KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112215283
Entry
112215283         CDS       T05605                                 

Definition
(RefSeq) TGF-beta receptor type-1-like
  KO
K04674  TGF-beta receptor type-1 [EC:2.7.11.30]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04060  Cytokine-cytokine receptor interaction
otw04068  FoxO signaling pathway
otw04144  Endocytosis
otw04218  Cellular senescence
otw04350  TGF-beta signaling pathway
otw04371  Apelin signaling pathway
otw04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112215283
   04350 TGF-beta signaling pathway
    112215283
   04371 Apelin signaling pathway
    112215283
   04068 FoxO signaling pathway
    112215283
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    112215283
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112215283
  09143 Cell growth and death
   04218 Cellular senescence
    112215283
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    112215283
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112215283
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     112215283
Protein kinases [BR:otw01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   112215283
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr TGF_beta_GS Activin_recp Pkinase_fungal APH FTA2 Syndecan
Other DBs
NCBI-GeneID: 112215283
NCBI-ProteinID: XP_024229969
LinkDB
Position
16
AA seq 497 aa
MDSVPYSLVLIVLFFGTMIQENDALQCYCQRCLNSTCTTDGLCFVTVMKSGSRLTTERSM
CVHESELIPRDRPFICAPSTKDDTGIYPMCCASDWCNKNPNLSVFPVPTVKPVPLGPVVL
AAVIAGPVCVLCFVLVLVFYVCHSRVGVHQRVPNEEDPSMDHPFLTVGSTLKDLIYDMTT
SGSGSGLPLLVQRTIARTIILQESIGKGRFGEVWRGKWRGEEVAVKIFSSREERSWFREA
EIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVTVEGMIKLS
LSTASGLAHLHMEIVGTQGKPAIAHRDLKSKNILVKKNGTCCIADLGLAVRHDSATDTID
IAPNHRVGTKRYMAPEVLDDSINRSMLSRLRGQISNAMGLVFWEIASRCSLAGIVEDYQL
PYHDLVQSDPSVEEMRRVVCDQKLRPNIPNRWQSCEALRVMAKIMRECWYANGAARLTAL
RIKKTLSQLSQSEGIKM
NT seq 1494 nt   +upstreamnt  +downstreamnt
atggattcagtaccctattctctcgtgttaatagtcctgttctttgggactatgattcaa
gaaaatgatgccctgcagtgctattgccagcgctgtctcaactctacgtgcaccacggac
ggtctgtgcttcgtgacggtcatgaagtctggcagccggctcaccaccgagcgcagcatg
tgcgtgcacgagagcgaactgatcccccgcgaccgccccttcatctgcgcgccctccacc
aaggacgacacaggcatctacccaatgtgctgcgcctccgactggtgcaacaagaacccc
aacctcagcgtcttcccagtgccgacggtgaagccggttcctctggggcctgtggttctg
gcggcagtgatcgcggggcccgtgtgcgtgctgtgcttcgtgctggtgctggtcttctac
gtttgccacagccgtgtgggtgtgcatcaacgcgtgcccaacgaggaggatccctccatg
gatcaccccttcctcaccgtgggttccactctcaaagacctcatctacgacatgaccacc
tctggctccggctctggtctgcccctactggtacagaggaccatagcccggaccatcatc
ctccaggagagcatcgggaagggccgcttcggcgaggtgtggcggggcaagtggcgaggc
gaggaggtggcggtcaagattttctcctcccgtgaggaacgttcgtggttccgtgaggcc
gagatctaccagacggtcatgctgcgtcacgaaaacatcctgggctttatcgccgccgac
aacaaagataacgggacatggacccagctgtggctggtgtcagactaccacgagcacggc
tctctgtttgactatctgaaccgctacacagtcaccgtggagggcatgatcaaactgtca
ctgtccaccgccagcggtctggcccacctccacatggagatcgttggcacgcaagggaag
ccggccatcgcccacagggatctgaaatctaagaacatcctggtgaagaagaacgggact
tgctgcattgccgacctgggcttggccgtgcgccacgactccgccaccgacaccatcgac
atcgcccccaaccacagagtagggaccaaaaggtatatggcaccagaggtgctagacgac
tcgataaacagaagcatgttgagtcgtttaagagggcagatatctaacgccatgggcttg
gtgttctgggagatagccagtcgatgctctctggcaggcatcgttgaagactaccagctg
ccataccatgacctggtgcagtcagacccttctgtggaggagatgaggcgggtggtgtgt
gatcagaagctacgacccaacattccaaacaggtggcagagttgtgaggctctgcgggtg
atggctaagatcatgagggagtgctggtacgccaacggagccgcccgcctcacagcgctg
cgcatcaagaagaccctgtcccagctcagccaatcagagggcatcaagatgtag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112225563
Entry
112225563         CDS       T05605                                 

Definition
(RefSeq) TGF-beta receptor type-2-like isoform X1
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04060  Cytokine-cytokine receptor interaction
otw04068  FoxO signaling pathway
otw04144  Endocytosis
otw04218  Cellular senescence
otw04350  TGF-beta signaling pathway
otw04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112225563
   04350 TGF-beta signaling pathway
    112225563
   04068 FoxO signaling pathway
    112225563
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    112225563
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112225563
  09143 Cell growth and death
   04218 Cellular senescence
    112225563
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    112225563
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112225563
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     112225563
Protein kinases [BR:otw01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   112225563
SSDB
Motif
Pfam: ecTbetaR2 Pkinase PK_Tyr_Ser-Thr
Other DBs
NCBI-GeneID: 112225563
NCBI-ProteinID: XP_024245385
LinkDB
Position
26
AA seq 588 aa
MGCWRFSAVNIVLLSFCLPILSFTHIKTSLCKWCDYSSPICEDSVCYTNCSLSSFCNLSE
EICVAIWRKDNQSTSVKTLCHQPQQPLENIMLSNYSSNECVMTPHPSEDGVLFVCGCLGE
HECNDKLIFDKGSNGFSKLKSKDVIPVVVISLVPPFLVAIIASMAFYLYRTKQPSKQPKD
WAPKHTHYKALDIPEGLSGHVIPSGEDCHGKRSAINGDTTSDMCPVQAYNFNHNMEQLPI
QLEALVGKGRFAEVWRAKLHHQAMGSLYETVAVKIFPSVEYVSWSKERAIFSDANLEHDN
VVKFLTAEERGPSGSPQRQYWLVMAYHSLGNLQDFLAGHVLSWAELCAMAGSVAQGLAHL
HSDTTPCGIPKVPVAHRDLKSSNIVVKSRRECALCDFGLALRLDLSLTVDDFANSGQVGT
ARYMAPEVLESRVNLEDLEAFKQMDVYSMALVLWEMVSRCEVIGEVKSYEPPFGSKVCDQ
PCVDSMRDLVLRDRGRPEIPTSWTTHQGMDLLCATINECWDHDPEARLTAHCVVERFGSL
EEEMEQKGLDTINSQNNHQGPPSGIFPDCDVDPLTPETDTEGPSSLGH
NT seq 1767 nt   +upstreamnt  +downstreamnt
atggggtgctggagattctcggcagtgaatattgttcttctgtctttctgccttcccatc
ctctccttcacacacatcaagaccagcctgtgtaagtggtgtgactactccagccctatc
tgtgaggacagtgtgtgttacaccaactgttccctctcctccttctgtaatctaagtgaa
gagatctgcgttgctatatggcggaaggacaaccagagtacgagtgtgaagacgttatgc
caccagccccagcagcccctggagaacatcatgttgtctaactactcctccaacgagtgt
gtgatgactcctcatccttctgaggacggggtcctgttcgtctgtggctgcctgggagaa
cacgagtgcaacgataagctcatattcgacaagggctccaatggtttttccaagctcaag
agtaaagatgtgatcccagtggtagtgatcagcctggtccctcccttcttagtggctatc
attgcttccatggctttctacctgtaccgtaccaaacagcccagcaagcagcccaaagac
tgggctcccaaacacacacactacaaggccttagacatcccggagggacttagtgggcac
gtcatccccagtggtgaggactgccatggcaagcggtcagccatcaatggcgacaccacc
tctgacatgtgtcctgtccaggcctataacttcaaccacaacatggagcagctgcctatc
cagctggaagccttggtggggaagggtcgcttcgctgaggtttggcgggccaagctccac
caccaggccatgggttctctgtacgagacagtggcagtgaagatcttcccgtctgtggag
tacgtgtcctggagtaaggagagggccatcttctctgacgccaacctggagcacgacaat
gtggttaaattcctgacagcagaggagcgagggccctccggctcccctcagaggcagtac
tggctggtcatggcctatcacagccttgggaacctgcaggacttcctggcgggccacgtg
ttgagctgggctgagctttgtgctatggctgggtcggtggctcaaggattggcccacctt
catagtgataccaccccctgtgggatccccaaggtgcctgttgcccaccgcgatctgaag
agcagcaacatcgtggtgaagagcagaagagagtgtgccctctgtgactttggtctggct
ctgaggctggacctctccctcaccgtggatgactttgccaacagtggccaggtggggaca
gctcgctacatggcccctgaggtgttggaatctagggtgaatctggaggatctggaggcc
tttaaacagatggatgtctactccatggccctggtcctctgggaaatggtttcccgctgc
gaagtcataggggaggtgaagagttatgagccgccctttggctctaaggtgtgtgaccag
ccgtgtgtggacagcatgagggacctggtcctgagggacaggggcagacctgagataccc
accagctggacaacacatcagggtatggatcttctgtgcgccaccatcaatgagtgttgg
gaccacgacccagaggccaggctcacagcccactgtgtggtggagcgctttggaagtcta
gaagaggagatggagcagaaggggttagacactatcaacagccagaacaaccatcagggt
cctccctctggcatcttccctgactgtgacgtggaccctttgacccctgaaacagacaca
gagggaccctcatccctgggccactga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112226882
Entry
112226882         CDS       T05605                                 

Definition
(RefSeq) TGF-beta receptor type-1-like
  KO
K04674  TGF-beta receptor type-1 [EC:2.7.11.30]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04060  Cytokine-cytokine receptor interaction
otw04068  FoxO signaling pathway
otw04144  Endocytosis
otw04218  Cellular senescence
otw04350  TGF-beta signaling pathway
otw04371  Apelin signaling pathway
otw04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112226882
   04350 TGF-beta signaling pathway
    112226882
   04371 Apelin signaling pathway
    112226882
   04068 FoxO signaling pathway
    112226882
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    112226882
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112226882
  09143 Cell growth and death
   04218 Cellular senescence
    112226882
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    112226882
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112226882
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     112226882
Protein kinases [BR:otw01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   112226882
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr TGF_beta_GS Activin_recp Pkinase_fungal APH FTA2
Other DBs
NCBI-GeneID: 112226882
NCBI-ProteinID: XP_024247297
LinkDB
Position
28
AA seq 499 aa
MDTMRSYLTCWVLFLGAGVQISIALQCHCQWCSNSTCYTDGLCFVSFVKSGSKMVAQGSM
CLPEADLIPKDRPFVCAPSKKENTGVVPVCCNTDMCNKDPDPGDYSLTFPTARTPPLSPV
ALAAVIAGPVCVLCFVLLLVFYVCHSRSVVHRRVPNEEDPTMDHPFLADGHTLKDLIYDM
TTSGSGSGLPLLVQRTIARTIILQESIGKGRFGEVWRGRWRGEEVAVKIFSSREERSWFR
EAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVTVEGMIK
LSLSTSSGLAHLHMEIVGTQGKPAIAHRDLKSKNILVKKNGTCCIADLGLAVRHDSATDT
IDIAPNHRVGTKRYMAPEVLDDSINMKHFESFKRADIYAMGLVFWEIARRCSIGGIHEDY
QLPYYDLVQSDPSVEEMRRVVCDQKLRANIPNRWQSCEVLRVMAKIMRECWYSNGAARLT
ALRIKKSLSQLSQQEGIKM
NT seq 1500 nt   +upstreamnt  +downstreamnt
atggatacaatgcgctcttatttaacatgttgggtcctgtttcttggagcgggagttcag
atatccatcgcattgcagtgccactgccagtggtgtagtaacagcacctgctacacggac
ggcctgtgctttgtgtccttcgtgaagtcaggcagtaagatggtggcacaggggagcatg
tgtttacctgaggcagacctcatccctaaggacaggccatttgtctgcgccccatcgaaa
aaagagaacactggggtggtccctgtctgctgcaacacagacatgtgtaacaaagacccc
gatccgggcgactactcgttgacattccccacagcccgtacgccccccctgagcccagta
gccctggcggctgtcatcgcagggccggtgtgtgtgctgtgctttgtgctgctgctggtg
ttctacgtgtgccacagccgctctgtcgtccaccgccgtgtgcccaacgaggaagaccct
accatggaccaccccttcctagctgacggccacaccctcaaagacctcatctacgacatg
accacctcaggctccggatcaggcctgcccctgctggtgcagaggaccatagcaaggacc
attatcctgcaggagagcattgggaaggggaggttcggggaggtgtggcggggccgctgg
cgaggagaggaggtggccgttaagatcttctcatctcgggaggagcgctcgtggttccgc
gaggctgagatctaccaaaccgtcatgctgcgccatgagaacatcctgggcttcatcgct
gctgacaacaaagataacggcacgtggacccagctgtggctggtatcagattaccatgag
catggctccctgtttgactacttgaacaggtacacggtgacagtggagggcatgatcaag
ctgtccttgtccacctccagtggcctggctcacctgcacatggagattgtcggcacgcaa
ggtaaaccagccatcgcccaccgcgacctgaagtctaagaacatcctggtgaagaagaat
ggtacctgctgcatcgctgacctgggattggctgtccgccacgactccgccaccgacacc
atcgacatcgcccccaatcacagagtgggaaccaagaggtacatggcccccgaagtcctg
gatgactcaatcaatatgaagcattttgagtcgttcaagcgggcagacatctacgccatg
ggcctggtgttctgggagatcgcacggagatgctcaataggaggtatccacgaggactac
cagctgccctactatgacctggtccagtcagacccctcggtggaagagatgaggagggtg
gtgtgtgaccagaaactacgggccaacatccccaacaggtggcagagctgcgaggttttg
cgggtgatggctaagatcatgagggagtgctggtactccaacggggcggcccgcctcacc
gcgttgcgcatcaagaagtccctgtcccagctcagccagcaggaaggcatcaagatgtaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112227836
Entry
112227836         CDS       T05605                                 

Definition
(RefSeq) TGF-beta receptor type-1-like isoform X1
  KO
K04674  TGF-beta receptor type-1 [EC:2.7.11.30]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04060  Cytokine-cytokine receptor interaction
otw04068  FoxO signaling pathway
otw04144  Endocytosis
otw04218  Cellular senescence
otw04350  TGF-beta signaling pathway
otw04371  Apelin signaling pathway
otw04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112227836
   04350 TGF-beta signaling pathway
    112227836
   04371 Apelin signaling pathway
    112227836
   04068 FoxO signaling pathway
    112227836
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    112227836
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112227836
  09143 Cell growth and death
   04218 Cellular senescence
    112227836
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    112227836
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112227836
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     112227836
Protein kinases [BR:otw01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   112227836
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr TGF_beta_GS Activin_recp Pkinase_fungal APH FTA2 DUF1923
Other DBs
NCBI-GeneID: 112227836
NCBI-ProteinID: XP_024248541
LinkDB
Position
29
AA seq 497 aa
MDAITRCLVLIVLFFGTRIQENDALQCYCQRCLNSTCTTDGLCFVSVRKSGSSITAESSM
CVPENELIPRDRPFICAPSTKDDTGIYPMCCATDWCNKNPDLSVFPVPTVKPVPLGPVAL
AAVIAGPVCVLCFVLMLVFYICHSRAGVHHRVPNEEDPSMNHPFLNVGSTLQDLIYDMTT
SGSGSGLPLLVQRTIARTIILQESIGKGRFGEVWRGKWRDEEVAVKIFSSREERSWFREA
EIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVTVEGMIKLS
LSTASGLAHLHMEIVGTQGKPAIAHRDLKSKNILVKKSGTCCIADLGLAVRHDSATDTID
IAPNHRVGTKRYMAPEVLDDSINMKHFESFKRADIYAMGLVFWEIASRCSLAGIVEDYQL
PYHDLVQSDPSVEEMRRVVCEQKLRPNIPNRWQSCEALRVMAKIMRECWYANGAARLTAL
RIKKTLSQLSQSEGIKM
NT seq 1494 nt   +upstreamnt  +downstreamnt
atggacgcaataacccgttgtctcgtgttaatagtcctgttctttgggactaggattcaa
gaaaatgatgccttgcagtgttactgccagcgatgtctcaactccacgtgcaccacggac
ggcctgtgcttcgtgtccgtcaggaagtctggcagcagcatcaccgccgagagcagcatg
tgtgtcccagagaacgagcttatcccgcgtgaccgccccttcatctgcgcaccctccacc
aaggacgacactggcatctaccccatgtgttgcgccaccgactggtgcaacaagaacccc
gacctcagcgtcttcccagtgccaacagtgaagccggttcccctggggcctgtggcgctg
gcagcggtcatcgcggggcctgtgtgcgtactgtgcttcgtgctgatgctggtcttctac
atctgccacagccgtgcgggcgtccaccaccgcgtacccaacgaggaggacccctccatg
aaccaccccttcctcaatgtgggctccactctccaagacctcatctacgacatgaccacc
tctggctccggctctggtctgcccctgctggtccagaggaccatagcccggaccatcatc
ctccaggagagcatcgggaagggccgcttcggcgaggtgtggcgggggaagtggcgagac
gaagaggtggcggtcaagatcttctcgtcccgtgaggagcgctcgtggttccgcgaggct
gagatctaccagacagtcatgctgcgtcacgagaacatcctgggcttcatcgctgctgac
aacaaagataatgggacatggacccagctgtggctggtatcagactaccatgagcatggc
tctttgtttgactacctgaaccgctacaccgtcaccgtggagggcatgatcaaactttcc
ctgtccactgccagcggcctggcccacctccacatggagatcgttggcacgcaagggaag
ccggccatcgcccacagggacctgaaatctaagaacatcctggtgaagaagagcgggacg
tgctgcatcgctgacctgggcctggctgtgcgccacgactccgccactgacaccatcgac
attgcccccaaccacagagtaggaaccaaaaggtatatggcaccagaggtgctagacgac
tcgataaacatgaagcattttgagtcatttaagagggcagatatctacgccatgggcttg
gttttctgggagatagccagtagatgctctctagcaggcatcgttgaagactaccagctg
ccataccatgacttggtgcagtcagacccttctgtagaggagatgaggagggtggtgtgt
gagcagaagctacggcccaacattccaaaccgttggcagagctgtgaggctctgcgggta
atggctaagatcatgagggaatgctggtatgccaacggagccgcccgcctcactgcgcta
cgcatcaagaagactctttcccagctcagccaatcagagggcatcaagatgtag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112229968
Entry
112229968         CDS       T05605                                 

Definition
(RefSeq) TGF-beta receptor type-2-like isoform X1
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04060  Cytokine-cytokine receptor interaction
otw04068  FoxO signaling pathway
otw04144  Endocytosis
otw04218  Cellular senescence
otw04350  TGF-beta signaling pathway
otw04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112229968
   04350 TGF-beta signaling pathway
    112229968
   04068 FoxO signaling pathway
    112229968
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    112229968
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112229968
  09143 Cell growth and death
   04218 Cellular senescence
    112229968
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    112229968
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112229968
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     112229968
Protein kinases [BR:otw01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   112229968
SSDB
Motif
Pfam: ecTbetaR2 PK_Tyr_Ser-Thr Pkinase Pkinase_fungal
Other DBs
NCBI-GeneID: 112229968
NCBI-ProteinID: XP_024251906
LinkDB
Position
31
AA seq 548 aa
MELLRFSAFWWGTIMFGSILLEQKMASSMTMLKLKRLCNFCDVESTSCTGTGNCMADCSI
TSICPHPEDVCVSIWRKKDDNVTIDTICHNPAHKLHGLVLEDYNNSKCEMRERNNMGSQF
FICSCSEDECNDHLFFTPYSLDSQVVSVILVSLVPLLVLAVLVITSFYWYRIYHQRRAGA
KRKKTPLDFSDAHAIMMDDDGSDSSSTHANNLNHNTELLPIELDAQVGKGRFAEVYKAKL
KQGATGAGEHFETVAVKIFADEEYASWKNEKDIFSDADLRHENVLHFLTAEDHKVEKQYW
LITAYHPRGNLQEYLTRHVISWDDLWVLGGSLARGVAHLHSDHTLCGRYKVPIVHRDIKS
SNILVKGDLTCVLCDFGLGLRLDNSLSVDELANSGQVGTARYMAPEVLESRINLENIESF
KQTDVYSMALVLWEITSRCNAIGEVKDYEPPFGKVREHPCVESMKDSVLRDRGRPEIPNS
WINHPGIQVVCGTIDECWDHDPEARLTAQCVAERFNDMEHPDKLSGRSNSEEKIPQDVSV
TEIEEIEK
NT seq 1647 nt   +upstreamnt  +downstreamnt
atggagctacttcgtttttccgctttctggtggggaacgataatgtttggtagtattctg
ctagaacagaaaatggcctcatcaatgactatgctgaagctgaagcgtctgtgtaayttc
tgtgacgttgagtctaccagctgtacgggcacagggaactgtatggccgactgtagcatc
acatccatctgcccccatccagaggacgtgtgtgtcagcatctggaggaagaaagacgac
aatgtcaccatagacacgatatgccacaacccagcccataagctgcatggtctggtgctg
gaggactataacaacagcaagtgtgagatgagggagaggaataacatgggctcccagttc
ttcatctgctcctgctccgaggacgagtgcaacgaccaccttttcttcaccccctactcc
ctagactcccaggtggtgtcggtgatcctggtcagcctggttcctctgctggttctggcc
gtgctggtcatcacatccttctattggtaccgcatctaccaccagcgccgcgccggtgcc
aagcgcaagaagacgccgctcgacttcagtgatgcccacgccatcatgatggacgacgac
ggctcggacagcagctccacgcacgccaacaacctcaaccacaacacggagctcctcccc
atcgagctggacgcccaggtgggaaagggccgcttcgccgaggtctacaaggccaagctg
aagcagggcgccacgggggctggcgaacacttcgagaccgttgccgtcaaaattttcgca
gacgaggaatatgcctcgtggaagaacgagaaggacatcttctcggacgccgacctgcgc
cacgagaacgtcctgcacttcctgaccgcagaggaccacaaggtggagaaacagtattgg
ctgatcacggcctaccacccccggggcaacctccaggagtacctgacgcgccacgtcatc
agctgggacgacctgtgggtgctgggcgggtcgctggcaaggggcgtggcccacctacat
agtgaccacacgttgtgtggacgctacaaggtgcccattgtccaccgggacatcaagagc
tccaacatcctggtgaagggggacctcacctgtgtcctgtgtgacttcggactgggtctg
cgtctggacaactcgctgtctgtggacgagctggccaacagtggacaggtgggcactgcc
aggtacatggcccctgaggtgctggagtccagaatcaacctggaaaacattgagtcgttc
aagcagacagacgtttactccatggccctggtactgtgggagatcacctccaggtgcaat
gccattggagaggtgaaggactacgagccgcccttcggtaaggtgagggagcacccgtgt
gtggagagtatgaaggacagtgttctcagagacagagggaggccagagatccccaacagc
tggatcaaccacccaggcatccaggtggtgtgcggcaccatagacgagtgctgggaccac
gaccccgaggccaggctaactgctcagtgtgtggccgaacgcttcaatgacatggagcac
ccagacaagctgtctggacgcagcaattccgaggagaagatcccccaggatgtctctgtg
acggagattgaagagattgagaagtag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112239013
Entry
112239013         CDS       T05605                                 

Definition
(RefSeq) TGF-beta receptor type-2-like
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04060  Cytokine-cytokine receptor interaction
otw04068  FoxO signaling pathway
otw04144  Endocytosis
otw04218  Cellular senescence
otw04350  TGF-beta signaling pathway
otw04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112239013
   04350 TGF-beta signaling pathway
    112239013
   04068 FoxO signaling pathway
    112239013
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    112239013
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112239013
  09143 Cell growth and death
   04218 Cellular senescence
    112239013
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    112239013
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112239013
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     112239013
Protein kinases [BR:otw01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   112239013
SSDB
Motif
Pfam: ecTbetaR2 Pkinase PK_Tyr_Ser-Thr
Other DBs
NCBI-GeneID: 112239013
NCBI-ProteinID: XP_024263294
LinkDB
Position
3
AA seq 594 aa
MGCWRFSAVNIVLLSFCLPILSFTHIKTNLCKWCDYSSPICEDSVCYTNCSLSSFCTLSE
EICIAIWRKDNESMSVKTLCHQPQQPLENIMLSNYSSNECVMAPQPSEDGVLFVCGCLGE
HECNDKLIFDKGSNDFSKLKSKDVIPVVVISLVPPCLVAIIATMAFYLYRTRQPGKQPKD
WAPKRTHYQALDIPEGLSGEAITGGEDCHGKLSAINSDATSDMSPVRAHNFNHSTEQLPI
QLEALVGKGRFAEVWRARLHHQAAGPQYETVAVKIFPSVEYVSWSNERAIFSDANLEHEN
VVQFLTAEERGPSGSPQRQYWLVMAYHGLGNLQDFLAGHVLSWAELCAMAGSVARGLAHL
HSDTTPCGIPKVPVAHRDLKSSNIVVKSRRECALCDFGLALRLDLSLTVDDFANSGQVGT
ARYMAPEVLESRVNLEDLEAFKQMDVYSMALVLWEMVSRCEVIGEVKSYEPPFGSKVCDQ
PCVDSMRDLVLRDRGRPEIPTSWTTHQGMNLLCATITECWDHDPEARLTAHCVVERFGSL
EEEMEQEVLEAVNNSQECPPSDTFPDSTGCDVDPLAPETDTEGTLIPGQISEIL
NT seq 1785 nt   +upstreamnt  +downstreamnt
atggggtgctggagattctcggcagtgaatattgttcttctgtctttctgtcttcctatc
ctctccttcacacacatcaagaccaacctgtgtaagtggtgtgactactccagccctatc
tgtgaggacagtgtgtgttataccaactgctccctctcctccttctgtactctgagtgaa
gagatttgcattgcaatatggcggaaggacaatgagagtatgagtgtgaagacgttatgc
caccagccccagcagccactggagaatatcatgttgtcaaactactcctccaacgagtgt
gtgatggctcctcagccctctgaggatggggtcctgttcgtttgtggctgcctgggagaa
cacgagtgcaacgataagcttatattcgacaagggctccaatgatttttccaagctcaag
agtaaagatgtgattccagtggtggtgatcagcctggtccctccctgtttagtggctatc
atcgctaccatggcgttctacctgtaccgtaccagacagcccggcaagcagcccaaagac
tgggctcccaaacgcacacactaccaggccttggacatcccagagggactcagtggggag
gccatcactggcggtgaggactgccatggcaagctgtcagccatcaatagcgacgctaca
tctgacatgtctcccgtccgggcccataacttcaaccacagcacggagcagctacccatc
cagctagaagccttggtggggaaagggaggtttgctgaggtgtggcgggccaggctccac
caccaggcagctggtcctcagtatgagacggtggcagtgaagatcttcccgtctgtggag
tatgtgtcctggagcaacgagagggccatcttctctgacgccaacctggagcatgaaaat
gtggttcaattcctgacagcagaggagcgagggccctccggctcccctcagaggcagtac
tggctggtcatggcctaccacggcctgggaaacctacaggacttcctggcgggccatgtg
ttgagctgggctgagctgtgtgctatggctgggtcggtggctcgaggattggcccacctc
cacagtgacaccaccccttgtgggatccccaaggtgccggtggcccaccgtgatctgaag
agcagcaacatcgtggtaaaaagccggagagagtgtgccctctgtgactttggtctggct
ctgagactggacctctccctcaccgtggatgactttgccaacagtggccaggtgggtaca
gctcgctacatggcccctgaggtgttggagtccagagtaaatctggaggatctggaggcc
tttaaacagatggatgtatactccatggccctggtcctctgggaaatggtgtcccgctgt
gaagtcataggagaggttaagagttacgagccgccgtttggctctaaggtgtgtgaccag
ccgtgtgtggacagcatgagggacctggtcctgagggacagaggcagacctgagataccc
accagctggacaacacatcaggggatgaatctgctgtgtgccaccatcacggagtgttgg
gaccatgacccagaggccaggctcacagcccactgtgtggtggagcgctttggaagtcta
gaagaggagatggagcaggaggtgttagaagctgtcaacaacagccaggagtgtcctccc
tctgacaccttccctgactccaccggctgcgatgtggaccctctggcccctgaaacagat
acagaggggaccctcatccctgggcagataagtgagatattataa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112239812
Entry
112239812         CDS       T05605                                 

Gene name
tgfbr2
Definition
(RefSeq) TGF-beta receptor type-2
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04060  Cytokine-cytokine receptor interaction
otw04068  FoxO signaling pathway
otw04144  Endocytosis
otw04218  Cellular senescence
otw04350  TGF-beta signaling pathway
otw04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112239812 (tgfbr2)
   04350 TGF-beta signaling pathway
    112239812 (tgfbr2)
   04068 FoxO signaling pathway
    112239812 (tgfbr2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    112239812 (tgfbr2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112239812 (tgfbr2)
  09143 Cell growth and death
   04218 Cellular senescence
    112239812 (tgfbr2)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    112239812 (tgfbr2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112239812 (tgfbr2)
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     112239812 (tgfbr2)
Protein kinases [BR:otw01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   112239812 (tgfbr2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase ecTbetaR2 Pkinase_fungal Cep57_CLD DcuC
Other DBs
NCBI-GeneID: 112239812
NCBI-ProteinID: XP_024263986
LinkDB
Position
Unknown
AA seq 526 aa
MFVCLSLSITSIISIISVISVISRRKNDSNYSIETLCHDPSKPLYGVELDDYNSSTCTMK
EKKSSGGPLFICSCTEEECNDNLAFAPVVGPTIEPPVVSIVLISLLPLLVLVVVVITMFY
WYRVQRHRKLSQKQWDSKKSKRKGLDCSIMMDDDGSDSSSTHANNLNHNTEPLPIELDLQ
VGKGRFAEVFKAKLRQPGSSSDQYETVAVKIFPEEEYASWKNEKDIFSDIDLRHDNVLHF
LTAEERKMSKQYWLITAFHPRGNLQEYLTRNLVSWEDLRGLGGSLACGVAHLHSDHTACG
RPKVPIVHRDLKSSNILVKQDLTCCLCDFGLGLRLDNTMTVDDLANSGQVGTARYMAPEV
LESRLNLENIESFKQTDVYSMALVLWEITSRCHAIGEVKDYEPPYGCKVQMHPGVESMKD
HLLRDRGRPEIPDSWINHQGIAIVCGSIEECWDHDPEARLTAQCVAERFSEIEDEMEKLS
SRSSSDEKIPAEEQKIPTRPEEERQTIAERIEEIKVAVESSVSDEK
NT seq 1581 nt   +upstreamnt  +downstreamnt
atgtttgtgtgtctgtctctctccattacctccattatctccattatctccgttatctcc
gttatctccaggaggaagaatgacagtaactacagcatcgagactctgtgtcatgacccc
tccaagcctctgtacggcgtcgagctggatgactacaacagctctacgtgtaccatgaaa
gagaagaagagctctggcggaccgttgttcatctgctcctgtactgaggaggagtgtaac
gataacctggccttcgctcccgtggtcggcccgaccatcgagcccccggtggtatcgatc
gtcctgatcagcctgttgcccttactggtcctagtggtagtagtcatcactatgttctat
tggtaccgggtccaacgccatcgcaaactcagccagaaacaatgggacagcaagaagtcc
aaacgcaaaggtctggactgcagcatcatgatggacgacgatggatcagacagcagctca
acgcacgccaacaacctcaaccacaacactgaacccctacccatcgagctggacctgcag
gtgggtaaggggcgcttcgctgaggtgttcaaggccaagctgaggcagcccggctcctcg
tctgaccagtatgagacggtggccgtgaagatcttccctgaggaagagtacgcatcgtgg
aagaacgagaaggacatcttctctgacatcgaccttcgccacgacaacgtcctccacttc
ctcacagcagaggagagaaagatgtcgaagcagtactggctgatcacagccttccacccc
cgaggaaaccttcaggagtacctgacccgtaacctggtctcctgggaggatctacggggt
ctgggcgggtccctggcctgcggggtggcacaccttcacagtgaccacacggcctgcggg
cgacccaaagtgcccatcgtacaccgcgacctgaagagctctaacatcctggtgaagcag
gatctgacctgttgtctgtgtgactttggactggggctcagactggataacaccatgaca
gtggatgatctcgcaaacagcggacaggtgggcacagccaggtacatggctcctgaagtg
ttggagtccaggctgaacctggagaacattgagtcgttcaagcagacagatgtttattct
atggctctggtgttgtgggagatcacctcccgctgtcatgccatcggagaggtgaaggac
tatgaacctccatatggctgtaaagttcagatgcatcctggtgtggagagcatgaaggat
cacctcctcagagacagaggaagacctgagatcccagacagctggatcaaccaccagggc
atagccatagtgtgcggctccatagaggagtgttgggaccacgacccggaggccaggctc
acagcccagtgcgtggccgaacgcttcagcgagatagaagacgagatggagaaactgtcc
agccgcagcagctccgacgagaagataccagcggaggaacagaagataccgacaagaccc
gaagaagaacgacagacgatagcagaacggatagaagagatcaaagtagcggtggagagc
tctgtgagcgatgagaagtga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112241489
Entry
112241489         CDS       T05605                                 

Definition
(RefSeq) TGF-beta receptor type-2-like
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04060  Cytokine-cytokine receptor interaction
otw04068  FoxO signaling pathway
otw04144  Endocytosis
otw04218  Cellular senescence
otw04350  TGF-beta signaling pathway
otw04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112241489
   04350 TGF-beta signaling pathway
    112241489
   04068 FoxO signaling pathway
    112241489
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    112241489
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112241489
  09143 Cell growth and death
   04218 Cellular senescence
    112241489
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    112241489
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112241489
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     112241489
Protein kinases [BR:otw01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   112241489
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase ecTbetaR2 DcuC SIT
Other DBs
NCBI-GeneID: 112241489
NCBI-ProteinID: XP_024265363
LinkDB
Position
Unknown
AA seq 439 aa
MTNILNMIGCVSPDGMFQPSFSLNKLCKFCDVESSSCNGTGSCLSNCSITSICRLEQEVF
AHLEEELAGPLFICFCTEEECNDNLAFAPVVGPTIEPPVVSIVLISLLPLLVLVVVVITM
FYWYRVQRHRKLSQKQWDSKKSKRKGLDCSIMMDDDGSDSSSTHANNLNHNTEPLPIELD
LQVGKGRFAEVFKAKLRQPGSSSDQYETVAVKIFPEEEYASWKNEKDIFSDIDLRHDNVL
HFLTAEERKMSKQYWLITAFHPRGNLQEYLTRNLVSWEDLRGLGGSLACGVAHLHSDHTA
CGRPKVPIVHRDLKSSNILVKQDLTCCLCDFGLGLRLDNTMTVDDLANSGQVGTARYMAP
EVLESRLNLENIESFKQTDVYSMALVLWEITSRCHAIGGTLTHSLTHSLTHSLTHSFTYT
HTHTLTHRVTDTLTHTLTE
NT seq 1320 nt   +upstreamnt  +downstreamnt
atgacaaacatattgaatatgattggttgtgtttctccagatgggatgttccagccgtcc
ttcagtctcaacaagttgtgtaagttctgtgacgtggagtcttcatcctgcaacggaaca
ggaagctgcctctcaaactgctccatcacctccatctgtcgtctggagcaggaagtcttc
gcgcatctagaagaagagcttgcgggaccgttgttcatctgcttctgtactgaggaggag
tgtaacgataacctggccttcgctcccgtggtcggcccgacaatcgagcccccggtggta
tcgatcgtcctgatcagcctgttgcccttactggtcctagtggtagtagtcatcactatg
ttctattggtaccgggtccaacgccatcgcaaactcagccagaaacaatgggacagcaag
aagtccaaacgcaaaggtctggactgcagcatcatgatggacgacgatggatcagacagc
agctcaacgcacgccaacaacctcaaccacaacactgaacccctacccatcgagctggac
ctgcaggtgggtaaggggcgcttcgctgaggtgttcaaggccaagctgaggcagcccggc
tcctcgtctgaccagtatgagacggtggccgtgaagatcttccctgaggaagagtacgca
tcgtggaagaacgagaaggacatcttctctgacatcgaccttcgccacgacaacgtcctc
cacttcctcacagcagaggagagaaagatgtcgaagcagtactggctgatcacagccttc
cacccccgaggaaaccttcaggagtacctgacccgtaacctggtctcctgggaggatcta
cggggtctgggcgggtccctggcctgcggggtggcacaccttcacagtgaccacacggcc
tgcgggcgacccaaagtgcccatcgtacaccgcgacctgaagagctctaacatcctggtg
aagcaggatctgacctgttgtctgtgtgactttggactggggctcagactggataacacc
atgacagtggatgatctcgcaaacagcggacaggtgggcacagccaggtacatggctcct
gaagtgttggagtccaggctgaacctggagaacattgagtcgttcaagcagacagatgtt
tattctatggctctggtgttgtgggagatcacctcccgctgtcatgccatcggaggtaca
ctcacccactcactcactcactcactcactcattcactcactcactcattcacttacaca
cacactcacacactcactcacagagttacagacacactcacacacacactcacagagtaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112260530
Entry
112260530         CDS       T05605                                 

Definition
(RefSeq) TGF-beta receptor type-1-like
  KO
K04674  TGF-beta receptor type-1 [EC:2.7.11.30]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04060  Cytokine-cytokine receptor interaction
otw04068  FoxO signaling pathway
otw04144  Endocytosis
otw04218  Cellular senescence
otw04350  TGF-beta signaling pathway
otw04371  Apelin signaling pathway
otw04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112260530
   04350 TGF-beta signaling pathway
    112260530
   04371 Apelin signaling pathway
    112260530
   04068 FoxO signaling pathway
    112260530
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    112260530
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112260530
  09143 Cell growth and death
   04218 Cellular senescence
    112260530
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    112260530
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112260530
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     112260530
Protein kinases [BR:otw01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   112260530
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr TGF_beta_GS Activin_recp Pkinase_fungal APH FTA2
Other DBs
NCBI-GeneID: 112260530
NCBI-ProteinID: XP_024291476
LinkDB
Position
10
AA seq 501 aa
MTMDTIRCYFIFLVMFLGAGIHISIALQCDCQWCSNSTCYTDGLCFVSFVKSGSKMVAQG
SRCLLEADLIPKDRPFFCAPSKKENTGVVPVCCNRDMCNKDLNPEDYSETFPTARTPPLS
PVTLAAVIAGPVCMLCFVLLLVFYVCHSRSIIHHRVPNEEDPAMDHPFLADGHTLKNLIY
DMTTSGSGSGLPYGWQRTIARTIILQESIGKGRFGEVWRGRWRGEEVAVKIFSSREERSW
FREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVTVEGM
IKLSLSTSSGLAHLHMEIVGTQGKPAIAHRDLKSKNILVKKNGTCCIADLGLAVRHDSAT
DTIDIAPNHRVGTKRYMAPEVLDDSINMKHFESFKRADIYAMGLVFWEIARRCSIGGIHE
DYQLPYYDLVQPDPSVEEMRRVVCDQKLRANIPNRWQSCEVLRVMAKIMRECWYSNGAAR
LTALRIKKSLSQLSQQEGIKM
NT seq 1506 nt   +upstreamnt  +downstreamnt
atgacaatggatacaatacgctgttatttcatatttttggtcatgtttcttggagcagga
attcacatatcaatcgcgttgcagtgcgactgccagtggtgtagtaacagtacctgctac
acggatggcctgtgctttgtgtccttcgtcaagtcgggcagtaagatggtggcacagggg
agcaggtgtttactggaagcagacctcatccctaaagacaggccgttcttctgcgcccct
tccaagaaggagaacaccggtgttgtccctgtctgctgcaacagagacatgtgtaacaaa
gacctcaacccagaagactactcagagacattccccacagcccgtacccctccactgagc
ccagtgaccctggcggccgtcatcgcggggccggtgtgtatgctgtgtttcgtgctgctg
ctggtgttctatgtgtgtcacagccgctcgattatccaccaccgcgtgcccaacgaggaa
gaccctgccatggaccaccccttcctggccgacggccataccctcaaaaacctcatctac
gacatgaccacctccggctccggatcaggtctcccctatgggtggcagaggaccatagcc
aggaccatcatcctgcaggagagcatcggaaagggaaggttcggggaggtgtggcggggc
cgctggcgaggagaggaggtggccgttaagatcttctcatcccgggaggagcgctcgtgg
ttccgtgaggccgagatctaccagacagtcatgcttcgccacgaaaacatcctgggcttt
attgccgctgacaacaaagataacggcacgtggacccaattgtggctggtatcagattac
catgagcacggctccctttttgactacctgaacaggtacacggtgacagtggagggcatg
atcaagctgtccctgtccacctccagcggcctggctcacctgcacatggagattgttggc
acgcaaggtaaacctgccatcgcccaccgcgacctgaagtctaagaacatcctggtgaag
aagaatggtacttgctgcatcgctgacctgggattggctgtccggcatgactctgccact
gacaccatcgacatcgcccccaatcacagagttggaaccaagaggtacatggcccctgaa
gtcctggatgactccataaacatgaagcattttgagtcattcaagcgggcagatatctac
gccatgggcctggtgttttgggagatcgcacggagatgctcaataggaggtatccacgag
gactaccagctgccctactatgacctggtccagccagacccctcggtggaggagatgagg
agggtggtgtgtgaccagaaactacgggccaacatccccaacaggtggcagagctgcgag
gtgctgcgagtgatggctaagatcatgagggagtgttggtactccaatggggcggcccgc
ctcaccgcgctgcgcatcaagaagtccctgtcccagctcagccagcaagagggcatcaag
atgtag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112264984
Entry
112264984         CDS       T05605                                 

Definition
(RefSeq) TGF-beta receptor type-2-like
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04060  Cytokine-cytokine receptor interaction
otw04068  FoxO signaling pathway
otw04144  Endocytosis
otw04218  Cellular senescence
otw04350  TGF-beta signaling pathway
otw04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112264984
   04350 TGF-beta signaling pathway
    112264984
   04068 FoxO signaling pathway
    112264984
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    112264984
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112264984
  09143 Cell growth and death
   04218 Cellular senescence
    112264984
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    112264984
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112264984
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     112264984
Protein kinases [BR:otw01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   112264984
SSDB
Motif
Pfam: ecTbetaR2 PK_Tyr_Ser-Thr Pkinase Pkinase_fungal
Other DBs
NCBI-GeneID: 112264984
NCBI-ProteinID: XP_024297701
LinkDB
Position
13
AA seq 571 aa
MELLRVSAFWCGTILFGSVLLEQMGPSSMNMLKLKRLCKFCDVESTSCAGTGSCMADCSI
TSICPHPEDVCVSIWRKKDDNVTIDTICHNPAHKLHGLVLEDYNNSKCEMRERNGMGSQF
FICSCSEDECNNHVFFTPYSLDPQVVSVILVSLVPLLVLAMLVITSFYWYRIYHQRHAGA
KRKKTPLDFSDARAIMMDDDGSDSSSTHANNLNHNTELLPIELDAQVGKGRFAEVYKAKL
KQGATGAGEPFETVAVKIFADEEYASWKNEKDIFSDADLRHENVLHFLTAEERKVEKQYW
LITAYHPRGNLQEYLTRHVISWDDLWALGGSLARGVAHLHSDHTLCGRYKVPIVHRDIKS
SNILVKGDLTCVLCDFGLGLRLDNSLSVDELANSGQVGTARYMAPEVLESRINLENIESF
KQTDVYSMALVLWEITSRCNAIGEVKDYEPPFGKVREHPCVESMKDSVLRDRGRPEIPSS
WINHPGIQVVCGTIDECWDHDPEARLTAQCVAERFNDMEHPDKLSERSNSEEKIPQDISV
TEFEEIEKKEVCLRNYNAPAEEAENYNQPSS
NT seq 1716 nt   +upstreamnt  +downstreamnt
atggagctacttcgggtttctgctttctggtgtggaacgatactctttggtagtgttctg
ctagaacagatggggccctcgtcaatgaacatgctgaagctgaagcgtctgtgtaagttc
tgtgacgtggagtctaccagctgcgcgggcacagggagctgtatggccgactgtagcatc
acatccatctgcccccatccagaggatgtgtgtgtcagcatctggaggaagaaagacgac
aacgtcaccatagacacgatatgccacaacccagcccataagctgcatggtctggtgctg
gaggactataacaacagcaagtgtgagatgagggagaggaatggcatgggctcccagttc
ttcatctgctcttgctccgaggacgagtgcaacaaccatgtgttcttcactccctactct
cttgacccccaggtggtgtcggtgatcctggtcagcctggttcctctgctggttctggcc
atgctggtcatcacatccttctattggtaccgcatctaccaccagcgccacgccggtgcc
aagcgcaagaagacgcctctcgacttcagcgacgcccgcgccatcatgatggatgacgat
ggctcggacagcagctccacgcacgccaacaacctcaaccacaacacggagctcctcccc
attgagctggacgcccaggtgggcaagggccgcttcgccgaggtctacaaggccaagctg
aagcagggcgccacgggagccggtgagcccttcgagaccgtcgccgtcaagattttcgcc
gatgaagagtatgcctcgtggaagaacgagaaggacatcttctcggacgctgacctgcgc
cacgagaacgtcctgcacttcctgacagcggaggaacgtaaggtggagaaacagtattgg
ctgatcacggcctaccacccccggggcaacctccaggagtacctgacgcgtcacgtcatc
agctgggacgacctgtgggcgctgggcgggtctctggcgagaggcgtggcccacctgcac
agtgaccacacgttgtgtggacgctacaaggtgccaatcgtccaccgggacatcaagagc
tccaacatcctggtgaagggggacctcacctgcgtcctgtgtgacttcggcctgggtctg
cgtctggacaactcgctgtccgtggacgagctggccaacagtggacaggtgggcactgcc
aggtacatggcccctgaggtgctggagtccaggatcaacctggagaacattgagtcgttc
aagcagacagatgtctactccatggccctggtactgtgggagatcacctccaggtgcaat
gccattggagaggtaaaggactacgagcccccattcggtaaggtgagggagcacccgtgt
gtggagagtatgaaggacagcgtactcagagacaggggacgaccagagatccccagcagc
tggatcaaccacccaggcatccaggtggtgtgtggcacgatagacgagtgctgggaccac
gaccccgaggccaggctgactgcacagtgtgtggccgaacgcttcaatgacatggagcac
ccagacaagctgtctgaacgcagcaactcagaggagaagatcccccaggacatctctgtg
acggagtttgaagagattgagaagaaggaagtatgcctcagaaactacaatgcccctgcc
gaggaggctgagaactacaatcaaccaagcagctga

DBGET integrated database retrieval system