccccaagagtattttcagctaaccattcagagagatgtgggtgtggtc
tgcaggaaccaaaccgcttacctacggcatgagtcagagttcaaggacaagctcagcccc
atcttcatctccttgaactacagcctgtccaactcccaggaggccatgctgcatggccag
agagctgtggtcgcacagaccaggatcattctggactgcggagtggacaacgtctgtgtc
cctgacctgaggctgactgctgaagcaggtactgaccgtcttctgataggggatgaccac
cctgccctgctggtcatcacagcagagaacagaggagagggggcctacgagaccgagctg
gagatacgcccaccagccaacacacactaccagagtatggtgactgacagaaagggcttc
agcaagttgatttgtgctcagaagaaggagaaccagacggtggtgatggtctgtgagctt
gggaaccctatgaagcagggccagaagctcctggccggtctgttcttcagcgtggggaac
ctggaggaggtggagagtcacgtgtcattcacattacagatcaaaagcaagaacagccag
aaccctgacagtaacatggcccatctgaggattgatgtcagcgctgaggcagctctggag
atgcgggggggctcctctccacctgagtgtgtcctgcccattgccaagtgggaacagaag
gagcatcctgctgacctagaggaggttggcccgctagtggaacacgtctatgagttgaga
aacctgggtccgagcacggtcaacgccagggtgcaggtagagttccctacccatcaccat
ggagacgtcctgctctatgtgttcgccaatgcttctgaggatttcctcacctgccacact
gactcccctgacatcgacccatatcagttggtgaagaccgggaatgctactgttggtaaa
gtgtataaggtcaaacagaatgaggtggcacagcaggagcctcagcgcaaagagaccgtt
cacgtgaactgcaccagtggagatacctgtctgaggtttgtgtgtgaggccacaggtctg
gagagaggctggagcgctgtggtgaaggtgatgtctcgactctgggtacagaccttcctg
gagaggccctatgagaattatgttctccactctacagcaagctttgaggttatagatatg
ccctccaagatccaacctgaagagctgccaagtggacaggctgagacccagaccagtgtg
gtgtggagggctcctgatggagagaaggaagtgccggtgtggtggattgttgtggctgtg
gtctctggcctcttcctccttgctctgctagctctgatcttctggaaggtggggttcttt
aatcgcaaccgtcccccgtgtgatgatgacgacgatgcagaacacctagctgggcctgga
cagtcagaatatgctgagatgcccacaaacacagaggacaagcaagcataa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112258519
Entry
112258519         CDS       T05605                                 

Definition
(RefSeq) integrin alpha-3-like isoform X1
  KO
K06482  integrin alpha 3
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112258519
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112258519
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112258519
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112258519
   04515 Cell adhesion molecules [BR:otw04515]
    112258519
   04090 CD molecules [BR:otw04090]
    112258519
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112258519
Cell adhesion molecules [BR:otw04515]
 Integrins
  Integrin alpha subunits
   112258519
CD molecules [BR:otw04090]
 Proteins
  112258519
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS FG-GAP_2 Collectrin
Other DBs
NCBI-GeneID: 112258519
NCBI-ProteinID: XP_024288706
LinkDB
Position
9
AA seq 1068 aa
MAIFQLLRFSTNTYYLLLLVLLCTVHILQGFNLDVRFPVVKEGKTPGSLFGFSVALHKQM
VGEKRYLLVVGAPKEKAESGVKANVTGDVYTCPVNVAQSDCTRMNLIGSDPDLIEGEDRV
EDMWLGVTVASQRQPGGRILTCGHRFVKLHGVLKLRQMIGKCYIRGNDLNYNETDMHWQN
PDQVCSHTKDITGEVMCNMGISAAITDTEVIVGAPGSFEWQGNVHVSWMNPNVIYDTKRS
SFPNFGNRRHIYIGYSVAEGRGLLSQSQDTVVTGAPKDNKDDAKGSVILTVKKSSTSGDG
DQLKPYLTLRGEQMGSYFGNSLAVADLNNDGWMDLIVGAPFYFDRKKELGGAVYVYMNEN
GSFRQNYSIILRGPRDSAFGMAVAAIGDVNQDGFQDFAVGAPFHGTGRVFIWTGSAEGIS
QEPSQVIEGEDIAGGGFKTFGYSINGGLDVDENRYPDMVVGSLDDRVALLRARPVIHLIK
TLEVTPGIVDPKDCDNCVEVEVCFNYKLSTGDKDFRKNVTVKYTVEADLTRHNHRVRFQD
NGLDSYTGFLSMPSAKCKTLRLGLVSPIRDKVEPVVFSLNVSLHEGHPRARQSLQNLDAF
PVLSEGKASHVKKEIHFQKACGPDNTCQSNLQMKAEFANEEQTPFPSHDGHQILQYSASV
KKVMLVVDVNNFQSPGKPAEDAHNAMLNVTIPPSLIYSAFRSKLWSNSPAIKCSAEDMVV
LCELGNPFTSNQVDQIQIIFQTSEISLDTREIRSTLQLSTLSKQSNLQPLPLVMVVEYTL
DASFALAQYTGHTHFSGEIMGESGMKTASDVGSPVEFTFKVNVFGKPLVNLGNLEVEFDW
PWEVANGKWLLYLTEIQTKGTSDSHCVPPGAIVNPLKLMLPESKARRRRKREEGSTEEVH
PRELQASLNLKGIRKKSFKLDCVTGTAHCVKFICPLRNMNNTATIIVRARVWNSTMLEDY
REAWRVTVNGKATLKLVTDKPTIRMNTESTEFTLNIDPELGEEATYQVPLWIIIVSAVAG
ILLLAFIILLMWKCGFFRRASTREMYEAKAQKAEMKTQPSEVERLTEE
NT seq 3207 nt   +upstreamnt  +downstreamnt
atggcaatctttcaactactccggttttctacgaatacctactatctcctgttgcttgtc
ctgttgtgcacagtacatattcttcaggggttcaacctggatgtgcggttccctgttgtc
aaggaaggaaagaccccgggaagtctctttgggttctcggtggcacttcacaaacagatg
gtgggagagaaaagatacctactcgttgttggagcacccaaggagaaggcagagtctggc
gtgaaggccaatgtaacaggagatgtgtatacctgccctgtaaacgttgcccaatcagat
tgcaccaggatgaacctgattggctcagaccctgacctcattgagggtgaggacagggtg
gaggatatgtggctgggggtaaccgtggccagccaaagacagccaggggggcgaattctg
acctgtggccatcgctttgtgaagttacatggcgtattgaagctgcgtcagatgattggg
aagtgttatatccgtggtaacgacctgaactataatgaaacagacatgcactggcagaac
cctgatcaggtgtgcagccacactaaagacatcacaggtgaagtcatgtgcaacatgggc
atctctgctgccatcactgacacagaggtcatcgtgggcgcccctggcagctttgagtgg
caaggcaatgttcatgtctcctggatgaatccaaacgtcatctatgacaccaagagaagc
agcttccccaactttggtaatcgacggcacatttacataggctactcggtggcagagggc
cgaggcctcctcagccagagccaggacacagtggtgacaggggctcctaaggataacaag
gatgacgccaaaggctcggtcattctgactgtgaagaagtcgtcgacgtcaggggacggg
gaccagctgaaaccctacctcaccctgagaggcgagcagatgggctcatactttgggaac
tccctagccgtggcagacctcaacaatgatggttggatggatctgatcgtcggagccccg
ttctattttgatcggaagaaggagcttggtggagcggtgtacgtctatatgaacgagaac
ggctccttccggcagaactacagcatcatactccgaggccctagagactctgcgtttgga
atggctgtggctgccattggagatgtcaaccaagatggctttcaagattttgcggtgggc
gctccgttccatggaacaggcagggtgttcatctggacaggcagtgctgagggcatctct
caggagcccagtcaggtgattgagggggaggatatagctgggggtgggttcaagacgttt
ggctactccatcaacggggggctggatgtggatgagaaccgctaccctgacatggtggtc
ggctcactggacgaccgcgtagccttactgagggcccgcccagtcattcacctcattaaa
actcttgaagtgacgccagggattgtggaccctaaagactgtgacaactgtgtggaggtg
gaggtctgtttcaactacaaactgagcactggggacaaggacttcaggaagaacgtcacg
gtgaagtacactgtggaagccgacctaacacggcacaaccaccgggtccgtttccaagac
aatggcctggacagctacactggattcttgtcaatgccatctgccaaatgcaaaacgctg
aggctcggactagtgagtcccatccgagacaaggtggagcccgtagtcttctccctgaac
gtatccctccatgaggggcatcccagagcccggcagtccctgcagaacctggatgccttc
cctgtgctcagtgagggaaaggccagccatgtcaaaaaggagattcacttccagaaagcc
tgtggcccggacaatacgtgccagagtaacctgcagatgaaggcagagtttgccaatgaa
gagcagacaccttttcccagccatgatggtcaccagatcctccagtacagcgccagtgtc
aagaaggtcatgttggtcgtggacgtgaacaacttccagtcgccagggaaaccggcagag
gacgctcacaatgccatgctcaacgtcaccattcccccgtcgctgatctactcagccttt
cgctcaaagctatggagcaacagcccagccatcaagtgttcagcagaggatatggttgta
ctgtgtgagctggggaacccattcaccagcaaccaggtggatcagatccagatcatcttt
cagacgtctgagatcagtctggacaccagagagattcgctctacgctgcagctttccaca
ttgagtaaacagagcaatctacaaccgctgcctcttgtcatggtggtggagtatacactg
gatgcgtcttttgcacttgcccagtacacaggtcacactcacttcagtggggagatcatg
ggagaatcgggcatgaagactgccagcgacgtcggaagtcctgtggagttcacatttaag
gtgaatgtttttggaaagccactggttaaccttggaaacctggaggtggagtttgattgg
ccctgggaggtagccaatggcaagtggctgctgtacctgacggagatccagaccaaaggg
acgtcagactctcactgtgtgcctcctggagccatcgtcaacccactcaaactcatgtta
ccagagagcaaagccaggaggagaaggaagcgagaggagggctccacagaggaggtgcac
cccagagaactccaggcctccctcaatctgaagggaattcgcaaaaagtcctttaaactg
gactgtgtcacgggcactgctcactgtgtgaaattcatctgccctctccgcaacatgaac
aacactgcgacaatcattgtcagggccagagtgtggaacagcaccatgctggaggactac
agggaagcgtggcgggtgacagtgaatggcaaggccacactgaaactggtcacagacaaa
cccaccatcaggatgaacactgagagcacagagttcaccctgaatatagacccagagctg
ggggaggaggctacgtaccaggtccccctgtggatcatcatcgtgtctgctgtcgctggc
atcctccttctggccttcatcatcctccttatgtggaagtgtggcttcttcaggagggcc
agcaccagggagatgtacgaggccaaggcccagaaagctgagatgaagacccagccgtcg
gaggtggagaggctgactgaggagtag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112259461
Entry
112259461         CDS       T05605                                 

Definition
(RefSeq) integrin alpha-1-like
  KO
K06480  integrin alpha 1
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112259461
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112259461
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112259461
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112259461
   04515 Cell adhesion molecules [BR:otw04515]
    112259461
   04090 CD molecules [BR:otw04090]
    112259461
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   112259461
Cell adhesion molecules [BR:otw04515]
 Integrins
  Integrin alpha subunits
   112259461
CD molecules [BR:otw04090]
 Proteins
  112259461
SSDB
Motif
Pfam: Integrin_alpha2 VWA FG-GAP VWA_2 VCBS FG-GAP_2 Clathrin LYRIC
Other DBs
NCBI-GeneID: 112259461
NCBI-ProteinID: XP_024289931
LinkDB
Position
9
AA seq 1091 aa
MYQTGLPENTTIPNLHEVKENMTMGTTLVTNPQGGFLACGPQYGYMCGQQTYISGVCTNV
SSTFQVLNSIAPAVQECAKELDIVMVLDGSNSIWPWTSIIDFLVKFLKNIEIGAKLSQVG
IVSYGEKVTHNVNLSQFDTTQSLLAKVAKLPQQTGFKTMTALGIDTARKEAFTVERGARP
GVKKVMIIVTDGESHDFYNLDKVIKECEEDDIERFGIAVLGDYNRNNRSIKEVKKFIEEI
QSISSDPVGDHFFNVSDEFALLNIVDALGSRIFALEATSGNYTSSFEMEMSQAGFSAHTS
KEGVMLGAVGAYEWNGTVVMHTNQGTVVPLNADFQDPLDERKESLAEYVGYAVQSASTPN
GELYITGAPRYNHTGRVIVYKLDGEIITVTQVLKGEQIGSYFGSVLQTVDVDQDSYTDIL
LVGAPMFMGPEREEQGQVYVYKLNEGLFEHQTTLKPDNQTCCTSAHSNGCTIVNTNGPCG
ARFGTAIAEVSDLDLDGNRDVAIGAPLENDHKGAVYVYHGAKKTIKEKYVQRIPGPGDGV
KTKFFGQSIHGVMDLNGDGIIDITIGGLGGASLFWSKDVAELYANMTFDPNKINLQQPSE
DCVLGERATVCVKTRVCFSYSVKSEKDHTNLGTAIKYNLTLDSLRAKSRAAFVNPDEKSE
RKVQVTANIIDALCLEHSFAMKANLDFRDPIMVSLEFGLAEDTGPVLDGDLPTSLNKTIP
LVDCGSDDKCIADLSLKAVPSIQSLVIKANKEKFHVLITIRNSQDNAYNTKVMLSFTENI
NYVKVKANDKVCSLNNTKVECAVGYPFLKSNVEEVFEILFEVNPAHVWKEIQINVTATSD
SEELKTTLHDNSVRISIPVKYEAGLRFTADRHMKEDHIIVKEGEQYPQHLSTTPVKKDVN
METPPLKLRVMYPYLSPRENILLYLTHVTSSQDVRCHIRDLINPLKINNNNTHTINPKKE
TLSVFLVGCKDHPCKSFICSIPHVNNSQVNVTFRVWKPTFIKAEFSSLHMIVNATLENLN
TDLFVLSATNYARDVKVQVSKEALGGIPLWIIIVSILIGLLILALVIFALWKAGFFKRKS
IEDMENEDMKN
NT seq 3276 nt   +upstreamnt  +downstreamnt
atgtatcaaactggactgcctgaaaacacaacaattcctaatttacacgaagtcaaggaa
aacatgaccatgggaacgacgttggttaccaaccctcaaggaggctttctggcttgtggt
ccacagtacggctacatgtgtggtcagcagacatacatctctggggtctgtaccaacgtc
agctcaaccttccaggtgctcaactccatcgccccggctgtgcaagagtgtgccaaagag
cttgacattgtcatggttcttgacggctccaacagtatctggccctggaccagcatcatt
gatttcctggtcaagtttctgaagaatatcgaaattggagctaaactgtcccaggtgggc
attgtgtcgtatggagagaaagtcactcacaatgtcaacctcagccagtttgataccact
caatccctcctggccaaagtggcgaaacttccccagcaaacaggtttcaagactatgacc
gccctgggaattgacacggcaaggaaagaggccttcactgtggagcgaggggcgcggccg
ggggtcaagaaggtcatgataattgtgacggacggagagtcacatgacttttataacctc
gacaaggtcatcaaagaatgtgaggaggacgatatcgagaggttcggtatcgctgtgctt
ggtgattacaacaggaacaacagaagcatcaaggaggtgaagaaattcattgaggagatc
cagtcgatctccagcgatcctgtgggagatcacttcttcaacgtgtcggatgagtttgcc
ttgctgaacatcgtagacgccctgggcagcaggatctttgccttggaggcaacgtcaggt
aactacacctcgtcttttgagatggagatgtcccaggctggatttagtgcccacacctct
aaagagggtgtgatgctgggtgctgtgggggcgtatgagtggaacgggacagtagtgatg
cataccaaccagggtaccgtggttcctctaaacgcagactttcaagaccccctggatgaa
aggaaggagagcctggcggagtacgtgggttatgccgtacagtcagcatcaacccctaat
ggtgaattatacatcacaggagcaccacggtacaaccacacaggcagagtcatcgtctac
aaactggatggggaaatcatcacagtcacacaagtactgaaaggagagcagattggctcc
tactttggcagcgtgctccagacggtggatgttgaccaggactcctacacagacatcctg
ctggtgggagctcctatgttcatgggcccagagagggaggaacagggacaggtgtacgtc
tacaaactcaatgagggcctatttgagcaccagaccacgctgaagccagacaaccagacg
tgttgtacctcggcccactccaacggttgcaccatcgtcaataccaacggcccgtgtggc
gcccgcttcggcaccgccatcgcagaggtcagtgacctagacctggacgggaaccgggac
gtggctatcggggcgccactggagaacgaccacaaaggggcagtctacgtctaccatgga
gccaagaagaccatcaaggaaaaatatgtgcagcgtatcccaggccctggagacggggtg
aagactaagttctttggccagtcgatccacggagtcatggatctgaacggagacggaatt
atagacattaccatcggagggctgggaggggcttctctgttctggtccaaggatgttgct
gagctttatgccaacatgacctttgacccaaacaagatcaacctacagcagccctctgaa
gactgtgtgctgggtgagagagccaccgtgtgtgtgaagaccagggtctgctttagctac
agtgtcaagtctgagaaggaccacactaacttgggcacagccattaagtacaacctgact
ctggactctctgagggcaaagtcgagggcagcgtttgtcaaccctgacgagaagagtgag
aggaaggtccaggtcaccgccaacatcatagatgctctgtgtctggaacattcctttgcc
atgaaggctaatctggacttcagagaccccatcatggtctccctcgagtttggtctggct
gaggacacaggccccgtcctggatggagacttaccaacgtcactcaacaaaacgattcct
ttggtggactgtgggagcgatgacaagtgcatagctgacctatccctgaaggctgtgcca
agtatacaaagtcttgtgatcaaagccaacaaggaaaagttccatgtgctcattaccatt
agaaacagtcaagacaatgcctacaataccaaagtcatgctcagctttactgaaaacata
aactacgtcaaagtcaaggccaatgacaaagtctgcagtctgaataataccaaagttgag
tgtgctgtgggatatccattcctcaaaagcaatgtagaggaggtgtttgagatcctgttt
gaagtcaaccctgcacacgtctggaaagagattcagatcaacgtaactgcaaccagtgac
agtgaggaattgaagaccaccctccatgacaactctgtgagaatctccatccctgtgaag
tacgaggctggactcagattcactgctgacaggcatatgaaggaggaccacatcatagtg
aaagagggagagcagtacccccagcatctttcaaccacaccagttaaaaaggatgtgaat
atggagactcctcctctaaagctgagggtgatgtacccgtacctatcacctagagagaac
atcctgctatacctgacacatgtcacctcctcacaggatgtgagatgtcacatcagggac
ctgattaaccctttaaagatcaacaacaacaacacgcacaccatcaatcctaaaaaagag
accctcagtgtcttcctggtgggctgtaaggaccacccgtgtaagtcatttatctgctcc
atccctcacgtcaacaacagccaggtcaatgttaccttcagggtgtggaagcccaccttt
atcaaagcagagttctccagccttcacatgattgttaatgccactctggagaacctgaac
actgatctcttcgtgttgagtgccaccaattacgccagagatgtgaaggtccaggtctct
aaagaggctttgggaggtataccactgtggatcattatagtcagtatcctcataggactg
ctgattctggcactggtcatcttcgctctatggaaggctggatttttcaagagaaaatcc
atagaggacatggagaacgaggacatgaagaattaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112267689
Entry
112267689         CDS       T05605                                 

Definition
(RefSeq) integrin alpha-5-like isoform X1
  KO
K06484  integrin alpha 5
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04145  Phagosome
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
otw04810  Regulation of actin cytoskeleton
otw05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112267689
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    112267689
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112267689
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112267689
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    112267689
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112267689
   04515 Cell adhesion molecules [BR:otw04515]
    112267689
   04090 CD molecules [BR:otw04090]
    112267689
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112267689
Cell adhesion molecules [BR:otw04515]
 Integrins
  Integrin alpha subunits
   112267689
CD molecules [BR:otw04090]
 Proteins
  112267689
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha
Other DBs
NCBI-GeneID: 112267689
NCBI-ProteinID: XP_024301641
LinkDB
Position
2
AA seq 1062 aa
MGTGRQFATISVNSPPRNPGYCALFVVLTLVFIQQCATFNLETENRVVYTGPKDSFFGYS
VDVFYNNSSSVSILIGAPKANTSQPNVNEGGSVYLCPWSQGQSNCSVVHFDNEGDRRFHV
NDVDVQVEFKSHQWFGATVRSHGNTVLACAPRYYWRTEHDAPFSDVTGTCYLSVDNLKTF
VEYAPCRTERHGPAGQGYCQGGFSADFTKDGKIVLGGPGSFYWQGQLILATTKEIVKAYY
PSYFLLSVTGQIQTHQVQGSYDDSYLGYSVAGGEFSGDNIEDFVTGVPKGLMLYGLVSIL
NGTDLKSMLNLTGEQMGSYFGYAVAATDINNDGMEDLVVGAPMFMQRGSDGLRWEEVGRV
YVYLQRRPLLFEPRLPHLGGTQAFGRFGSSLAPLGDLNQDGFNDIAIGCPFGGDDQQGLV
LIYNGHASGLMDMPTQTLAGQWASGTFPASFGYALRGNKDLDHNGYPDLIVGAFGVDKAV
LYRARPIVNASASLMLQPTMINPEEKSCTVSNGNETISVSCVNLSFCLSANGKHLPADLG
FVVEVQLDHLKQTQKESSVRRTLFLDSQQPSLLKTITMANGGRTCHDTRIYLRSEGEFRD
KLSPIYVTLNFSLDPLASLDHHGLRPILKYQTTHLIEQKAQIQLDCGEDNICVPDLKLAV
YGDRTEVYLGDDNSLTLTFNARNEGEGGAYEAELYMVLPPEADYSGIARNNASLTQLTCS
YEAENQTRSLVCDLGNPMKSGTSLWAGLRFTVPRLNDTYNTVQFELQIRSKNENSSQSDV
ELYDLEVAVVADVILQGVSRPDKLLFPPPNWRMSHSLQEEQDIGSEIQHVYELVNNGPSM
ISQSVLELRCPLRAQGHDLLYPVEIITQGPLNCSSNHTLNALKLKLQPPTTEQPPSSQTV
SPEHHIQRREVYRDPLAKQSNLSCSMVECWRLHCHVGLLERGNSVILTVRSRIWAETFIE
RAYKQYVLECSAQYRVKNMPYAIAPKLKPSGSTKILTPVMWNKPESQYIVPLWIIILAIL
AGLLLLALLIYVLYKMGFFKRSNPYGTAMEKAQLKPQASSEA
NT seq 3189 nt   +upstreamnt  +downstreamnt
atgggcactggacggcaatttgcaacaatttcagtaaactcaccccctcgaaatccaggt
tattgcgccctgttcgttgtacttacattggtttttatccagcagtgcgcaacgtttaac
ttggaaacggaaaatcgcgtcgtctacactggacctaaggacagttttttcggttattcg
gtggatgttttctacaataattcgtctagtgtcagcattctgattggtgctcccaaagct
aacaccagccaaccgaatgtcaacgaaggtggatctgtgtacttatgtccctggagccag
ggccaatcgaattgcagtgtcgtccactttgacaatgaaggagatcgccgtttccatgtc
aacgacgtcgacgtccaggtggagttcaagtcccatcagtggtttggggcgacagtgcgt
tcccatggcaacactgtcctggcttgtgccccgaggtattactggagaacggaacacgac
gcccccttctctgacgtcacaggaacttgctacctctccgtggacaacctcaagacattt
gtggagtacgccccctgtcgcacagagagacatggtcctgccggacagggctactgtcag
ggcgggttcagtgctgacttcaccaaggatgggaagattgttcttggaggaccaggaagc
ttttactggcaaggtcagctgatcttagccaccacaaaggaaatagtcaaggcctactac
ccttcctacttcctgctctctgttaccgggcagatccagacccatcaggtgcaggggagc
tatgatgacagttacctgggttactctgtggccggcggggagttcagtggagataatatt
gaagatttcgtcacgggagtccccaagggactcatgttgtatggtttagtgtccatactc
aatggaacagacctgaaatccatgctgaacctcaccggagaacagatggggtcctatttc
ggctacgcagtggcagccacggacatcaacaacgacgggatggaagaccttgtggtggga
gctcccatgttcatgcagaggggttccgacggactgcgttgggaggaggtgggccgtgtc
tatgtgtacctgcagcggcgacccttgctgtttgaacccaggctgccccacctggggggg
acccaggccttcgggaggtttggcagctcgctggccccactgggagacctcaaccaggat
ggcttcaacgatattgccatcggctgtccctttggaggagacgaccaacagggattggtc
ctcatctataatggacatgccagtggactgatggacatgcccactcagactctagctggc
caatgggcctctggcaccttccccgccagttttggctacgccctccgcggaaataaagat
ctggatcataatggctacccagatctcatcgtaggtgcttttggggttgacaaggctgtt
ctgtacagggcgcggcctattgtcaatgccagtgcctctcttatgctgcaacctaccatg
atcaatccagaggagaagagttgtacggtgtccaatgggaatgagacaatctctgtgtcc
tgtgtcaacctcagtttctgcctctcggccaatgggaagcacctccctgctgatctaggt
tttgtggtggaggtacagttggaccatctgaagcagacccagaaggagtcgtcagtgagg
agaactctgttcctggatagccaacagcccagcctactgaagaccatcaccatggccaat
ggaggacgaacgtgtcatgacacccgcatctacctgcgaagtgaaggggagtttagggat
aaactttcccccatttacgtcacactcaactttagcctggaccctctcgcttcgctggat
caccatggtctcaggcccattctaaaataccagacaacacaccttatagagcagaaggcc
cagattcagctggactgtggtgaggacaacatctgtgtccctgacctcaaactggctgtt
tatggcgataggacggaggtgtatctgggtgacgataactccctgaccctgactttcaat
gccaggaacgagggagagggcggggcctacgaggcagagctttacatggtgcttccccca
gaggctgactacagtggtatagcccgcaacaatgcgagtctgactcagctaacctgtagc
tacgaggcagagaatcagacccgctctctggtctgtgacctgggcaaccctatgaagtct
ggcacaagtttgtgggcaggcctccgcttcactgtgccccgactgaatgacacttacaat
acggtgcagtttgagctccagatacgcagtaaaaatgagaatagctcccagagcgatgtt
gagctctatgatcttgaggtggctgtggtagctgatgttatcctacagggcgtttctcgt
ccggacaagctcctcttccctcccccaaactggaggatgagccacagcctccaagaggag
caggacattgggtctgagatccagcatgtctacgagttggtgaacaatgggcccagtatg
atcagtcagtcggtgctggagctgcgatgccctctgagagctcagggtcacgatcttctg
taccctgtggagatcatcactcagggaccactcaactgcagctccaaccacaccctcaat
gcactgaaactcaagctccagcctcctacaacagaacagcctccctcctcacagacggtc
agccctgaacaccacatccagaggagagaggtctacagggatcctctggccaaacaaagc
aacttgtcatgctctatggtggagtgctggaggctgcactgccatgtggggttactggag
agaggaaacagtgtcattctgacagtccgctcacgcatctgggctgagaccttcatcgag
agggcatacaagcagtatgtgctggagtgttctgcccagtacagagtcaagaacatgccc
tatgccatcgctcccaaactcaaacccagtggatccacaaagatcctgactccagtgatg
tggaacaagccggagagccagtacattgtacccctgtggattatcattctggccatactg
gctggactgctgctgctcgccctgctcatatatgtactatacaagatgggcttcttcaaa
agatccaatccctatggtacagccatggagaaagctcaactcaaaccccaggcttcttct
gaggcctaa

DBGET integrated database retrieval system