KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112215306
Entry
112215306         CDS       T05605                                 

Definition
(RefSeq) phosphoenolpyruvate carboxykinase, cytosolic [GTP]-like
  KO
K01596  phosphoenolpyruvate carboxykinase (GTP) [EC:4.1.1.32]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw00010  Glycolysis / Gluconeogenesis
otw00020  Citrate cycle (TCA cycle)
otw00620  Pyruvate metabolism
otw01100  Metabolic pathways
otw03320  PPAR signaling pathway
otw04068  FoxO signaling pathway
otw04910  Insulin signaling pathway
otw04920  Adipocytokine signaling pathway
Module
otw_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:otw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    112215306
   00020 Citrate cycle (TCA cycle)
    112215306
   00620 Pyruvate metabolism
    112215306
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112215306
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112215306
   04920 Adipocytokine signaling pathway
    112215306
   03320 PPAR signaling pathway
    112215306
Enzymes [BR:otw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.32  phosphoenolpyruvate carboxykinase (GTP)
     112215306
SSDB
Motif
Pfam: PEPCK_GTP PEPCK_N
Other DBs
NCBI-GeneID: 112215306
NCBI-ProteinID: XP_024229996
LinkDB
Position
16
AA seq 635 aa
MSCLLLGLIRRRGGVGTSVGVRSLASIPSLPPAVADFVKRAVDECKPANVHVVTGSAEES
AHILAGLEKDGMVKRLPKYENCWLARTDPKDVARVESKTVIVTKNQRDTIPIPDGGAKSQ
LGSWMSEGDFQKARQDRFPGCMAGRTMYVIPFSMGPVGSPLSKFGVQVTDSPYVVASMGI
MTRMGTPVMDKLAQGAEFVRCQHSLGRPLPLKAPLVNSWPCNPEKVLISHLPDTRQILSF
GSGYGGNSLLGKKCFALRIASRIAKDEGWLAEHMLILGITNPQGVKRYVAAAFPSACGKT
NLAMMKPALPGWTVECVGDDIAWMKFDSQGKLRAINPENGFFGVAPGTSLKTNPHAMATI
AKNTVFTNVGETSDGGVWWEGLDPPAAGVSLTDWHGKSWKAGDSGPCAHPNSRFCTPAAQ
CPIIDPQWESDEGVPIDAIIFGGRRPEGVPLVYESFNWRHGVFVGASMRSEATAAAEYKG
KVIMHDPFAMRPFFGYNFGDYLAHWLSMETRKGATHLPKIFHVNWFRKDPTSGSFLWPGF
GDNARVLEWIFKRCSREREDEAAKKSMVGWVPLEGAINLQGLGSEVDMGALFDLPKAFWE
KETQELKAYFTQQVGADLPQQVEGELKALEDRIRN
NT seq 1908 nt   +upstreamnt  +downstreamnt
atgtcgtgccttttgcttggacttatcagaagacggggtggagtggggacatccgtgggg
gtccgctccttagcctcgatcccctctctgcccccagcggtggctgactttgtgaagagg
gccgtggatgagtgcaagcctgccaatgtgcatgtggtgacggggagcgcggaggagtcc
gcccacatcctagctggcctggagaaagacggcatggtgaagaggctacccaagtatgag
aactgctggctggcacgtacagaccccaaggacgtggctcgggtggagagtaagactgtg
atcgtcaccaagaaccagagggacaccatccctatccccgatgggggggctaagagccag
ctgggcagctggatgagcgagggtgacttccagaaggccagacaggaccgcttcccaggc
tgcatggcaggtcgaaccatgtacgtgatccccttcagcatgggcccggtgggctctccg
ctgtctaagtttggcgtgcaggtgacagactccccctacgtggtggccagtatgggcatt
atgacgcgcatgggcacccctgtcatggacaaactggcacagggggcggagtttgtacgc
tgccagcactccctcggtcgacccctcccactgaaagctcccctggtcaactcgtggccg
tgtaacccagagaaggtgctgatctcccacctgccagacaccaggcagatcctgtcgttc
ggcagtggctacggaggcaactccctgctggggaagaagtgcttcgccctgaggatcgcc
tcgcgcatcgccaaggacgagggctggctggccgaacacatgctgatcctgggcatcact
aatcctcagggagtgaagcgctacgtggcggcggcatttcccagtgcctgtgggaaaact
aacctggccatgatgaagcctgcgctgcctggctggactgtggagtgtgtaggagacgac
atcgcctggatgaagttcgacagtcagggtaaactcagggcaatcaacccagagaacggc
tttttcggtgtggctcccggcacgtccctgaagaccaaccctcatgccatggcgaccatc
gccaaaaacactgtgttcaccaatgtgggtgagaccagtgacggaggggtgtggtgggag
ggactggacccccctgccgcaggggtctccctgaccgactggcacggcaaatcctggaaa
gcaggagactctggcccgtgtgctcatcccaactccaggttctgtaccccggcggcccag
tgccccatcatcgacccccagtgggagagtgacgagggtgtgcccatcgatgccatcatc
ttcgggggcaggaggccagagggagtccctctggtgtacgagtcgtttaactggcgccac
ggtgtgtttgtaggagcctctatgaggtctgaggccacagcagctgctgagtacaaaggc
aaggttatcatgcacgaccccttcgccatgcgccccttcttcggctacaattttggtgac
tacctagcccactggctgagcatggagacccgcaagggcgccacccacctgcccaagatc
ttccatgtcaactggttccggaaggaccccacgtcgggctccttcctctggccgggtttc
ggtgacaacgcccgcgttctggagtggatcttcaagcgctgcagccgtgagagggaggac
gaggcggccaagaagagcatggtgggctgggtgccactggagggagccatcaacctgcag
ggactgggcagcgaggtggacatgggtgccctcttcgacctgcccaaggccttctgggag
aaggagacccaggagctgaaggcgtactttacccagcaggtgggagccgacctcccccaa
caggtggagggagagctgaaggctctggaggacaggatcaggaattga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112227813
Entry
112227813         CDS       T05605                                 

Definition
(RefSeq) phosphoenolpyruvate carboxykinase, cytosolic [GTP]-like isoform X1
  KO
K01596  phosphoenolpyruvate carboxykinase (GTP) [EC:4.1.1.32]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw00010  Glycolysis / Gluconeogenesis
otw00020  Citrate cycle (TCA cycle)
otw00620  Pyruvate metabolism
otw01100  Metabolic pathways
otw03320  PPAR signaling pathway
otw04068  FoxO signaling pathway
otw04910  Insulin signaling pathway
otw04920  Adipocytokine signaling pathway
Module
otw_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:otw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    112227813
   00020 Citrate cycle (TCA cycle)
    112227813
   00620 Pyruvate metabolism
    112227813
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112227813
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112227813
   04920 Adipocytokine signaling pathway
    112227813
   03320 PPAR signaling pathway
    112227813
Enzymes [BR:otw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.32  phosphoenolpyruvate carboxykinase (GTP)
     112227813
SSDB
Motif
Pfam: PEPCK_GTP PEPCK_N
Other DBs
NCBI-GeneID: 112227813
NCBI-ProteinID: XP_024248492
LinkDB
Position
29
AA seq 638 aa
MSCLLLGVIRRRGGVGASVGVRSLASIPSLPPAVADFVKGAVDECKPANVHVVTGSAEES
AHILAGLEKEGMVKKLPKYENCWLARTDPKDVARVESKTVIVTKNQRDTIPTPGGGAKSQ
LGSWMSEGDFQKARKDRFPGCMAGRTMYVIPFSMGPVGSPLSKFGVQVTDSPYVVASMGI
MTRMGTPVMDKLSQGAEFVRCQHSLGQPLPLKAPLVNSWPCSPEKVLISHLPDTRQILSF
GSGYGGNSLLGKKCFALRIASRIAKDEGWLAEHMLILGITNPRGVKRYVAAAFPSACGKT
NLAMMKPALPGWTVECVGDDIAWMKFDSQGKLRAINPENGFFGVAPGTSLKTNPHAMATI
AKNTVFTNVGETSDGGVWWEGLDPPAAGVSLTDWHGKSWKAGDSAPCAHPNSRFCTPAAQ
CPIIDPQWESDEGVPIDAIIFGGRRPEGVPLVYESFSWRHGVFVGASMRSEATAAAEYKG
KVIMHDPFAMRPFFGYNFGDYLAHWLSMETRKAPTHLPKIFHVNWFRKDPTSGSFLWPGF
GDNARVLEWIFKRCGREREDEAAKKSLVGWVPQEGAINLQGLGSKVDMGALFDLPKAFWE
KETQELRAYFTQQVGADLPQQVEGELKALEVRVRNGEA
NT seq 1917 nt   +upstreamnt  +downstreamnt
atgtcgtgtcttttgcttggagttatcagaagacggggtggcgtgggggcatctgtgggg
gtccgctccctggcctcgatcccctctctgcccccagcggtggctgactttgtgaagggg
gcggtggatgagtgcaagcctgccaatgtgcatgtggtgacggggagtgcagaagagtcg
gcccacatcctagctggcctggagaaggagggcatggtgaagaagctaccgaagtatgag
aactgctggctggcacgcacagaccccaaggatgtggctcgcgtggagagtaagacggtg
atcgtcaccaagaaccagagggacaccatccccacccccggtgggggggctaagagccag
ctgggcagctggatgagtgagggtgacttccagaaggccaggaaggaccgcttcccaggc
tgcatggcaggtcgaaccatgtatgtgattcctttcagtatgggcccggtgggctctccg
ctgtctaagtttggcgtgcaggtgacggactcgccctacgtggtggccagcatgggcata
atgacacgcatgggcaccccagtcatggacaagctgtcacagggagcagagtttgtgcgc
tgccagcactcccttgggcaacctctcccactgaaagctcccctggtcaactcgtggccg
tgtagcccagagaaggtgctgatctcccacctgccagacaccaggcagatcctgtctttc
ggcagcggctacggaggcaactctctgctgggcaagaagtgcttcgctctgcggatcgcc
tcgcgcatcgccaaggatgagggctggctggccgaacacatgctgatcctgggcatcacc
aatcctcggggagtgaagcgttacgtggcggcggcgtttccaagtgcttgtgggaaaacc
aacctggccatgatgaagcctgcgctgcctggctggactgtggagtgtgtgggagacgac
atcgcctggatgaagtttgacagccagggtaaactcagggccatcaacccagagaacggc
tttttcggcgtggctcctggcacgtccctgaagaccaaccctcacgccatggcgaccatc
gccaaaaacacagtgttcaccaacgtgggcgagaccagcgacggaggggtatggtgggag
ggactggacccccctgctgcaggggtctccctgaccgactggcatggaaaatcctggaaa
gcaggagactctgccccgtgtgcccaccccaactccaggttctgtaccccggcggcccag
tgtcccattatcgacccccagtgggagagtgacgagggagtgcccatcgatgccatcatc
ttcgggggcagaaggccagagggtgtcccactggtgtatgagtcgtttagctggcgtcac
ggtgtgtttgtgggagcctctatgaggtctgaggccacagcagccgctgagtacaaaggc
aaggttatcatgcatgaccccttcgccatgcgccccttctttggctacaacttcggtgac
tacctggcccactggctcagcatggagacccgcaaggcccccacccacctgcccaagatc
ttccatgtcaactggttccgtaaggaccccacgtcgggctccttcctctggccaggcttc
ggggacaatgcacgcgtgctggagtggatcttcaagcgttgcggccgcgagagggaggac
gaggcagcaaagaagagcttggtgggctgggtgccacaggagggagccatcaacctgcag
ggcctgggcagcaaagtggacatgggggccctcttcgacctgcccaaggccttctgggag
aaggagacccaggagctgcgggcgtactttacccagcaggtgggagccgacctcccccaa
caggtggagggagagctgaaggctctggaggtcagggtcaggaatggagaggcatag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112266975
Entry
112266975         CDS       T05605                                 

Gene name
pck1
Definition
(RefSeq) phosphoenolpyruvate carboxykinase, cytosolic [GTP]
  KO
K01596  phosphoenolpyruvate carboxykinase (GTP) [EC:4.1.1.32]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw00010  Glycolysis / Gluconeogenesis
otw00020  Citrate cycle (TCA cycle)
otw00620  Pyruvate metabolism
otw01100  Metabolic pathways
otw03320  PPAR signaling pathway
otw04068  FoxO signaling pathway
otw04910  Insulin signaling pathway
otw04920  Adipocytokine signaling pathway
Module
otw_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:otw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    112266975 (pck1)
   00020 Citrate cycle (TCA cycle)
    112266975 (pck1)
   00620 Pyruvate metabolism
    112266975 (pck1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112266975 (pck1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112266975 (pck1)
   04920 Adipocytokine signaling pathway
    112266975 (pck1)
   03320 PPAR signaling pathway
    112266975 (pck1)
Enzymes [BR:otw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.32  phosphoenolpyruvate carboxykinase (GTP)
     112266975 (pck1)
SSDB
Motif
Pfam: PEPCK_GTP PEPCK_N
Other DBs
NCBI-GeneID: 112266975
NCBI-ProteinID: XP_024300719
LinkDB
Position
2
AA seq 625 aa
MPPQLQSQNKAGVRVVQGDLGALSPAVKEFVETNINLCQPESLHICDGSEEENHTILAKL
EEQGMIKKLTKYENCWLARTDPRDVARVESKTVIVTQEQRDTVPSPRVGGISQLGRWMSQ
EELDKAMDLRFPGCMKGCTMYVIPYSMGPVGSPLSKIGVELTDSPYVVASMRVMTRMGKA
VLTALGNRDFVRCLHSVGCPLPLKKPLVNNWPCNPELTLIAHIPDRRTIVSFGSGYGGNS
LLGKKCFALRIASRIAMEEDWLAEHMLILGITNPAGQKKYIAAAFPSACGKTNLAMLSPT
LPGWKVECVGDDIAWMKFDDEGNLRAINPENGFFGVAPGTSAKTNPNAMKTICKNTIFTN
VAETSDGGVYWEGMDQELPEGVTVTSWKNNPWTSQDGEPCAHPNSRFCTPASQCPIIDPQ
WESPEGVPIEAIIFGGRRPEGVPLVYEAFSWQHGVFVGASMRSEATAAAEHQGKLIMNDP
FAMRPFFGYNFGRYLSHWLSMAGRPNAKLPKIFHVNWFRKSQSGSFLWPGFGDNIRVLEW
MFRRLDGEAGAMPSAVGYLPCKGSLNLEGLGENQVNLEELFSLSKDFWQKEVEDIRAYFD
IQVNDDLPNEVAKQLECLEHRVRQM
NT seq 1878 nt   +upstreamnt  +downstreamnt
atgcctcctcagctgcagtcccagaacaaggcaggcgtccgggttgtccagggggacctg
ggtgcactgagcccggccgtcaaggagtttgtagagactaacatcaacctgtgtcagccc
gaatcactgcacatctgtgacggctctgaagaggagaaccacaccatcctggccaaactg
gaggagcagggcatgatcaagaagctgaccaaatatgagaactgctggctggcccggaca
gaccccagagacgtggcccgcgtggagagcaagacggtcatcgtgacccaggagcagagg
gacacggttccgtctccacgagtaggtggcatcagccagcttgggcgctggatgtctcag
gaggagttggacaaggctatggacctgcgcttcccaggctgcatgaaaggttgtactatg
tacgtgatcccctacagcatggggcctgtgggctcccccctgtctaagatcggagtggag
ctgactgactcaccttatgtggtggccagtatgagggtgatgacccgcatgggcaaggct
gtgctgaccgcactgggaaacagagactttgtgcgctgccttcactctgtgggctgcccc
ctgccactcaaaaagcccctggtcaataactggccatgcaaccctgagctcaccctgatc
gcccacattcctgaccgtagaacaattgtgtcctttggcagtggctacggagggaactcc
ctgttgggaaagaaatgctttgcactccgcattgcctcccgcatcgccatggaggaggac
tggctggccgaacacatgctgatcctgggcattactaaccctgctggtcaaaagaagtat
attgcagctgcgttccccagtgcctgtggcaaaaccaacctggccatgctcagtcccaca
ctccccggctggaaggtggagtgtgttggggacgacatcgcctggatgaagttcgatgac
gaaggcaacctgagagccattaacccagagaatggcttctttggtgtggcacctggaacc
tcagcaaagaccaaccccaacgccatgaaaaccatttgcaaaaacaccatcttcaccaat
gtggccgagactagcgatggtggtgtctactgggagggcatggaccaggaactccctgag
ggagtcacagtgacctcctggaagaacaacccctggacatcccaggatggagagccctgc
gcacatcccaactcccgcttctgcactccagctagtcagtgtcccatcattgacccccag
tgggagtcccctgagggtgtcccaattgaagcaatcatctttgggggacgtagacctgaa
ggtgtccccctggtttacgaggcctttagctggcaacacggcgtgtttgtcggagcttcc
atgagatcagaagccacagctgccgcagagcaccaaggcaagttgatcatgaatgacccc
ttcgccatgcggcccttcttcggctacaactttggccgttacctgtcccactggctgagc
atggccgggcggcccaatgccaagctgccgaagatctttcacgtcaactggttccgcaag
agccagtccggcagcttcctgtggcctggcttcggggacaacatccgcgtgctggagtgg
atgttccggaggttggatggagaagccggagccatgccctccgccgtgggctacctgccc
tgcaagggctccctgaacctggagggcctgggggagaaccaggtgaacctggaggagctg
tttagtctgtctaaggacttctggcaaaaggaggtggaggatattagggcctactttgac
atccaggttaatgacgatcttcccaatgaggtggccaagcagctagagtgtcttgagcac
agggtgaggcagatgtag

DBGET integrated database retrieval system