KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112215338
Entry
112215338         CDS       T05605                                 

Definition
(RefSeq) melanoma receptor tyrosine-protein kinase-like isoform X1
  KO
K04361  epidermal growth factor receptor [EC:2.7.10.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04012  ErbB signaling pathway
otw04020  Calcium signaling pathway
otw04068  FoxO signaling pathway
otw04144  Endocytosis
otw04510  Focal adhesion
otw04520  Adherens junction
otw04540  Gap junction
otw04810  Regulation of actin cytoskeleton
otw04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112215338
   04012 ErbB signaling pathway
    112215338
   04068 FoxO signaling pathway
    112215338
   04020 Calcium signaling pathway
    112215338
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112215338
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112215338
   04520 Adherens junction
    112215338
   04540 Gap junction
    112215338
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112215338
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    112215338
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112215338
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112215338
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     112215338
Protein kinases [BR:otw01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   112215338
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   112215338
  Exosomal proteins of pancreatic cancer cells
   112215338
  Exosomal proteins of bladder cancer cells
   112215338
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like APH
Other DBs
NCBI-GeneID: 112215338
NCBI-ProteinID: XP_024230062
LinkDB
Position
16
AA seq 1202 aa
MRPGSGIVIAALFSLGCSMTLTADKKVCQGISNRLTLLGTVDDHYNNLVRMYSNCTVVLE
NLELTYIQEYHDLSFLKSIQEVGGYVLIAVNKAAIIPLENLRLIRGHSLYDNKYALAVMS
NYEKNHSSVTLNYTRGLRELMLRGLTDILKGGVKIAHNPLLCNVETIQWWDMVNKAGNPS
MDFKLESYGRYCGKCDPGCYNGSCWTPGPENCQTFTKLKCAEQCSGRCRGPKPSDCCNEH
CAAGCTGPRPTECLACRDFQDDGTCKDACPPTMIYNPNTHQLASNPNAKYTFGATCVKTC
PHNYVVTDHGACVRTCSGNTHEVEENGVRRCKKCDGICPKVCNGLGMGPLTAVLSINASN
IDSFKNCTKINGDVSIIGTSLNGDRYTSTPKMDPAKLDYFRTVKEISGFLLIQAWPKHLD
SLSAFENLEIIRGRTKQFGQVSFAALNVAHLKYLGLRSLREISDGNIVVKNNPHLCYSNG
GHWNGLFRLDKQFARVDNNANISTCAQLNSTCDDMCTKEGCWGPGPTMCLTCLYYARRGR
CVGACHVLEGTPREYVLNNICLECDQECMVKNRTGSCFGSGPDKCVECAHVKDGPHCVYR
CPRGVLGDVDRPIWKYADKNRECQLCHENCTDGCSGPGLNGCNARGGSVPSAVAASVVGG
LLVFVVLALGVFVLVRRRHIVRKRTLRRLLQERELVEPLTPSGEAPNQALLRILKETEFK
KIKVLGSGAFGTVFKGVWIPEGENVKIPVAIKVLREATSPKANKEILDEAYVMASVEHPH
VCRLLGICLTSTVQLITQIMPYGCLLDYVKENKDLIGSQCLLNWCVQIAKGMNYLEERHL
VHRDLAARNVLVKTPHHLKITDFGLAKLLTADEKEYHADGGKVPIKWMALESILHWTYTH
QSDVWSYGVTLWELMTFGSKPYDGIPAREISGVLEKGERLPQPPICTIDVYMIMVKCWMI
DADSRPRFRELISEFSKMARDPSRYLVIQGDDCMYLPSPTDSKFYRSLISTSEDMEDVVD
AEEYLLPDKTTQHHNSGNGHLMRENSVILRYITDPTHGGSLEKDLTDPTHRGSLKKDITD
PTHGGSLEQDLAALPEYMNQNTKLSDVFNPNYEDPSVPAWATRTSSGYDPDNKFFNSLPR
VPEGPEYLNMARSTLPRSVCESNPDYQEDFLPQATPTSSHFLPAAENLEYLGLSAAVHTP
VR
NT seq 3609 nt   +upstreamnt  +downstreamnt
atgcgacctggaagtggaatagttattgctgccttgttcagcctgggctgcagcatgaca
ctgacagcggacaagaaagtgtgtcaggggatcagcaacaggctgacgctgctggggact
gtagacgaccattacaacaacctggtgaggatgtacagcaactgtaccgtggtcctggag
aacctagagcttacctacatccaggagtaccacgacctctccttcctcaagtccattcag
gaggttggaggctatgttctgatcgccgtcaacaaggcagccatcatcccactggagaac
ctgcgtctgatccgaggacactccctctacgacaacaagtatgccctggctgtcatgtcc
aactacgagaagaaccactcctctgtgacccttaactacacacggggcctaagggagctg
atgctgagaggactgacagacattctcaagggaggggtgaaaattgcccacaatcctttg
ttgtgtaatgtggagaccatccaatggtgggacatggtaaacaaggccggcaaccccagt
atggatttcaaactggagagctatggccgttactgtggcaagtgtgaccctggatgctac
aatggatcatgctggacaccaggaccagagaactgtcaaacatttaccaagctgaagtgt
gcagagcagtgctctggaaggtgtaggggtcctaaacctagtgactgctgtaacgaacac
tgtgctgcagggtgcaccggccctaggcctacagagtgtctggcctgcagagacttccag
gatgatggcacatgtaaggatgcctgccctcctaccatgatctacaatcccaacacccac
cagctggcttccaaccctaacgccaagtacacgttcggggccacttgtgtgaagacctgc
ccacataactatgtggtgacggaccacggggcgtgtgtccgaacatgcagtggcaacaca
cacgaggtggaggagaatggtgtcaggaggtgcaagaagtgtgacggaatctgtccaaaa
gtgtgcaatggacttggaatggggccgcttactgccgtcttgtcaatcaacgcctctaac
attgattctttcaaaaactgcaccaaaatcaatggcgatgtttcaataattggaacctct
ttgaatggtgataggtacacatcaacaccaaaaatggaccctgccaaactggattatttc
agaactgtgaaggaaatttcagggtttctgctcatacaagcttggccaaagcacctcgat
tctctcagtgcatttgaaaacctggagattatcaggggaaggaccaaacagtttggtcag
gtgagttttgctgccctgaacgtggcccatctgaagtatctaggcctccgctccctacga
gagatcagcgatggcaacattgtggtgaagaacaacccccacctctgctacagcaacgga
ggccactggaatggcctgttcagactggacaaacagtttgcaagggtggacaacaacgcc
aacatcagcacatgtgcccagctgaacagtacctgtgatgacatgtgcactaaggagggc
tgctgggggcccggtccaaccatgtgcttaacctgcctgtactacgcccgtaggggccgc
tgtgtgggggcctgtcacgtactggaggggacaccaagagagtatgtgttgaacaacata
tgcctagagtgtgaccaagaatgtatggtgaagaacagaaccggaagctgctttggatct
ggccctgacaagtgtgtggagtgcgcccacgtcaaagatggcccccactgtgtctatcgg
tgcccacgcggcgttctcggggacgtggacaggcccatctggaaatacgctgacaagaac
agagaatgtcagctctgccatgagaactgcaccgacggatgctctggacctggactgaat
ggctgcaatgccagaggtggttctgtcccatcggcagtggctgccagtgtggtgggaggc
ctcctggtgtttgtggtcctggccttgggtgtgttcgtgctagtccgcagacgtcacatc
gtcaggaagaggacgctgcgccgcctgctgcaggaaagagagttggttgaacccctgacc
ccaagtggagaggcacccaaccaggccctgctccgcattctgaaggagaccgagtttaag
aagatcaaagtgttgggatcaggggcctttgggactgtctttaagggcgtgtggattcct
gagggagaaaacgtgaagatccctgttgccattaaggtgttgagagaggccacatctccc
aaagccaacaaggagattctagacgaggcctatgtgatggccagtgtggagcacccccac
gtatgtcgtcttctgggcatctgcctgacgtccacggtgcagctcatcacccagatcatg
ccctacggctgtctgctggactatgtcaaggagaacaaggacctcattggctcccagtgc
ctactcaactggtgtgtacagatcgcaaagggtatgaactacctggaggagcgtcacctg
gtgcaccgtgacctggcggccaggaacgttctggtgaagacgcctcaccatttgaagatc
acggactttggactggccaagctgctcaccgccgacgagaaggagtaccacgctgatggg
ggaaaggtgcccataaagtggatggcactggagtccatccttcactggacctatacccat
cagagtgatgtgtggagctacggtgtgacattgtgggagctgatgacatttgggtcgaag
ccctacgatggcataccggccagggagatctctggagtcctggagaaaggagagcgccta
cctcagccccccatctgtaccatagacgtctacatgatcatggtcaaatgctggatgatc
gatgcagacagcagaccacggttcagggagctcatctctgagttctccaaaatggcccgg
gatccatctcgctatctggtcattcagggagatgattgcatgtacctgcccagtcccacg
gactctaagttctaccgtagcctgatcagtacatcagaggacatggaggatgtggtcgat
gccgaggagtatcttctccccgacaagaccacccagcaccacaactcagggaatggccat
ctgatgagagagaacagtgtgatccttcgctacatcacagaccctacccacggtggttct
ctagagaaagacctcacagaccccacccacagaggttctctaaagaaagacatcacagac
cccacccacggtggttctctagagcaagatctcgctgctcttccagaatacatgaaccag
aacaccaagctctctgatgtcttcaaccccaactatgaggaccccagcgtgccagcctgg
gcaactcggacctcctctgggtacgacccggacaacaagttcttcaactccctgccacgt
gtgccggagggacccgagtatctgaacatggcccgcagtaccctccctcgctctgtatgc
gagagcaacccagactaccaggaggacttcctacctcaggccacacccaccagtagtcac
ttcctgcccgcagcagagaacctggagtacctcggattgagcgctgctgtacacacccct
gtacgctag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112216488
Entry
112216488         CDS       T05605                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: vascular endothelial growth factor receptor 1-like
  KO
K05096  FMS-like tyrosine kinase 1 [EC:2.7.10.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04020  Calcium signaling pathway
otw04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112216488
   04020 Calcium signaling pathway
    112216488
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112216488
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112216488
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     112216488
Protein kinases [BR:otw01001]
 Receptor tyrosine kinases (RTK)
  VEGFR family [OT]
   112216488
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 V-set C1-set
Other DBs
NCBI-GeneID: 112216488
NCBI-ProteinID: XP_024232242
LinkDB
Position
16
AA seq 1166 aa
MIGYIFVVLCGLVGSALAKGKVDREPKGKFSVPVLDVKSRQLVLEANQTLTIHCRGRWEL
SWAFPGGVARDQERMRLEDSRCGRQSQHYCSQLTLSSAQAQHTGSFRCRYSHRTLRQRAV
YVYVTDRQRPFVEEQNNSPDVVYIKESQPLVFPCRVTHPDATVSLVKFPDRELTPDQRNI
VWNSRQGFLIRSPTYFYIGLFSCKTSVNGTTHSLSYLTHRQVNKIMEVYLNSTSPVQTLQ
GDSLAINCTVTAEWNSRVSISWDYPGQVNRAAIISRRIMASKTHMVFYSILSIPKLHRSD
RGLYICRVTSGPVSRETNVSVTVYDRPYIRXHPDKGLXWEVXAGQSYRLSPKLRAFPAPE
LKDGKEQQNQCFRYHGGWDSLVIRDVAKEDAGKYTILVGIQEHRIYQNLTLSLVVKLSPG
IGEKAVSLQDPGSVPQGSRQALHCSSHGVPPPHIAWLWHPCPPKGLPVPLYSSPTMEPGE
REGPSTSTQNHIXTHRQEVLQGKKQTVGILMVAELFVSAVYRCIASXNEQDMSFYSTDVP
GGFGVKQEEELREGGDLTCVANKQLYTKLSWQLVTDTAEPSNLSHEAGDPPLDRITVKEQ
GLYTSQATNERGSAVGSTYIWVQNSSEGLSLKILTLTVPVGGHSLWLLRFTLSTSVPPYE
LKQAKSEYLSIILDPDKGPPEEQCDRLQYDPSQWEFPETASNREPLDHEAFGKVMQVSAF
GIYNSTGCGTVAVKMLKEGATHSEHKALMSELKMLTHIGQHANIVNLLGACTAQVRQPIT
GSVIGCDVYSVTCGSVTVWSVTVCGSGLCVDGPTYLIFQYCRNGDLLNYLKNNRELYHKS
LTDAFTRDRFSRLYHNLPKRSSSEFQRPVDSIYIPMSPTTTRGQESIALISLNSSPMNTS
DGPGMYEELNELQEEEEEEEEEALTYDDLLSFSYQVAKGMDFLSSKHCIHRDLAARNVLV
TQGGLVKIGDFGLARDIDNDSNYVVRGNVRLPVKWMAPESIFQGMYTMQSDVWAYGILLW
EVFSLGVTPYPGIKVDNNFYVMIERGFKMEQPYYASESVYSIMCKCWALEPRDRPHFSKL
VAFMDDQLADMEEKLYHNILDKRCSHVLYQNAPVKSDLSALAKEKGHQAQSQNQYCKTHS
TGEAPTTLSDRVAMETDDDNPLKPCQ
NT seq 3501 nt   +upstreamnt  +downstreamnt
atgattggctatatcttcgtggttctgtgtggattggttggcagtgcgctcgcaaagggt
aaggtggatagggagcctaaggggaagttcagtgttcctgttctggatgtgaagagtcga
cagctggtcctggaggccaaccagactctgacaatccactgcaggggtcggtgggagctg
tcgtgggcattccctggaggtgtggccagagatcaggagagaatgcgattggaagattct
cggtgtggtaggcagagccagcattactgcagccaactgacgcttagctcggcccaggcc
cagcacacaggatcgttccggtgtcggtacagtcatcggacgctcaggcagagagctgtc
tatgtctatgtcacagacagacagcggccatttgtggaggagcagaataacagtccagac
gtggtgtatatcaaggagagccagcctctggtcttcccctgtagggtcacccaccctgac
gccaccgtgtcattggtcaagttccctgaccgtgagttgaccccagaccagaggaacata
gtgtggaacagcagacagggcttcctcatccgcagtcccacctacttctacatcggcctg
ttctcctgcaagacctctgtcaacgggaccacacactccctcagttacctcacacacaga
caagtgaataagattatggaggtgtatctgaacagtactagtcccgtccagactttacag
ggggacagtctggccatcaactgtactgtcactgcagagtggaacagcagagtgtccatc
agctgggactaccctgggcaggtaaaccgggcagccataattagtaggcgtatcatggcc
agtaaaactcacatggttttctacagtattctgtccatccctaaactccaccgctctgac
agagggctctatatctgccgagtgaccagtggaccggtcagccgagagactaacgtgtct
gtcacagtctacgaccgtccgtatatccgctgacacccagacaaggggctatagtgggag
gtcnnagcaggacagagttaccgactctcccctaaactacgggccttccctgccccagag
ttgaaggatgggaaggagcagcagaaccagtgtttccgttaccatggtggatgggattcc
ctggtgatccgggatgtggcgaaggaggatgcagggaagtacactatcctggtgggaatc
caggagcacagaatctaccagaacctaacgctctctctggtggtcaagctgagtcctggg
ataggggagaaggcggtgtccttgcaggacccaggtagtgtcccgcagggcagcagacaa
gccctgcactgcagctcccacggagtcccccctcctcacatcgcctggctctggcacccc
tgcccccccaaaggcctccctgtccctctctactcctcacccactatggagcctggtgag
agagagggccccagcacgtccacacagaaccacatcnctacacacagacaggaagtgctc
caggggaagaaacagaccgtggggattttgatggttgctgagttgtttgtatccgcagtg
tatcgctgtattgcctcanagaacgaacaggacatgtccttttatagtacagatgtccca
ggaggcttcggtgtgaaacaggaggaggagctaagagagggaggagacctcacttgcgta
gccaataaacaactgtacaccaagttgtcatggcaactggtgactgacacagcagagccc
tctaacctctcacacgaggcgggggaccctccacttgaccgaatcacagtgaaggaacag
ggtctgtacaccagccaggccaccaatgagagaggctctgctgtgggctccacctacatc
tgggttcagaactcgtcagagggcctgtctctgaagatccttactctcactgtacctgtt
ggtggccactctctctggctgctgcggttcactctctcaactagtgtacctccatatgaa
ctcaaacaggcaaagtcagagtacctgtcaatcatcctggacccggacaaggggcctccg
gaggagcagtgtgatagactacagtacgaccccagccaatgggagttcccagagactgcc
tcgaacagggaacctctggaccatgaggcctttgggaaggtcatgcaggtgtctgccttt
ggcatctacaactctacaggctgcggaactgtggctgtcaagatgctcaaagagggggct
actcacagtgagcacaaggctctgatgtcagagttgaagatgctgactcacatcggacag
catgccaacatcgtcaacctgctgggggcatgcacggctcaggtacgacagccaatcaca
ggctctgtgattggctgtgacgtgtactctgtgacgtgtggatcggtgactgtgtggtct
gtgactgtgtgtggctctggactgtgtgtggacgggcccacgtacctgatatttcagtac
tgccgtaacggggacctgctgaactacctgaagaacaacagagagctctaccacaagtct
ctgaccgacgccttcaccagggaccgcttcagcagactttaccacaacctgcccaagagg
agctccagtgagttccagaggccagtggacagcatatacatccccatgtcccccaccacc
actagagggcaagagagcatcgccctgatcagcctcaactcttctcccatgaacacctct
gatggtccagggatgtatgaggagttaaatgagctgcaggaggaggaggaggaagaggag
gaggaggcgctgacctacgacgacctgctcagcttctcctatcaggtggccaagggcatg
gacttcctgtcctccaaacactgtatccatcgggaccttgctgccaggaacgtgttggtg
actcagggtggactagtaaagatcggggactttggactggcccgggacatcgacaatgac
tccaactacgtagtgagaggaaatgtgcgtctgccagtgaagtggatggctccagagagt
atcttccaggggatgtacaccatgcagagcgatgtctgggcctatggtatcctgctgtgg
gaggtcttctctctgggtgtgaccccctacccagggataaaggtggacaacaacttctat
gtgatgatagagagaggttttaagatggagcagccgtactacgccagtgaatctgtgtat
tcgatcatgtgtaagtgctgggccttggagcctcgggaccgccctcacttctccaagctg
gtggccttcatggatgaccaactggccgacatggaggagaagctctaccataacatcctg
gacaagcgctgcagtcatgtgttataccagaatgcaccggtgaaatctgatctctcagcc
ttggccaaagaaaagggtcatcaagcacagtcacagaaccaatactgcaagacccactcc
actggagaggccccaacaacactgtctgacagggttgccatggagactgatgatgacaat
cctctgaaaccatgtcagtga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112218557
Entry
112218557         CDS       T05605                                 

Definition
(RefSeq) insulin-like growth factor 1 receptor
  KO
K05087  insulin-like growth factor 1 receptor [EC:2.7.10.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04068  FoxO signaling pathway
otw04114  Oocyte meiosis
otw04140  Autophagy - animal
otw04144  Endocytosis
otw04150  mTOR signaling pathway
otw04510  Focal adhesion
otw04520  Adherens junction
otw04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112218557
   04068 FoxO signaling pathway
    112218557
   04150 mTOR signaling pathway
    112218557
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112218557
   04140 Autophagy - animal
    112218557
  09143 Cell growth and death
   04114 Oocyte meiosis
    112218557
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112218557
   04520 Adherens junction
    112218557
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    112218557
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112218557
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:otw04090]
    112218557
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     112218557
Protein kinases [BR:otw01001]
 Receptor tyrosine kinases (RTK)
  INSR family [OT]
   112218557
CD molecules [BR:otw04090]
 Proteins
  112218557
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain Pkinase fn3 Furin-like Insulin_TMD Kinase-like TMEM154
Other DBs
NCBI-GeneID: 112218557
NCBI-ProteinID: XP_024235210
LinkDB
Position
19
AA seq 1413 aa
MRSGTERNNSTLFWGLMLSVSAICLLSANGKICGLSIDIRNDISEFKSLENCTVVEGYLQ
ILLIGEKTNNLNQELFRSLSFPKLTVITDYLLLFRVSGLDSLSTLFPNLNVIRGRNLFYN
YALVIFEMTSLKDIGLYNLRNITRGAIRIEKNPELCYLDSVDWSLIMDAEFNNFIAGNKQ
SKECGDVCPGIMEDNAQCIKTSFNGNFNSRCWTSNHCQKVCPEKKCERRACTDSGECCHA
QCLGSCTEPDDDMACAPACTTTTRAAACSTAPQTLTSLRAGAASPWTCVPACHCPATLIC
HSRRRGMPECPSGFTRNESNSMFCSACDGLCDKICDSKTIDSVDAAQSLMGCTVIKGNLH
INIRRGNNIASELESFMGLIQTVTGYVRIRHSHTLGSLSFLKSLRYINGEELMEGMYAFS
AIDNQRLQYLWDWTQHNLTIRAGRLSFRFNPKLCMSEIHKMWEKTGITEKFEEDDFRNNG
DRASCESHILKFKSNSTVSNRIKLTWERYRPPDYRDLISFIVYYKEAPHQNITEFDGQDG
CGSNSWNMVDVDLPQDKEIDPGVLLSPLKPWTQYAIFVKAITLVVEDKHIPGAKSDVVYI
RTRPSEPSMPMDARAYANSSSKLVVKWSPPLNPNGNLTFYLVRWQQQAEDRELYQHNYCS
KELKIPIRISATGLADMEEDTKPTKSDLSGGDKGPCCPCPKTKEDLKAEIDDASYRKVFE
NFLHNSIFTPRPPDRRRRDLFGVANSTLARGGNTTGLEGNRTEGEPPEREFPFMEDRSKT
EFIEIPNLQPFTVYRIDIHACNQEVRRCSAGAFVFSRTKPADKADDMPGSVIQERDEKVE
GSVLLRWPEPVNPNGLILMYEIKFRQGTEPEKHECVSRQHYRVHKGTRLTNLGYGNYSAR
VRATSLAGNGSWTEPVSFYVPPPKRDYDNAFYLVIIIPIIVIILIASLITVLFFINKKRN
SDRLGNGVLYASVNPEYFSAAEMYVPDEWEVAREKITMHKELGQGSFGMVYEGLAKGVVK
DEPETRVAIKTVNESASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMT
RGDLKSHLRSLRKENTSSQVLPPLKKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAE
DFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTNSDVWSFGVVLWEI
ATLSEQPYQGMSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIINS
LKEELEPPFSEMSFFFSKENKPPDTEELDMEVENMENVPLDPAPSRPPTAAPQPSQGPMG
ATRGSAPPPPQQLSPIQGPSSTLMGPGSPSTSVPAASASASPSLALDKHSAQVSANGPVV
VLRPNFEDTQNYAHMNGGRKNERALPLPQSSAC
NT seq 4242 nt   +upstreamnt  +downstreamnt
atgagatctgggacagagaggaataattcgaccttgttttggggtctgatgctgtctgtc
tccgctatctgcctgttgtccgcaaatggaaaaatctgtggtctaagtatcgacatccgt
aatgacatcagtgagttcaagagtctggagaactgcacggtggtggagggctacctgcag
atcctcctcatcggagaaaagaccaacaacctcaaccaggagctcttccgctccctcagc
ttccccaagctgaccgtcatcaccgactacctgctcctgttccgcgtgtccggcctggac
agcctcagcacgctcttccccaacctcaacgtcatccgcggacgcaacctcttctacaac
tatgccctggtgatcttcgagatgaccagtctgaaggacattggcctgtacaacctgagg
aacatcacacgaggggccatccggatcgagaagaaccctgagctctgctacctggactct
gtggactggtctctcatcatggacgcagagttcaacaacttcatcgcggggaacaagcag
tccaaggagtgtggtgatgtgtgtccaggcatcatggaggacaacgctcagtgcatcaag
accagctttaacggcaactttaactctcgctgctggacatccaaccactgccagaaagtc
tgcccagagaagaagtgtgagcggagggcatgtacggacagtggtgaatgttgccatgcc
cagtgcctggggagctgtacggagccggacgacgacatggcctgcgcgcctgcctgcact
actaccacgagggccgctgcgtgcagcactgccccccagacacttacaagtttgagggct
ggcgctgcatcaccatggacctgtgtgcccgcgtgccactgcccagcgactttgatttgt
cattcacgaaggagaggcatgcctgagtgtccatcaggctttacacgcaatgagagcaat
agtatgttctgcagtgcctgtgatggcctgtgtgataagatctgtgactccaagaccatc
gactcagtggatgctgctcagtctctaatgggctgtacagtcatcaaaggcaacctgcac
atcaacatccgccgtggcaataacatcgcttcagagctggaaagcttcatggggctgatc
cagacagtgacaggctatgtgaggatccgccactcccacacgctaggctcgctctccttc
ctcaagagcctgcgctacatcaacggggaggagctcatggaagggatgtatgctttctct
gccatcgacaaccagcgcctgcagtacctgtgggactggacccaacacaacctgaccatc
agggctgggaggctgtcgttccgcttcaaccccaaactctgcatgtctgagatacacaag
atgtgggagaagacgggaatcactgagaagtttgaggaggacgatttccgcaacaatggg
gacagagccagctgtgagagccacatcctgaagttcaagtccaacagcacggtgagtaac
cggatcaagctgacctgggagcgctacagaccaccagactacagagacctcatcagcttc
attgtctactacaaggaggcaccgcaccagaatatcacagagtttgatggccaggatggg
tgtggctccaacagttggaacatggttgacgtggacctgcctcaggacaaagagatagac
cctggtgtgttgctgtccccactgaagccctggacccagtacgccatctttgtcaaggcc
atcacccttgtggtggaggacaaacacatcccgggagccaagagtgacgtggtctatata
cgcaccagaccctcagagccgtctatgccaatggatgcccgtgcgtatgccaactcatcc
tcaaagctggtagtgaaatggtcacctcccctcaaccctaacggcaatctcactttttac
ctggtccgctggcagcagcaagctgaagacagggagttgtaccaacacaactactgctcc
aaagagctgaagatccccatcaggatatcagccacggggttggcagacatggaggaggac
accaagcccaccaagtctgacctgtctgggggggataagggcccttgctgcccctgcccc
aagaccaaggaggacctgaaggcagagatagacgacgcctcctaccgcaaagtctttgag
aacttcctgcacaattctatcttcacccccagacccccagaccggcgacgtagggatcta
tttggtgtcgctaacagcaccctggcacggggtggcaacaccacaggcctggagggtaat
aggacagaaggagagccccctgagagggagttccccttcatggaggaccggagcaagaca
gagtttatcgagatccccaacctgcagcccttcactgtgtaccgcatcgacatccacgcc
tgtaaccaggaggtccgtcgctgcagcgctggagccttcgtcttctccaggaccaaacct
gcagacaaagcagatgacatgccaggcagcgtgatccaggagagggatgagaaggtggag
gggtcggtgctgctgaggtggccagagcctgtcaaccccaatggcctcatcctgatgtat
gagatcaagttccgccagggcaccgagcctgagaaacacgagtgtgtgtcacgccagcac
taccgtgttcacaaaggaactcgtctgaccaacctgggctatgggaactactctgcccgc
gtgcgtgccacctccctggcaggaaatgggtcctggactgagccagtgtccttctacgtg
cccccacccaaacgggactatgacaacgcattctatctggtcatcatcatccccatcatc
gtgataattctcatcgccagcctcatcactgtactcttctttatcaacaaaaagaggaac
agtgacaggctggggaatggtgtcctctatgcttctgtcaaccctgagtacttcagtgct
gccgagatgtatgttccagatgagtgggaggtggccagggagaaaatcaccatgcacaag
gagttgggccagggttccttcggcatggtgtatgagggcctggctaagggcgtggttaag
gacgagcctgagacccgcgtggccatcaagacagtcaacgagtcagccagcatgagggag
aggatcgagttcctcaatgaggcctctgtcatgaaggagttcaactgtcaccacgtggtg
cgtctgctgggcgtggtctctcagggccagcccaccttggtgataatggagctgatgacc
cgtggagacctgaagagccacctgcgatcactccggaaagagaacacgtccagccaggtt
ctgcccccgctgaagaagatgatccagatggcaggagagattgcggacggcatggcatac
ctcaacgccaacaagtttgtccacagagacctggctgccaggaactgcatggtggcggag
gacttcaccgtcaagatcggagactttggcatgacgcgagacatctacgagacggattac
tatcggaaaggaggaaaaggccttctgccggtccgctggatgtctccagagtcgctgaaa
gatggcgtgttcaccacaaattctgatgtctggtcgtttggggtggtgttatgggagatt
gccaccttgtctgagcagccgtaccagggcatgtccaacgagcaggtgctgcgtttcgtc
atggagggaggactcctggacaagcctgacaactgccctgacatgctgtttgaactgatg
cggatgtgctggcagtacaaccccaagatgcgtccctccttcctggagatcatcaacagc
ctcaaggaggagctggagcctccattcagtgagatgagtttcttcttcagcaaggagaac
aagcccccggacactgaggagctggacatggaggtggagaacatggagaatgtgccactg
gaccctgcacccagcagaccccccactgccgcccctcagccctcccagggacctatgggg
gccacacggggctcagcgccccctcctccccagcagttatctccaatacaaggcccttct
agtaccctgatgggacctggctccccctccacctcagtccctgctgcctctgcctcagcc
tcgccaagcctggctttggacaagcattcagcacaggtatcggccaacgggccagtggta
gtgctacggcccaactttgaggacacgcagaactacgctcacatgaacggggggcgcaag
aacgagcgggcgctgccactgccccagtcttcagcctgctga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112219021
Entry
112219021         CDS       T05605                                 

Definition
(RefSeq) hepatocyte growth factor receptor-like
  KO
K05099  proto-oncogene tyrosine-protein kinase Met [EC:2.7.10.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04020  Calcium signaling pathway
otw04510  Focal adhesion
otw04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112219021
   04020 Calcium signaling pathway
    112219021
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112219021
   04520 Adherens junction
    112219021
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112219021
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     112219021
Protein kinases [BR:otw01001]
 Receptor tyrosine kinases (RTK)
  MET family
   112219021
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase TIG Pkinase_fungal Kinase-like
Other DBs
NCBI-GeneID: 112219021
NCBI-ProteinID: XP_024236017
LinkDB
Position
19
AA seq 863 aa
METTAPWHRDTVFNMDQSQQMIGNNLYDQCWNQTWNRSCLAVCCVCILIGCPVCPQITKV
PLIGPGCEQQWTCSSCLLAPRFMGCGWCDGRCTRLAQCHPTSLWTQDSCPPIITMISPAN
GPLGGDTKVTVCGRNFGFNKTERFDHTLISLDLAGAPCKLLKRESNSYRLVCAPVSPVNS
SQASNVVKVHSGKEMAQQQGFTFVNPVIREIFPVFGPKLGGTMLTIRGSFLDSGNTRQVT
VGNATCEILRVSGTMLMCRTPPQSAPSRQVVYMRVDSVVREAPVLFTYNEDPLISSIQPT
RSFISGGSTVVAQGFYLHSTLQPQMVLIPTAQEGKVFTVNCIKGEDRLAILCTTPSLKDL
GLQTPVVTKVAFVLDDFSTPQFDLLYVEDPRFEDFQRPTVTSKGNKSILEIKVPGRVDVE
AMKGEVLKVSNRTCESVTVVGNTLECTVPMELRDATNELEVEWRQASSSVSLGRVMLAHE
QDYRGLLAGCVCVSLLLLMLLTLFLWKRRNKHIDDLAEGKVWYDGRAHIQHLDMLANARS
VSPTNEMVSHESLDYRTTLLEDQGVERPESCRGAPPIYGSHGELLSPRLGLGGMGLGAEG
ELVSPLLSAPVHIDPSQLHPDLLKEVQHVVIAREHLLLHFNQVIGRGHFGCVFHGTLLEA
DGQKQHCAIKSLNRITDLEEVSQFLKEGIIMKDFSHPNVLSLLGICLPPEGSPLVVLPYM
KHGDLRNFIRDETHNPTVKDLMGFGVQVARGMEYLASKKFVHRDLAARNCMLDESYTVKV
ADFGLARDVYEKEYYSIHSKSGVKLPVKWMALESLQTHKFTPTSDVERDSWIIGLIGLIG
LIGLIGIIGLIGLIVVFGCFYGN
NT seq 2592 nt   +upstreamnt  +downstreamnt
atggaaacaacagccccctggcaccgagacacggtgttcaacatggaccagagccaacag
atgattggaaacaatttgtatgatcaatgctggaatcaaacttggaatcgatcctgttta
gcggtgtgttgtgtctgtattctgattggttgtcctgtgtgcccccagatcaccaaggtg
cctctgattggtcctggctgtgagcagcagtggacgtgtagttcctgcttgctggcgcca
aggtttatgggatgtggctggtgtgacggccgttgcaccaggttggcccagtgtcaccca
acctccctctggacccaggactcctgccctcccatcatcaccatgatctccccagccaac
ggccccctgggaggagacaccaaggtgacggtgtgtgggaggaactttggcttcaacaag
acagagaggtttgaccatacactcatcagcctggacctggctggagcaccatgtaaactt
ctgaaacgagagagcaacagttacaggttggtgtgtgctccagtgtctcctgtgaactcg
tctcaggctagcaatgtggtgaaggtccacagtggaaaggagatggcccaacaacagggc
ttcaccttcgtgaacccagtgatcagagagatcttccctgtgtttggccctaagttagga
ggaaccatgctcaccatcagaggctctttcttagacagcggaaacaccagacaggtcact
gtgggaaacgccacctgtgaaatcctgagagtatcaggtactatgctgatgtgcaggacc
cctccccagtcggccccatcccgccaggtggtgtatatgagggtggactctgttgtccgg
gaggctcctgtactcttcacctacaacgaagaccctctcatctcctccatccagccaaca
agatcctttatcagtggaggcagcacggtggtggcccagggcttctaccttcactctact
ctccagcctcagatggtgctcatccccacagcccaggaaggcaaagtcttcactgtgaac
tgcatcaagggtgaggacaggctggccatcctgtgtaccaccccgtccctgaaggacctg
ggtctgcagactcctgtggtcaccaaggtggcgttcgtcctggatgatttctccacgccc
cagtttgacctgctgtatgtagaggaccctcgcttcgaggactttcagagacccaccgtc
acatcaaagggcaacaagagcattctggagattaaggtgccaggccgtgtggatgtggag
gcgatgaagggggaggtgctgaaggtgtctaacagaacctgtgagagtgtgactgtggtg
gggaacactctggagtgtactgtccccatggagctacgggacgcaaccaacgaattggag
gtggagtggcgtcaggcatcgtcctcggtgagtctgggcagggtgatgttggcccatgag
caggactacagagggctgctagctggctgtgtgtgtgtcagtctgctgctgctgatgttg
ctcactctgttcctctggaaaaggaggaacaaacacattgacgatctggctgagggtaag
gtttggtatgacggcagggctcacattcagcacttggatatgttggctaatgcccggagc
gtcagccccactaacgaaatggtgtcccacgagtctttggactatagaaccaccctgctg
gaggaccagggcgtggagaggccagagtcatgcaggggggctccccctatctacgggagc
catggggagctgctgtcccccagattggggctcggaggcatgggtctgggggcagagggg
gagctggtgtcccctctcctgtcggccccggtccacatcgacccgtcccagctgcaccct
gacctcctgaaggaggttcaacatgtggtcatcgccagagaacatctgctgttacatttt
aaccaggtcatcggcagaggacactttggctgtgtgttccacggtaccttgttggaggct
gacggacagaagcagcactgtgccatcaagtctctcaaccggattactgacctggaggag
gtgtctcagttcctgaaggaggggatcatcatgaaggacttcagccaccccaacgtgttg
tctctcctggggatctgtctgccccctgagggctctcctctggtggtgctgccatacatg
aagcacggagacctcaggaactttatcagggacgagacacacaacccaacagtgaaggac
ctgatgggctttggtgtgcaggtggccaggggcatggagtatctggccagcaagaagttt
gtccacagagacctagctgccaggaactgcatgctggatgagagctacacagtgaaggtg
gcagactttggcctggccagggatgtgtatgaaaaggagtactacagcatccacagcaag
agtggagtcaaactaccggtcaagtggatggccctggagagcctgcagacacacaagttc
acccccacgtcagatgtggagagagactcatggatcataggactcataggactcataggg
ctcataggactcatagggatcataggactcataggactcatagtggtgtttgggtgtttc
tatgggaactga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112220770
Entry
112220770         CDS       T05605                                 

Definition
(RefSeq) platelet-derived growth factor receptor beta-like isoform X1
  KO
K05089  platelet-derived growth factor receptor beta [EC:2.7.10.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04020  Calcium signaling pathway
otw04510  Focal adhesion
otw04540  Gap junction
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112220770
   04020 Calcium signaling pathway
    112220770
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112220770
   04540 Gap junction
    112220770
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112220770
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112220770
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:otw04090]
    112220770
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     112220770
Protein kinases [BR:otw01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   112220770
CD molecules [BR:otw04090]
 Proteins
  112220770
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase I-set Ig_3 Ig_2 ig V-set C2-set_2 RIFIN Adeno_E3_CR2
Other DBs
NCBI-GeneID: 112220770
NCBI-ProteinID: XP_024238421
LinkDB
Position
21
AA seq 1096 aa
MRSVRVCTLHLTTILTALLHFCPEFCCLEISPSNSEVVMTAGDSMIITCSGWGTVEWRFK
RDDNVPSFGVENQNTTSVLILDNVTWSQTGVYVCTEAWTDETIEVAVFVPDPDVWFIESF
HGMVTKTSEEGIIPCVVTNPQINVTLYERDSDMHLKGVYIPSEGYRAPLEDRTYVCRGEL
NGEEKESQAFYVFSIVVPETIDAYINASKTVLKQGEPLTVNCTVHGVELVFFSWDYPNRD
VDSIEPLTDVLSSQKMRSRLIVSKVTLANTGQYACHVHEGVQDQRATANVNITILEQGFV
ELRSIQDRNVSAQLHQNVELRVEIEAYPPPRVRWTKDDATVNGHNVIITKQEHETRYVST
LTLVRIRTEQKGLYTVHVANGDDTKKLTFDLEVKVPPQITDLSDHHLPGKRHAVTCVAEG
VPSPTIQWFSCDSMLKCSNRSTVWQPLVSDPETLSVQTNVSFNESRMVGQVRSQVIFHKP
QQVSVRCEASNERGLRRRDVKLVSSTFFSQVAVLAAVLALVVIIIISIIILIAVWRKKPR
YEIRWKVIESVSLDGHEYIYVDPIHLPYDLAWEMPRDSLVLGRTLGSGAFGRVVEATAYG
LSHTQSSMKVAVKMLKSTARRSETQALMSELKIMSHLGPHLNIVNLLGACTKQGPLYLVT
EYCCYGDLVDYLHKNKHTFLQYYLEKNQEDSGCRISGGSTPLSQRKGYVSFGSECDGGYM
DMSKDEPTVYVPMQELKDTIKYADIQPSPYESPYQHDHYQEQDQITMDPALFISDSTTLS
YTDLIGFSYQVAKGMEFLASKNCVHRDLAARNVLICEGKLVKICDFGLARDIMHDSNYIS
KGSTFLPLKWMAPESIFHNLYTTLSDVWSYGILLWEIFTLGGTPYPDLPMNELFYSALKR
GYRMAKPNHATDEVYEVMQKCWDEKHEKRPEFSFLVHTMGNMLTDSYKKRYCQVNDEFFK
SDHPAVVRTKPRLSSPFLTPAITPSTAPDSLQDLNPYPLTGDFRPEADGEEVTTSYNDYI
IPIPDPKPQEEVFSEANRMQMESPASSLALEDDEADSISQETAEADTIPEEEDLHANQAL
IPLESSGTPEVEDSFL
NT seq 3291 nt   +upstreamnt  +downstreamnt
atgaggagtgtcagagtatgcactctccatctgacaaccattcttacagctcttttacac
ttctgtcctgagttctgttgcctggagatctcccctagcaacagtgaagtcgtcatgaca
gcgggtgactccatgatcattacctgttctggctgggggacggtcgaatggaggttcaag
cgggatgacaacgttccctcttttggagtggagaaccagaacacaaccagtgttctcatt
ctggacaatgtgacgtggagccaaacgggagtatatgtctgtaccgaggcttggactgac
gagactatagaggtggcagtctttgttccggatcctgatgtgtggttcattgagagtttc
cacggcatggtgaccaagaccagcgaggaggggatcatcccgtgtgtggtcaccaacccc
cagatcaacgtcaccctctacgaaagagacagtgacatgcacctgaagggggtctacatc
ccaagtgagggctacagggcgccactggaggacaggacctatgtgtgccgaggagagctg
aacggggaggagaaagagtcccaggctttctacgtattcagcattgttgttccggagacg
atcgacgcctacatcaatgcgtctaagacggtgctgaagcagggcgagcctctgaccgtg
aactgcacggtgcacggagtggagctggtcttcttctcctgggactatcccaatagagac
gtggactccattgagcctctgactgacgtcctgtcatcccagaagatgcgctcacgcctc
atagtctccaaggtgacgctggccaacacgggccagtacgcgtgtcatgtccatgagggt
gtccaggaccagagagccacagccaacgtcaacatcaccatccttgagcaaggcttcgtg
gagctgaggtccatccaggatcgtaatgtctcggcccagctgcaccagaacgtagagctg
agggtggagatcgaagcttacccccctccacgtgtccgctggaccaaagatgatgccacg
gtcaacggtcacaacgtcataatcaccaagcaggagcatgagaccaggtacgtcagcacg
ttgaccctggtgaggatcaggacagaacagaaaggcctctacaccgttcacgtcgccaac
ggcgatgacaccaagaaattgacctttgatctagaggtcaaagtcccccctcagatcaca
gacctgtcggaccaccacctccctgggaagaggcatgcagtgacctgtgtggctgagggg
gtaccttcccccaccatccagtggttcagctgtgacagcatgctcaagtgcagtaaccgg
agcacagtgtggcagcccctagtgtcagaccctgagaccctgagcgtccagaccaacgtc
agcttcaacgagagccgtatggtgggccaagtccgcagccaggtcatcttccacaagccc
cagcaggtgagcgtccgctgcgaggccagcaacgagagaggactccgcaggagggacgtc
aaactggtgtccagcacttttttctcccaggtggcagtgttggctgcggttctagccctg
gtagtcatcatcatcatctctatcatcatcctcatcgctgtgtggaggaagaagcctcgc
tatgagatcaggtggaaggtgatcgagtcagtgagtctagacggacatgagtacatctac
gttgaccccatccatctgccctatgaccttgcctgggagatgccccgagacagcctggtg
ctgggtcgtactcttgggtccggagcattcggcagggtggtcgaagcgaccgcgtatggt
ctcagtcatacccagtccagcatgaaagtggcagtgaaaatgctcaaatccacggccagg
aggagtgagacccaggctctaatgtcagagctgaagatcatgagccacctgggtcctcac
ctcaacattgtcaacctgctgggggcctgcaccaaacagggccctctctacctggtgaca
gagtactgttgctatggagacctggtggactacttacacaagaacaagcacacgttcctg
cagtactaccttgagaagaaccaggaggactctggctgccgcatctctggagggagcacc
cctctcagccaaaggaaaggctacgtgtcatttggcagtgagtgtgacggtggttacatg
gacatgagtaaggacgagcccacagtgtacgtccccatgcaagagctgaaagacaccatc
aaatacgctgacatccagccttctccctatgagtctccctatcagcacgaccattaccag
gaacaagaccagatcacaatggaccctgccctgttcatcagtgactctactacacttagc
tatactgacctcatcggcttcagctaccaggtggccaaaggcatggagttcctcgcctcc
aagaattgtgtccatcgtgacctggccgccaggaacgtgttgatctgtgaggggaaactg
gtgaagatctgtgactttggcctagccagagacatcatgcatgattccaactacatctcc
aaaggcagcacattcctgcccctgaagtggatggccccagagagtatcttccataacctg
tacaccaccctgagtgacgtgtggtcctatggcatcttgctctgggagatcttcaccctt
ggaggaaccccttaccctgaccttcctatgaatgagctgttttacagtgccttaaagaga
ggctatcgcatggccaaacctaaccacgccacagacgaagtttatgaagtgatgcagaag
tgctgggatgagaagcatgagaagaggccagagttctcctttctggtgcacaccatgggg
aacatgctcactgacagctataaaaagagatactgccaagtcaacgacgagttcttcaag
agtgaccacccggccgtggtcagaaccaaacccaggctctcctcccccttcctcacccca
gccatcaccccctccaccgcccctgactccctccaggatctcaacccctaccccctaact
ggagactttagaccggaggcagatggagaggaagtgactacctcctacaatgactacatc
attcccatcccagaccccaagcctcaggaggaagtcttctccgaggccaaccgcatgcaa
atggaaagccccgcgagctctctggctctggaggatgacgaggctgattccatctcccag
gagacagccgaggcagacaccattccagaagaggaggatctccatgccaaccaggctctg
attccactggaatcttctggaacaccggaagtggaagacagcttcctgtag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112220893
Entry
112220893         CDS       T05605                                 

Definition
(RefSeq) vascular endothelial growth factor receptor kdr-like
  KO
K05096  FMS-like tyrosine kinase 1 [EC:2.7.10.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04020  Calcium signaling pathway
otw04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112220893
   04020 Calcium signaling pathway
    112220893
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112220893
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112220893
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     112220893
Protein kinases [BR:otw01001]
 Receptor tyrosine kinases (RTK)
  VEGFR family [OT]
   112220893
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Ig_3 I-set Pkinase Ig_2 ig VEGFR-2_TMD V-set Ig_4
Other DBs
NCBI-GeneID: 112220893
NCBI-ProteinID: XP_024238618
LinkDB
Position
21
AA seq 1235 aa
MAPLDCAKLSILLHLITYITGQVSLPAPLLLPSGDTHLRHTGKSLTLTCRGAAQLHWRLP
WRDVTSEGVRVEECEPQLHTHCSKLLVSHLSPNDTGLYSCRYTQPSADFSSTYIYVKDHQ
HPFVEHHFPIPYTLFTYRHEATLVIPCRTTSPDQIVTLEGLPPLSEDIEQWKEWDPKIGF
VIPYGPYKSFRLLTCVTNVDGQQVQSQYIPLRQTNFLRNVKINPERIKLLVGDTLVLNCS
AETTFNGRINFQWEYPKRMVNRNPTVNKIRENPALITRMYKAITLSNITMDDRGMYRCTA
EIGNAEMGKKKHASAKVTIYEHPYLNVSYKNEWARRVVYTEGRNKLMFEPKVNALPPTDT
IAWYKDGVPINENSTCYESSGYNLLIKDVKQKDAGVFTIALGNKERGLYRNLSYTLVVRV
RPMISEEEVASVDVQPYMFGKQHQLTCTAFGVPMPDITWLWQPCHPDPTDKECTLYTEPI
PVQMDDKGNYSHNWIESINNQTELVKGKNKTVSTLVVGAANVTGIYSCAAQNKLGTRTLR
TPFYVDDHPQHLAIEPQTAIEGDDVTLTCRGTRYLYTDLQWKDPQNSTITNNVTALQFSP
YSISLSLSLHNVSRNHTAGYQCWAHKIHNKRAIVKTVLTVHERKRPWLRQNLTNQDVNSS
STLTMACYALGVPPPYITWYKDNLPVQEGPGISLREDGVLTIKRVKKDDEGFYECLASNG
EGSVKASAVVTVVGDEGKPNIEVIVLVCTGAAATFLWLMLILFIRKLRKSVDYKMGPSII
IDPDEFPLDEQCELLQYDSSKWEFPRDRLRLGKTLGHGAFGKVVEASAFGIDKLSTCKTV
AVKMLKGGATTNERKALMSELKILIHIGHHLNVVNLLGACTKPGGPLMMIVEYCKYGNLS
NYLRSKRADFIVYKSQDGKLVTSGSGCDLSELIKRRLESVASTGSSASSGFVEDKSYCDS
EEEEEEPEDLYKRVLTMEDLICYSFQVAKGMEFLASRKCIHRDLAARNILLSENNVVKIC
DFGLARDIYKDPDYVRKGDSRLPLKWMAPEAIFDKIYTTQSDVWSFGVLMWEIFSLGASP
YPGLHIDEEFCCRLKEGTRMRAPEYSSSEIYQTMLDCWQGESGDRPTFTELVERLGDLLQ
ASVQQEGKHYIPIAALLSKEGDPSNTSRSEETNTRPLSHRDSGSTWNIRPGSVKTFDEVT
MENSSNDNHEGGQSDSGMGLSSDDGNTLKRLESFA
NT seq 3708 nt   +upstreamnt  +downstreamnt
atggccccgctcgactgcgcgaaactgtcaatcctccttcatttgatcacatatatcacc
ggtcaggtcagcctaccggcccctcttctgcttccctctggggacacacaccttcgccac
actgggaagtcactcaccctcacctgcagaggtgccgcccaactgcactggaggctgccc
tggcgggacgtcacctcggagggggtgcgcgtggaggagtgtgagccccagctgcacacc
cactgcagtaagttgctggtgagccacctgagccccaacgacacgggcctctacagctgc
aggtacacccagccctccgccgacttcagctccacctacatctacgtcaaagatcaccag
catccgtttgtggagcaccatttccccattccatacactttgtttacatacagacatgag
gccaccctagtgattccctgtagaacaacttctcctgaccagattgtcactcttgaaggg
ctgccacccttatcagaggatatagaacaatggaaggaatgggaccccaaaataggcttc
gtgatcccatatggtccctacaaatcctttcgtctcctgacctgtgttaccaacgtcgac
ggccaacaggtccagtcgcagtacatccctctgaggcaaactaacttcctgaggaacgta
aagatcaaccctgaacgtatcaagctgttagtgggagatactctggtcctcaactgctct
gcagagaccaccttcaacggaaggatcaacttccaatgggagtacccaaagaggatggtc
aataggaaccccaccgtcaataagatcagagagaatccagctttgatcaccaggatgtac
aaagccatcaccttgtccaacatcaccatggatgacaggggcatgtacaggtgcacggcg
gagatagggaacgctgagatggggaaaaagaagcacgcctcagccaaggtcaccatctac
gaacatccatacctgaatgtgtcctataagaatgaatgggccaggagagtagtctacaca
gagggtagaaacaagctgatgtttgaacccaaggtcaatgcactgccaccaaccgacacc
atcgcatggtataaggatggcgtccccatcaacgagaactccacttgttacgagtcttca
ggctacaacctactcatcaaagacgtgaagcagaaggatgctggggtcttcaccatcgcc
ctgggcaacaaggagagaggcctctacaggaatctcagctacactctggtagtccgagtg
aggcctatgatctcagaagaggaggtggcctcggtagacgtccaaccatacatgttcggc
aagcagcaccagctaacctgcaccgcctttggagtgcccatgcccgacatcacgtggctc
tggcaaccatgccaccctgaccccaccgacaaagagtgcaccctttacactgagccaatc
ccagttcaaatggacgataaagggaactactcacacaactggattgagagcataaacaac
caaactgaactggtgaaaggaaagaacaagactgtgagtacgctagtggtgggagcggct
aacgtcacagggatctactcctgcgcagcccagaacaaacttggcacccgtacactgaga
acccccttctatgtggacgatcaccctcagcacctggccattgagccccagactgccatc
gagggtgacgacgtcactctgacctgcagggggactcggtacctgtacacagacctgcag
tggaaggaccctcagaactccaccatcaccaacaacgtcacggccctgcagttcagcccc
tactctatctctctctccctaagcctgcacaatgtgtccaggaatcacacagcaggctac
cagtgctgggcgcacaagatccacaacaagagagctatagtcaagactgtgctgactgtg
catgagaggaagaggccgtggctgagacagaacctgaccaatcaagatgtaaacagcagc
agcactctgactatggcctgctatgccctgggtgtgccgccaccctacatcacctggtac
aaagacaacctaccagtacaggagggtccaggtattagcctgagggaggatggggtgctg
acgatcaagagagtgaagaaagacgatgagggcttctacgagtgtctggccagcaacggt
gaggggagtgtgaaagccagtgctgtggtcactgtcgtgggtgatgaggggaaacccaac
attgaggttatcgtcctggtgtgtacaggagctgctgccaccttcctctggctcatgctc
atcctcttcatccgcaagctgaggaagtctgtggactataaaatgggtccatccatcatc
atcgacccagacgagtttcctctggatgagcagtgtgaactcctgcagtatgacagcagc
aagtgggagtttccccgagaccgcctcagactgggcaaaactctgggccatggagccttc
gggaaagtggtggaggcttctgcttttgggatcgacaagctctcgacctgcaagactgtg
gctgtcaaaatgctgaaaggaggagctacgacaaatgagcgcaaggctctgatgtccgag
ctgaagatcctgatccacattggtcatcatctgaacgtggtcaacctgctaggagcctgc
accaagcctggaggtccattgatgatgatagtggagtactgcaaatatggaaacttgtca
aactacttgagaagcaagagggcggatttcatcgtctataagagccaggacggtaagctg
gtgacgtcggggtcgggctgtgacctcagcgagctcatcaagcggcgcctggagagcgtg
gcaagcaccggaagctcggccagctccggctttgtggaagataagagctactgcgactca
gaggaagaggaggaagagccagaggatctgtacaagagagtattgacaatggaagatttg
atttgctacagtttccaagttgcaaaaggcatggagttcctggcttcacgcaagtgtatt
catcgtgacctggctgcaagaaacatcttactgtcggagaataatgttgtgaagatttgc
gattttggactggccagagacatctacaaagacccagactacgttcgcaaaggagattcc
agactgcccctcaagtggatggcgccagaggccatttttgacaagatctacaccactcag
agcgatgtgtggtcctttggagtcctaatgtgggagattttctctctgggtgcctctcca
tatcctggcttacacatcgacgaggagttctgctgccgactgaaggaagggaccaggatg
agagctccggaatactcctcctctgagatataccagaccatgttggactgctggcagggc
gagtcaggagaccggccaaccttcactgagctggtggagagactaggagacctgctacag
gccagtgtacagcaggagggcaagcattacatcccaatagcagccctgctgtccaaggag
ggagacccctccaacacgtcccggtcagaggagaccaacaccaggccgctctctcaccgc
gactcagggagcacctggaacatccggccgggaagtgtgaagacctttgacgaggttacc
atggagaacagctctaacgacaaccatgaggggggacagtcggacagtgggatgggcctg
tcgtctgacgatgggaacacgctgaagcgcctggaatcttttgcctga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112223875
Entry
112223875         CDS       T05605                                 

Gene name
erbb2
Definition
(RefSeq) receptor tyrosine-protein kinase erbB-2
  KO
K05083  receptor tyrosine-protein kinase erbB-2 [EC:2.7.10.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04012  ErbB signaling pathway
otw04020  Calcium signaling pathway
otw04510  Focal adhesion
otw04520  Adherens junction
otw04530  Tight junction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112223875 (erbb2)
   04012 ErbB signaling pathway
    112223875 (erbb2)
   04020 Calcium signaling pathway
    112223875 (erbb2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112223875 (erbb2)
   04520 Adherens junction
    112223875 (erbb2)
   04530 Tight junction
    112223875 (erbb2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112223875 (erbb2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112223875 (erbb2)
   04090 CD molecules [BR:otw04090]
    112223875 (erbb2)
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     112223875 (erbb2)
Protein kinases [BR:otw01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   112223875 (erbb2)
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   112223875 (erbb2)
CD molecules [BR:otw04090]
 Proteins
  112223875 (erbb2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like APH Kinase-like
Other DBs
NCBI-GeneID: 112223875
NCBI-ProteinID: XP_024242945
LinkDB
Position
24
AA seq 1306 aa
MEAARSFLFLRLLLVGLSGALGREVCLGTDMKLALPSSLENHYETLRLLYTDCQVVHGNL
EITHLRGKPDLSFLQGIVEVQGYVLIARVSVNVVPLDNLRIIRGSQLYNSSYALAVLDNT
LPQEGVGLRVLRLRSLTEILLGGVHIWGNHQLCFPDPQHMEWRDTLDEKNTHAKQLRLQA
RAPNCPKCSPACVKRSCWGETEKDCQTLTHVHCASGCLRCKGPDPNDCCHMQCAAGCTGP
KDSDCLSCRHFNDSGTCKDNCPPPTIYDPVTFVSKPNPNRKFSFGATCVKTCPYNYLAME
VACTMVCPKANQEVIITQPDGKETQTQKCEKCEGECPKVCYGLGMGDLQSSSWVSSSNVA
QFTGCNKIYGSLAFLPQSFTGDPLANMTGLTLSELDAFKNLVEITGYLYIDAWPANWTNL
SVFENLKVIRGRMLYKGVFSLGVQSIQIRSLGLRSLRSISGGLVLLHNNSQLCYTQDLPW
GTLLHPTQGPHRIVNANQDPQECVVEGRMCHLLCANGCWGPGPSQCVACVKFQRGKECVE
ECDIYQGSPREFFDNSERVCGACHSECRPINGSASCLGPGAHQCTDCLHYQDGEVCVEKC
PSGLKEEQHTVWKYSNATGHCLSCNTNCTLSCTQKDERGCPIHTKTGPGTSIAAAVGGAV
LFLILLGLLVFYLRRQKQLKRKETLRRILQEHELVEPLTPSGALPNQAQMRILKETELKK
LRVLGSGAFGTVYKGAWAPDGENVKIPVAIKVLRENTSPKANKEILDEAYVMAGVASPYV
CRLLGICLTSTVQLVTQLMPYGCLLDYVRENKDHIGSQYLLNWCVQIAKGMSYLEDVRLV
HRDLAARNVLVKNPNHVKITDFGLARLLDIDETEYHADGGKVPIKWMALESILHRKFTHQ
SDVWSYGVTVWELMTFGAKPYDLIPARDIPELLEGGERLPQPLICTIDVYMIMVKCWMIE
PDSRPKFKELVTEFSAMARDPPRYVVIQNDDKMSLSSPVDSQFFRMLLEEEGAEIRDLLD
AEEYLVPQPNFFRPQAETSGPNGPSRHHSHRSTDHGLDSEPSMAGGPRSMYSSVSTLGRS
QYPTLPMGASAISNGPWNPHYPSLLARTTSHLSTGGHSDSVFLDGGPDDAPASPGRYCKD
PTFPNGGESDLETDGPSPMHHYNHLNHHSLPRRGNAYNHNHALPEYINQEVQDLRPGAIE
RPSTLPRKGAAERHRHLPNGLSSGHSVENPEYLVPMMTSGSTSPAFDNPYYLDLVAKAVA
GGGGGGERDGGPNPPPRQVNDFVTPTAENPEYLGLADTWSGQREHT
NT seq 3921 nt   +upstreamnt  +downstreamnt
atggaggcggcgagaagtttcctgtttctccggttactgctggtcggactttcgggcgca
ttgggcagagaagtgtgcctgggcacagacatgaagctggccctgccctccagtctggag
aaccactatgagaccctgcggctgctctacactgactgccaggtggtgcacggcaaccta
gagatcacacatcttcggggcaagccggacctctccttcctacagggtatcgtggaggtg
cagggctacgtcttgattgcccgtgtgtctgtgaatgtggtgccgctggacaacctgcgc
atcatccggggaagccagctgtacaactccagctatgctctggctgtcctggataacaca
ctccctcaagaaggggtgggcctgagggtgctccgcctccgcagtctcacagagatcctg
ctgggtggagtgcatatttgggggaaccaccagctctgtttcccagacccccagcacatg
gagtggagggacacactggatgaaaagaacacgcatgccaagcagctccgcctgcaggcc
cgggcccccaactgtccaaagtgctcccctgcctgtgtaaagcgaagctgctggggagag
acagagaaagactgccagaccctgacccatgtgcactgtgcatcggggtgtctgcgctgt
aagggacctgatcccaatgactgctgccacatgcagtgtgctgccggctgcactgggccc
aaagactcagactgcctgtcgtgccgtcacttcaacgacagcgggacgtgtaaagacaac
tgtccgccccccaccatctacgacccggtcacctttgtgtccaaacccaaccccaacagg
aagttcagcttcggggccacctgcgtcaagacatgtccctataactacctagccatggag
gtggcctgtaccatggtgtgtcctaaagcgaaccaggaagtgattatcacccagcctgat
ggcaaggagacacagacacagaagtgtgagaagtgtgaaggggaatgtccaaaagtgtgc
tatgggctgggcatgggtgatctccagagctcctcctgggtgagctcctccaacgtggcc
cagttcactggctgcaataagatctatggcagtctggctttccttccacagagcttcaca
ggcgacccattggctaacatgacaggtctgacccttagtgagctggatgcatttaagaat
ttggtggagatcacaggatatctgtacattgatgcgtggccagccaactggactaacctg
agtgtgtttgagaacctgaaagtgatccgaggaaggatgctctataaaggagtgttctct
ctgggggtccagtcaatacagatccgctctctgggtctgcgttcactcaggagcatcagc
gggggtctggtcctgctccacaacaactcccagctctgctacacccaggacctgccctgg
gggaccctgctgcaccccacccaggggccccaccgaatcgtcaatgccaaccaggacccc
caggagtgtgtggtggagggccgtatgtgtcacctgctgtgtgctaatggctgctggggg
ccagggcccagccagtgtgtggcctgtgtgaaattccagcgtgggaaggaatgcgtggag
gagtgcgacatctatcagggttccccgagggagtttttcgacaactccgagagagtctgt
ggcgcctgtcactcagagtgtcgccccatcaatggctctgcctcctgcctaggcccgggg
gcccaccaatgtacagattgcctgcactaccaggacggggaggtgtgtgtggagaaatgt
cccagtgggttgaaggaggagcagcacactgtgtggaaatacagcaacgccacgggccac
tgcctctcctgcaacaccaactgcacactctcgtgcactcagaaggatgaaagaggctgc
cccatccatactaaaacagggccgggcacttcgatcgcggctgcggtgggcggggcggtg
ctcttcctcatcctattgggtctgctggtgttctacctacgccgacagaaacagctcaag
aggaaggagacattgaggaggattctccaggagcatgagctggtggagcctctgactccc
agtggagccctgcccaatcaggcccagatgcgcatcctcaaggagaccgagctaaagaag
ctaagagttctgggctcaggagccttcggcactgtttacaagggggcgtgggctcctgat
ggggagaatgtgaagatcccggtggccatcaaggttttgcgagagaacacttcgcccaag
gccaacaaggagatcctggatgaggcgtacgtaatggccggtgtggccagtccctatgtg
tgtcgtctgctgggtatctgcctgacctccacagttcagttggtcacccagctcatgcca
tacggctgcctgctggactacgtccgagagaacaaggaccacatcggctcccagtacctc
ctcaattggtgtgtgcagatagcgaaggggatgagctacctggaggatgtacgtcttgtg
cacagggacctggcagcacgtaacgtcctggtaaagaaccccaaccacgtcaagatcact
gacttcggcctggctcgcctgttggacatagacgaaacagagtaccatgctgacggaggc
aaggtgcctattaagtggatggcgttggagtctatcctccacaggaagttcacccaccag
agtgatgtgtggagctacggggtgactgtttgggagctgatgacctttggggccaagccc
tatgacctgatcccggcacgagacatcccagagctgctggaggggggcgagaggctcccc
cagccccttatctgcaccattgacgtctacatgatcatggtcaagtgctggatgattgaa
ccagacagcaggcctaaattcaaggagctggtgaccgagttcagcgccatggcacgagac
ccacctcgctacgtagtcatccagaatgatgacaagatgagtttgtccagtccggttgac
agtcagttcttcaggatgctactggaggaggagggagcagaaatcagagacctgctggat
gctgaggagtacctggtgccccagcccaacttcttcagaccccaagcggagacctcgggc
cccaacggcccctcacgacaccactcacacaggagtacggaccatggattggatagtgag
ccctccatggcgggcggcccgagaagcatgtactcctcggtgagcaccctggggcgcagc
cagtaccccactctgccaatgggggccagtgccatctccaatgggccctggaacccccat
tacccctccctcctggcccgcaccacctcacacctctctacggggggacactcggactca
gtgttcctggacgggggtcccgatgacgccccagcgagccccgggcgctattgcaaagac
cccaccttccccaatggaggagagagcgacctggagacggatggaccgtcaccgatgcat
cattataatcatcttaatcatcactcgctgccccgtaggggtaatgcgtataatcataat
cacgcgttaccagagtacatcaaccaggaggtgcaggacctccggccgggggccatcgag
cgccccagcactctgccccgcaagggggcagccgagaggcatcggcacctccccaatggc
ctgagctcgggacacagcgtggagaacccggagtacctggtccccatgatgacctccggc
tccacctcgcctgccttcgacaatccctactacctggacctagtggctaaggctgtggcc
gggggtggtggtggtggggagagggatggggggcctaaccctcctcccaggcaggtgaat
gactttgtgacgcccacggcagagaacccagagtacctgggcctagcagacacctggagc
ggccagagagagcacacctga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112226767
Entry
112226767         CDS       T05605                                 

Definition
(RefSeq) epidermal growth factor receptor-like
  KO
K04361  epidermal growth factor receptor [EC:2.7.10.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04012  ErbB signaling pathway
otw04020  Calcium signaling pathway
otw04068  FoxO signaling pathway
otw04144  Endocytosis
otw04510  Focal adhesion
otw04520  Adherens junction
otw04540  Gap junction
otw04810  Regulation of actin cytoskeleton
otw04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112226767
   04012 ErbB signaling pathway
    112226767
   04068 FoxO signaling pathway
    112226767
   04020 Calcium signaling pathway
    112226767
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112226767
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112226767
   04520 Adherens junction
    112226767
   04540 Gap junction
    112226767
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112226767
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    112226767
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112226767
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112226767
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     112226767
Protein kinases [BR:otw01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   112226767
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   112226767
  Exosomal proteins of pancreatic cancer cells
   112226767
  Exosomal proteins of bladder cancer cells
   112226767
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like PTE Kdo APH Kinase-like LapA_dom
Other DBs
NCBI-GeneID: 112226767
NCBI-ProteinID: XP_024247072
LinkDB
Position
28
AA seq 1246 aa
MKTSLKNTMATQFQIWIVFTSLVSLVSCALPEKKVCQGITNRFSLLGSKEGHYLNMVKTY
SNCTIVLENLEVTHMEDHHDLSFLRSIQEVGGYVLIALNTANRIPLDNLRIIRGHTLYND
GFALAVLMNHNKSMGAGTTELPLTSLTEILKGGVKFSGNQLCNVETIQWLDIVDIDSKPN
MQLPEPNRNRLCKNCDPGCFNGSCWAPGPEHCQTLTKLNCAQQCSKRCKGPSPIDCCNEH
CAAGCTGPRPTDCLACRDFQDDGTCKDSCPRLLLYDRNLHQLVNNPDGKYNFGATCVKTC
PHNYVVTDHGACVRTCSGDTYEVDEGGVRKCKKCDGLCPKVCNGLGMGKLDKILSINATN
IDTFKNCTKINGNIAIIYTSIHGDPFTKAPKMDPAKLDVFKTVREITGYLLIQNWPENMT
SLSPFENLEIIRGRTKHGTVSLAITQLTITHLGLRSLKEISDGDVVITRNSNLCYTKKRH
WKQLFKSDRQTIQLESNAHAAACGLQNNTCDTMCTRYGCWGPGPTMCFACQDYSRTGSCV
DSCNLLEGEPRETEVNKTCVECHPECQLLNGTQTCTGPGQEQCTQCANFKDGNNCVLGCP
RGVPGVAGGKNTFIWKYADKMKVCQLCHQNCTQGCTGPGLRGCQSIGNSGLSVIAAGVVG
GLLAFLIMGLSVFVLLRRRHIKRKRTLRRLLQERELVEPLTPSGEAPNQALLRILKETEF
KKIKVLGSGAFGTVYKGLWVPEGEDVKIPVAIKVLREATSPKANREILDEAYVMASVDNP
HVCRLLGICLTSTVQLVTQLMPYGCLLDYVKENKDNIGSQYLLNWCVQIAKGMSYLEERH
LVHRDLAARNVLVKTPQHVKITDFGLAKLLNADEKEYHADGGKVPIKWMALESILHRKYT
HQSDVWSYGVTAWELMTFGTKPYDGIPANEIAGVLEKGERLPQPPICTIDVYMIMVKCWM
IDADSRPRFRELIAEFSKMARDPPRYLVIQGDDRMHLPSPTDTKFYQSLISGEDMEEAVD
ADEYLVPQHSFFSSPSTSRTQLLHSMSQNSTLNSSIGLCQSRNENGFPVREGSMVLRYIA
DPTDRFLDHAFQPAPDYMNQNGVSDMMNPVYQHPGPPRTLLPTISSDDTETEYLNCYKNE
AVGPEYLNTLQPSLLSPTTSNGISPITSSGLTTTANSLFPMFNGLSSPSSNGLSPTSNGG
LHCVQKYQPPNSIDNPDYQQDFTPSVKTHANGHIPAAENTEYLGPN
NT seq 3741 nt   +upstreamnt  +downstreamnt
atgaagacgagtttaaaaaataccatggctacacagtttcaaatctggatcgttttcacc
tctttagtctccttggtctcgtgtgctttaccggaaaagaaagtatgccagggcatcact
aaccggttcagccttctggggtcaaaagagggccactacttgaacatggtcaagacctac
agcaattgtaccattgtcctggagaacctggaggtcacacacatggaagaccaccatgat
ctgtctttcctcaggtccattcaggaggtgggtggctatgttctgatcgccctcaacaca
gccaacaggattcccctggacaacctgcgcatcatccgaggccacactctctacaacgat
ggctttgccctggctgtgttgatgaaccataataagtcaatgggagcaggcaccaccgag
ctgcctctgaccagcctcacagagatcctgaaaggaggagtgaagttctcaggcaaccag
ctgtgtaacgtggagaccatccagtggttggacatcgtggacattgacagcaaacccaac
atgcagttacctgaacccaacagaaatcgtctctgtaaaaattgtgatcctggatgcttc
aatggttcatgttgggcgcccggcccagaacactgccagacattgacgaagctgaactgt
gcccagcagtgctctaagaggtgtaagggtccgtctcccatcgactgctgcaacgaacac
tgtgctgcaggctgcactggacccagacctacagactgtctggcctgccgggactttcag
gatgatgggacgtgtaaagactcgtgtccgcgcctcctgctctacgaccgcaaccttcac
caactagtcaacaatccagacgggaagtacaacttcggggccacctgcgtcaagacctgc
cctcataattatgtggtgacagaccatggagcgtgcgttcggacatgcagtggtgacacg
tacgaagtggacgagggaggagtcaggaagtgcaagaagtgtgatggactgtgccccaaa
gtttgcaatggacttggaatggggaaacttgacaaaattctgtcaatcaacgccaccaac
attgacacattcaaaaactgcaccaaaatcaatgggaacattgctattatctacacgtct
attcatggggacccatttaccaaagcaccaaagatggatcctgccaagctagacgttttc
aagacggtcagagaaatcactggctatctgctgattcagaactggcccgagaacatgaca
tccctaagtccctttgaaaacctggagattattagaggacggaccaaacatggtacagtg
agcttggccataacccagctaaccatcacccacctgggccttcgctcgctgaaggagatc
agcgatggagatgtggtcatcaccaggaactccaacctctgctacaccaagaagcgccac
tggaagcagctgttcaagtccgacaggcagaccatacagctggagagcaatgcccacgca
gccgcatgcgggctgcagaacaacacatgtgacacaatgtgtaccagatatggctgctgg
ggacctggacccaccatgtgtttcgcctgtcaggactacagccgaacaggaagctgtgta
gactcctgtaacctgctagagggggagccacgtgagactgaagtgaataagacgtgtgtg
gaatgtcatcctgagtgccagctcctcaatggaacccagacctgcactggaccaggccaa
gagcagtgtacccagtgcgctaacttcaaagacggcaacaactgtgtcctagggtgccct
agaggggtgccaggggtggcagggggcaagaacaccttcatctggaagtatgcagataag
atgaaggtgtgccagctgtgccaccagaactgtacccagggatgcaccggtcctggactg
agaggctgtcagtctataggtaactctggcctatcggtgatcgcggctggtgtggtgggt
gggctgcttgccttcctcatcatgggcctgtctgtctttgtgttactgaggcgacgccac
atcaagaggaagagaaccctgcgaagactactccaggagagagagttagttgaaccgttg
acccccagtggtgaggcccccaaccaggctctgctccgcattctcaaagagaccgagttt
aagaagatcaaagtgttgggatcaggggccttcggcactgtctacaagggtctgtgggtc
cctgaaggagaggacgtgaagattcctgtggccattaaggttttaagagaggccacatca
cctaaagccaacagggagatcttggacgaggcctatgtgatggccagcgtggacaacccc
catgtgtgtcgtctgctgggcatctgcctgacctccacagtgcagctggtcacccagctc
atgccctacggctgtctgctggactacgtcaaggagaacaaggacaacatcggatcccag
tacctcctcaactggtgtgtgcagatcgccaaggggatgagctacctggaggagcgtcac
ctggtgcaccgtgacctggcagcgaggaacgtcctggtgaagacccctcagcacgtcaag
atcacggactttggcctggccaaactcctcaacgctgacgagaaggagtaccacgcagac
ggaggaaaggtaccaatcaaatggatggcactggagtccatcctccacaggaaatacaca
catcagagtgatgtttggagctatggtgtgaccgcgtgggagctgatgacgtttgggacc
aagccctatgacggcatcccggccaatgagatagcaggggtgctggagaaaggggagcgg
ctgccccagccccccatctgtaccatagacgtctacatgatcatggtcaaatgctggatg
atcgacgcagacagcaggcctcgtttccgggagctgatagctgagttttccaagatggcg
cgggatcccccacgttaccttgtcatccagggtgatgaccgaatgcacctcccaagtccc
acagacaccaagttctaccagagcctaatcagtggagaggacatggaggaagctgtggac
gcagatgagtacctggtacctcagcacagcttcttctccagccccagtacctcccgtacc
cagctcctacactctatgagccaaaacagcacattgaacagcagcattggattgtgccaa
agcagaaatgagaatgggttccctgtcagagaaggaagcatggttctccggtacattgct
gaccccacagacaggttcttggaccacgccttccagccagctccagactacatgaaccag
aatggtgtgtcggacatgatgaaccctgtataccagcaccccggtccccctcgcaccctc
ctccccaccatctcctcagacgacacagagacagagtacctgaactgctataagaacgag
gcagtggggcctgagtatctcaacaccctccagccctctctcctctcccccaccacctcc
aatggcatctcccccatcacctctagtggcctcaccaccaccgccaacagccttttcccc
atgttcaatgggctctcctccccgagctccaatggcctctcccccacttccaatggcggt
ctccactgcgtccagaaataccaacccccgaacagtatagataacccagactaccagcag
gacttcaccccttccgtcaagacccatgccaatggacacatcccggccgcagagaacaca
gagtacctaggcccaaactga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112227702
Entry
112227702         CDS       T05605                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: vascular endothelial growth factor receptor 1-like
  KO
K05096  FMS-like tyrosine kinase 1 [EC:2.7.10.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04020  Calcium signaling pathway
otw04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112227702
   04020 Calcium signaling pathway
    112227702
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112227702
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112227702
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     112227702
Protein kinases [BR:otw01001]
 Receptor tyrosine kinases (RTK)
  VEGFR family [OT]
   112227702
SSDB
Motif
Pfam: Ig_3 I-set ig Ig_2 PK_Tyr_Ser-Thr VEGFR-2_TMD V-set Pkinase Ig_4 Izumo-Ig Ig_6
Other DBs
NCBI-GeneID: 112227702
NCBI-ProteinID: XP_024248291
LinkDB
Position
29
AA seq 1005 aa
MIGYIFVVLCGLVGSALAKGKVDREPKGKFSVPVLDVKSRQLVLEANQTLTIHCRGRWEL
SWAFPGGVARDQERMRLEDSRCGRQSQHYCSQLTLSSAQAQHTGSFRCRYSHRTLRQRAV
YVYVTDRQRPFVGEQNNSPDVVYMKESQPLVFPCRVTNPDATVSLVKFPDQELTPDQRNI
VWNSRQGFLIRSPTYFYIGLFSCKTSVNGTTHSLNYLTHRQVNKIMKVYLNSTSPVQSLQ
GESLAINCTVTAEWNSRVSISWDYPGQDTGQPXVSRWIMASKFHMVFYSILSIPQIHRSD
RGLYTARVTSGPVSRETNRICHSQSPPLFRLKPRQGAEVEAHAGQKSNRLSPKLRAFPCP
EVIWLKDGKVAAEECSRYHVDGNSLVIRDVVEEDAGKYTILVGIQEHRLYQNLTLSLVVN
VSPGIGEKAVSVQDPGSVPRGSRQALHCTSHGVPPPRIAWLWHPCPPKGLCVCPPSSSMW
SPVKERAPGTSTHNHILSVTHRQEVLQGKKKTVGVLMVAEAFVSGVYRCIASSSVGKDEL
DMPFYITDVPGGFSVSQEDEPREGGDLHLTCVANKHLYTNFSWQRVTDPAEATPPTPSLG
GELSSGEATPPTHSLGGELSSGEATLPTPSLGGELSSGEFSDTLSLLLSNLTAGDSGTYR
CSANHLLTGQNTHLDTQVDVTVLEAPVLLQNLSDCSVNISSSVTLSCRAHGVPRPFITWY
KDQHTLLQGSGIVIAQGGENLHIDRITVEDQGLYTCQATNERGSVESSAYIWVHNSSGGL
SLEIPTLTCTCLVATLFWLLLTLFIRKLKKPNSSSAKAEYLSIILDPGEGPLEEQCDRLQ
YDPGQWEFPRDRLKLEKPLGRGAFGKVMQASAFGIDNSTGCRTVAVKMLKEGATPSDHKA
LMTELKILNHIGHHLNVVNLLGACTKAGPLMVIVEYCRYGNLSTYLKSKRDVFLLNKVSP
SLLCSWRISSPSVSRCLEAWSSSPLASVSTVTWLPGTFCCLRTKW
NT seq 3018 nt   +upstreamnt  +downstreamnt
atgattggctatatcttcgtggttctgtgtggattggttggcagtgcgctcgcaaagggt
aaggtggatagggagcctaaggggaagttcagtgttcctgttctggatgtgaagagtcga
cagctggtcctggaggccaaccagactctgacaatccactgcaggggtcggtgggagctg
tcgtgggcattccctggaggtgtggccagagatcaggagagaatgcgattggaagattct
cggtgtggtaggcagagccagcattactgcagccaactgacgcttagctcggcccaggcc
cagcacacaggatcgttccggtgtcggtacagtcatcggacgctcaggcagagagctgtc
tatgtctatgtcacagacagacagcggccatttgtgggggagcagaataacagtccagac
gttgtgtatatgaaggagagccagcctctggtcttcccctgtagggtcaccaaccctgac
gccactgtctcattggtcaagtttcctgaccaggagttgaccccagaccagaggaacata
gtgtggaacagcagacagggcttcctcatccgcagccccacctatttctacatcggcctg
ttctcctgcaagacctctgtcaacgggaccacgcactccctcaattacctcacacacaga
caagtgaataagatcatgaaggtatatctgaacagtaccagtccagtgcagtctctacag
ggggagagtctggccatcaactgtactgtcactgcagagtggaacagcagagtgtccatc
agctgggactaccctggacaggacacaggtcagccatgagtcagtaggtggatcatggcc
agtaaatttcacatggtgttctacagtattctgtccatcccccaaatacaccgctctgac
agagggctttatactgccagagtgaccagtggaccggtcagtcgagagactaaccgtatc
tgtcacagtcagtccccccctttattccgtctgaagcccagacagggggctgaagtggag
gctcatgcaggacagaagtcaaaccgtctctcccccaaactacgagcctttccctgcccc
gaagtcatctggttgaaggatgggaaggtggcagcggaggagtgttcccgttaccatgtg
gacgggaattccctggtgatccgtgatgtggtggaggaggatgctgggaagtacactatc
ctggtgggaatccaggagcacagactctaccagaacctaacgctctctcttgtggtcaac
gtgagtcctgggataggggagaaggcagtgtcagtgcaggacccaggtagtgttccgcgg
ggtagcagacaagccctgcactgcacctcccacggagtcccccctcctcgcatcgcatgg
ctctggcacccctgcccccccaaaggcctgtgtgtgtgtcccccgtcctcctcaatgtgg
agccccgtaaaagagagggcccccggcacttccacacacaaccacatcctgagtgtcaca
cacagacaagaagtcctccaggggaagaagaagaccgtgggggttttgatggttgctgag
gcgtttgtgtccggcgtgtatcgctgtattgcctctagttctgtgggcaaggatgagctg
gacatgcctttctatataacagacgtcccaggaggcttcagtgtgagtcaggaggatgag
ccaagggagggaggagacctacacctcacctgcgtagccaataagcacctgtacaccaat
ttttcatggcaacgggtgactgacccagcagaggccacacccccgaccccctccctgggt
ggtgaactgtcctcaggagaggccacacccccgacccactccctgggtggtgaactgtcc
tcaggagaggccacactcccgaccccctccctgggtggtgaactgtcctcaggagagttt
tctgacactctgagtctattgcttagcaacctgacggcgggggattctggaacctaccgc
tgctccgccaatcacctgctgacgggacagaacacacatctggacacacaggtggacgtc
acagtactggaggctccggtgctgttacagaatctgtctgactgcagcgtgaacatcagc
agctcagtgacactcagctgccgcgcccacggagtgccacgcccattcatcacatggtac
aaggaccaacacacactgcttcagggatcaggtatcgtcatagcacaaggaggcgagaac
ctccacattgaccgaatcacagtggaggaccagggtctgtacacctgccaggcaaccaat
gagagaggctctgttgagagctccgcctacatctgggttcacaactcatcaggtggcctg
tctctggagatccctactctcacctgtacctgtctggtggccactctcttctggctgctt
ctcactctcttcatacgtaaactcaaaaagccaaactcttcgagtgccaaggctgagtac
ctttcaatcatcctggacccaggggaggggcctctggaggagcagtgtgataggctacag
tacgacccaggccaatgggagttccccagagaccgcctcaaactggagaaacctctgggc
cgtggggcctttgggaaagtcatgcaggcgtctgcctttggcatcgacaactctacaggc
tgcaggactgtggctgtcaagatgctcaaggagggggctactcccagtgaccacaaggct
ctgatgacagaactgaagatcctgaaccacatcggccaccacctgaatgtggtcaacctg
ctgggagcttgcaccaaggcagggcctctcatggtgatagtggagtactgtaggtatgga
aacctatccacctacctgaagagcaagagagacgtgttcctgctcaacaaagtgtctcca
agtctcctctgttcctggaggatctcatctccttcagtttccaggtgtctcgaggcatgg
agttcctcgcctctcgcaagtgtatccaccgtgacctggctgccaggaacattctgctgt
ctgagaacaaagtggtga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112227760
Entry
112227760         CDS       T05605                                 

Definition
(RefSeq) melanoma receptor tyrosine-protein kinase-like
  KO
K04361  epidermal growth factor receptor [EC:2.7.10.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04012  ErbB signaling pathway
otw04020  Calcium signaling pathway
otw04068  FoxO signaling pathway
otw04144  Endocytosis
otw04510  Focal adhesion
otw04520  Adherens junction
otw04540  Gap junction
otw04810  Regulation of actin cytoskeleton
otw04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112227760
   04012 ErbB signaling pathway
    112227760
   04068 FoxO signaling pathway
    112227760
   04020 Calcium signaling pathway
    112227760
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112227760
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112227760
   04520 Adherens junction
    112227760
   04540 Gap junction
    112227760
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112227760
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    112227760
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112227760
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112227760
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     112227760
Protein kinases [BR:otw01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   112227760
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   112227760
  Exosomal proteins of pancreatic cancer cells
   112227760
  Exosomal proteins of bladder cancer cells
   112227760
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like Kinase-like
Other DBs
NCBI-GeneID: 112227760
NCBI-ProteinID: XP_024248375
LinkDB
Position
29
AA seq 1195 aa
MRPETGIVIAALFCMGCCVTLTAHKKVCQGISNRLTLLATVDDHYNNLVKMYSNCTVVLE
NLELTYIQDYHDLSFLKSIQEVGGYVLIALNKAASIPLENLRLIRGHSLFLDKYALTVTS
NYEKNHSSVTLNYTRGLRELKLSGLTEILKGGVKIAHNPLLCNVETIQWWDMVNKAINHS
MHFKLESYGRYCDKCDPGCYNGSCWTSGLENCQTFTKLTCAEQCSGRCRGPKPSDCCNEH
CAAGCTGPRPTECLACRDFQDDGTCKDACPPTMLYNPNTHQLASNPNAKYTFGATCVKDC
PHNYVVTDHGACVRTCSGNTHEVEENGVRRCKKCDGICPKVCDGLGMGLLTKVLSINASN
IDSFKNCTKINGAVSIMQTSLDGDRYTSTPKMDPAKLEYFKTVKEISGFLLIQAWPEHLN
SLSPFENLEIIRGRTKQFGQVSFAALNLAHLKYLGLRSLREISDGNVVVKNNPQLCYTNG
DHWKSLFRLGKQSSTVGNNVNISTCAKLNSTCDEMCTDEGCWGPGPTMCFTCLYYTRRGR
CVRACHLQEGVPREYVLNNRCLECDPECMVNGPRSCFGPGPDKCLACAHVKDGPHCVYQC
PHGVLGDGDRHIWKYTDKKRECQLCHENCTQGCSGPGLSGCSTRGGHVLSVVVARVVGGL
LVFVVLALGVFVLLRRRHLVRKRTLRRLLQERELVEPLTPSGEAPNQALLRILKETEFKK
IKVLGSGAFGTVFKGMWIPEGENVKIPVAIKVLREATSPKANKEILDEAYVMASVEHPHV
CRLLGICLTSTVQLITQIMPYGCLLDYVKENKDNIGSQCLLNWCVQIAKGMNYLEEHHLV
HRDLAARNVLVKTPHHLKITDFGLAKLLTSDEKEYHADGGKVPIKWMALESILHWTYTHQ
SDVWSYGVTVWELMTFGSKPYDGIPAIEIAGVLEKGERLPQPPICTIDVYMIMVKCWMID
AESRPRFRELISEFSKMARDPSRYLVIQGDDRMYLPSPTEPMFYRSLISTSENMEDAEEY
LHPYKDLSTRQTTQHHNSRNGHPMRENSVILRYITDPTHGGSLEKDITDPTHGGSLEKDF
PALPEYLNQNGNTRLSDVFNPSYEDPTEPAWASRPSSGYDPDVKFFNFLPCVLEIPEYHN
MARSTLPRSVCERMDNPDYQEDFLPQATPTRSHFLPAVENLEYLGLSAAVHAPVR
NT seq 3588 nt   +upstreamnt  +downstreamnt
atgcgacctgaaactggaatagttattgctgccttgttctgcatgggctgctgcgtgaca
ctgacagcgcacaagaaagtgtgtcaggggatcagcaacaggctgacgctgctggcgact
gtagacgaccactacaacaaccttgtgaagatgtacagcaactgtaccgtggtcctggag
aacctagagctcacctacatccaggactaccacgacctctccttcctcaagtccattcag
gaggttggaggatacgttctgatcgccctcaataaggcagccagcatccctctcgagaac
ctgcgtcttatccgaggacactccctcttccttgacaagtatgccctgactgtaacatcc
aattacgagaagaatcactcctctgtgaccctcaactacacccggggcctgagggagctg
aagctgagtggactgacagagattctcaagggaggtgtgaaaattgcccacaatcctttg
ctgtgtaatgtggaaaccatccagtggtgggacatggtaaataaggccataaaccatagt
atgcacttcaaactggagagctatggccgttactgtgacaagtgtgacccgggatgctac
aatggatcatgctggacctcaggactggagaactgtcaaacctttaccaagctgacgtgt
gcagagcagtgctctggaaggtgtaggggtcctaaacccagtgactgctgtaacgaacac
tgtgctgcaggctgcaccggccctaggcctacagagtgtctggcttgtagagacttccag
gatgatggcacatgtaaggatgcctgtccccctaccatgctctacaatcccaacacccac
cagttggcttccaaccctaacgccaagtacacgttcggggccacttgtgtgaaggactgc
ccacataattatgtggtgacggaccacggggcgtgtgtcagaacgtgcagcggcaacaca
cacgaggtggaggagaatggtgtcaggaggtgcaagaagtgtgacggaatctgtccgaaa
gtttgcgatggacttggaatggggctgcttactaaagtgttgtcaatcaatgcgtctaac
attgattctttcaaaaactgcaccaaaatcaatggagctgtttcaattatgcagacatct
ttggatggtgataggtacacatcaacaccaaaaatggaccccgccaaactggaatatttc
aagactgtgaaggaaatttcagggtttttgctgatacaagcttggcccgagcacctcaac
tctctcagtccatttgaaaacctagagattatcagaggaaggaccaaacagtttggtcag
gtgagtttcgctgccctcaacttggcccatctgaagtatctaggcctccgctccctgcga
gagatcagcgatggcaatgttgtggtgaagaacaacccccagctctgctacaccaacgga
gaccactggaagagcctgtttagattgggcaaacagtcctcaacagtgggcaacaacgtc
aacatcagcacctgtgccaagctaaacagtacctgtgatgagatgtgcactgacgagggt
tgctgggggcccggccccaccatgtgttttacatgcctgtattacacccgtagggggcgc
tgtgtacgggcctgtcacctacaggagggggtgccacgagagtatgtactgaataacagg
tgtctagaatgtgacccagagtgtatggtgaatggaccacgaagctgctttggaccaggc
cctgacaaatgtttggcgtgcgctcacgtcaaagatggccctcactgtgtatatcagtgc
ccacacggcgttctcggggacggggataggcacatctggaaatacactgacaagaagcga
gaatgtcagctctgccatgagaactgcacccagggatgctctggacctggactgagtggc
tgcagcaccagaggtggtcacgttttgtcggtggtggtggccagagtggtgggaggcctc
ctagtgtttgtggtcctcgccctgggtgtttttgtgctgctccgcagacgccacctcgtc
aggaagaggacactgcgccgtctgctgcaggagagagagttggttgaacccctgacccca
agtggagaggcacccaaccaggccctgctccgcattctgaaggaaactgagtttaagaag
atcaaagtgttgggatcaggggcctttggaactgtctttaagggcatgtggattcctgag
ggagaaaacgtgaagatccctgttgccattaaggtgttgagagaggccacttcaccaaaa
gccaacaaggagattctagacgaggcctatgtgatggctagcgtggagcacccccatgtg
tgtcgtctactgggcatctgcctgacatccacggtgcagctcatcacccagatcatgccc
tacggctgtctgctggactatgtcaaggagaacaaggacaacattggctcccagtgcctg
cttaactggtgtgtgcaaatcgccaagggtatgaactacctggaggagcatcacctggtg
caccgtgacctggcggccaggaacgttctggtgaagacgcctcaccacctcaagatcacc
gattttggactggccaagctgctcacctcagacgagaaggagtaccacgcagatgggggc
aaggtgcccataaagtggatggcactggagtccatccttcactggacctatacacatcag
agcgatgtgtggagctacggtgtgacagtgtgggagctgatgacgtttgggtccaagccc
tatgatggcatcccggccattgagatagctggagtcctggagaaaggagagcgcctgccc
cagccccccatctgtaccatagacgtctacatgatcatggtcaaatgctggatgatcgat
gcagagagcagaccacggttcagggagctcatctcagagttctccaaaatggcccgggat
ccatctcgctatctggtcattcagggggatgatcgcatgtacctgcccagtcccacggaa
cctatgttctaccgtagcctgatcagtacatcagagaacatggaggatgctgaggagtat
cttcacccctataaggatctctccaccagacagaccacccagcaccacaactctaggaat
ggccatccaatgagagagaacagtgtgatccttcgctacatcacagatcccacccacggt
ggttctctagagaaggacatcacagaccccacccatggtggttctctagagaaagatttc
ccagctcttccagaataccttaaccagaacgggaacaccaggctctctgacgtcttcaac
cccagctatgaggaccccactgagccagcctgggctagtaggccctcctctgggtacgac
ccagacgtcaagttcttcaacttcctgccgtgcgtgctggagatccctgagtaccacaac
atggcccgcagtaccctccctcgctccgtctgcgagcgcatggacaacccagactaccag
gaggacttcctgcctcaggccacacccaccagaagtcacttcctgcctgcagtagagaac
ctggagtacctcgggttgagcgctgctgtacatgcccctgtacgctag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112229041
Entry
112229041         CDS       T05605                                 

Definition
(RefSeq) platelet-derived growth factor receptor beta-like isoform X1
  KO
K05089  platelet-derived growth factor receptor beta [EC:2.7.10.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04020  Calcium signaling pathway
otw04510  Focal adhesion
otw04540  Gap junction
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112229041
   04020 Calcium signaling pathway
    112229041
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112229041
   04540 Gap junction
    112229041
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112229041
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112229041
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:otw04090]
    112229041
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     112229041
Protein kinases [BR:otw01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   112229041
CD molecules [BR:otw04090]
 Proteins
  112229041
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase I-set Ig_3 ig Ig_2 V-set Ig_6 C2-set_2
Other DBs
NCBI-GeneID: 112229041
NCBI-ProteinID: XP_024250692
LinkDB
Position
30
AA seq 1112 aa
MWRGTLPRVLSIHTGTMELGLAKSLPLVAIFTVLLQFCPEGFSLELSPSEKEVILSTNSS
FTVVCSGWSKVTWKSPHDPSLEGVAVEDRGTTSVLVLHNVTWRHSGNYVCEEPSTEEAKD
ISVFVPDPEEWFLPLQQAVVMKEGEEGTIPCVVTDPGINVTLYERASKASVEGTYHPSKG
FTAILKDSSYICRGAMNGEEKASQVYYVYSIVVPKSMNAFMTLSKTVLKQGEALMVNCTV
EEAEMVYFEWDFPRKETIEPLTDFLSEIRIRSFLNISSVTLEDSGQYICRVQDPFSGTSA
MDNLTVTVLERGFVDLEPSINTNVSALQYQSVALTVQIEAFPKPQVLWTRDNTTLTGETV
SIDTREVHETSYLSTLTLVRVRMEQRGLYTVQVANEDDVKEITFDLQVKSSPKIIDLSDQ
HIDQGHGVLCVTEGVPTPTVHWYSCESIGKCSNKTTAWKSLSADQENVSIQMNVSYIEAS
GVNQVRSLLTFQTMGGITSVRCEARNERGRRAWDIKLVSNSLFSQVAVLAAVLALVVIAV
IFLIILIALWRKKPRYEIRWKVIESVSSDGHKYTYMDPMHLPYDCVWEVPRDSLVLGHTL
GSGAFGRVVEATAYGLGHSQSTTKVAVKMLKSTARTSETQALISELKIMSHLGPHLNIVN
LLGACTKRGPIYLITEYCCYGDLVDYLHRNKHTFLQYYADKNRRDADMCRNSTESTVQIQ
GKSECDGGYMDMTKEDSLNYVPMQELSDNIKYADIEPSVNETPYHQDSNYQGQGQERADV
ALSISDSPILSYTDLVGFSYQVAKGMDFLASKNCVHRDLAARNVLICEGKLVKICDFGLA
RDVMNDSNYIAKGKTFLPLKWMAPESIFQNLYTTLSDVWSFGILLSEIFTLGGTPYPGIP
MNEQFYTALKRGYRMPKPAHATDEIYDIMCKCWDEKFKKRPLFSSLVNLTGNLLTDAYKK
KYTQVNESFLKSDHHAAIRSKPIPAGNPAVSSDDHSSGDRTGQETGEIEETGTEAGPSQT
DYIIAIPDIHVAEEAEAGGEVLDTATQSTSSPPSTTDQADTASLDGPEAPLEEPVPTEEA
VLAPTEEAVLAPTQEDKLPQSPCVPEVEESFL
NT seq 3339 nt   +upstreamnt  +downstreamnt
atgtggagaggaactctcccaagagtgttatcaattcacactggcactatggagttgggc
ttggcaaagtctctgcctttggtggccatctttacagtgctgctgcagttttgtccagag
ggcttcagtctggagctcagccccagtgagaaggaggtcatactgagcaccaactcctcc
ttcacggtggtctgttctggttggagcaaggtgacctggaagtctccccacgaccccagc
ctggagggagtggctgtggaggacaggggaaccaccagtgtgctggtcctccacaatgtc
acctggaggcactctgggaactatgtctgtgaagagccctctacagaggaggccaaggac
atatcggtgtttgtaccagaccctgaggaatggtttcttcccctgcagcaagcagtagtg
atgaaggagggagaggaaggtaccattccctgcgtggtgactgaccctggcattaatgtg
accctgtacgagagggccagcaaggccagtgtggagggaacataccaccccagtaaaggg
ttcaccgccatcctgaaagacagctcctacatctgccgaggtgccatgaacggagaggag
aaggcgtcccaggtgtattatgtctacagcattgtggtccccaaatccatgaacgccttc
atgacactctcaaagacggtgctgaaacaaggcgaggccttaatggttaattgtactgta
gaagaagcagagatggtttacttcgaatgggattttcctcgtaaagagacaattgagcca
ctgacagactttctatcggagattagaatccgctccttcttgaacatctccagtgttact
ctggaggactctggccagtacatctgccgagtgcaggaccctttttccggaacgtcagcc
atggataatctcactgtcactgttctggaacggggctttgtggatttggaaccctccatc
aacaccaatgtttcagcgctgcagtatcagagcgttgcgctcacagtgcagatcgaagcg
tttcccaaacctcaggtgctctggaccagagacaacaccacccttactggggaaactgta
tccattgacaccagagaggtgcatgagaccagttacctcagtactctgaccttggtaagg
gtccggatggaacagagggggctctacactgtccaggtggccaatgaagacgacgtcaag
gagataacctttgatcttcaagtcaagtcttccccgaagataatagatttgtctgaccag
cacatagaccagggccacggagtgctctgtgtcacagagggggtccccacacccaccgtc
cactggtacagctgtgaaagcattggaaaatgcagtaataagaccacagcatggaagtct
ctgtcggctgaccaagagaacgtcagcatccagatgaacgtcagctacatcgaggcctca
ggggtcaaccaagtccgcagccttttgaccttccagaccatggggggtattacatcagta
cgctgtgaagcccgcaacgagagagggcgcagggcctgggacatcaaactggtctccaac
tctctgttctcccaggtggctgtcttggctgcagtgttagccctggtggtcattgccgtc
atcttcctcatcatcctcatcgccctttggagaaagaagccccggtatgagatccgttgg
aaggtgatcgagtcagtgagctcagatggccataagtacacctacatggaccccatgcac
ctgccatatgactgtgtatgggaggttccccgggatagcctggtcctgggtcacactctg
ggttctggagcatttgggagggtcgtggaggccacagcctatggccttggtcactctcag
tccaccaccaaagtggctgtgaagatgctcaagtctacagcaaggacaagtgagactcag
gctctgatatctgagctgaagataatgagtcaccttgggccccatctaaacatcgtcaac
ctactgggggcttgtacgaaacgaggtcccatttacctcataactgagtactgttgctat
ggtgacctggttgactaccttcaccgcaacaagcataccttcctgcagtactacgcagac
aaaaaccgcagggatgctgatatgtgcaggaacagcacagagagtacagtccaaatccaa
ggaaaaagtgagtgcgatgggggttacatggacatgaccaaggaagattctttaaattat
gtcccaatgcaagagctgagtgacaacatcaagtatgcagacatcgagccctcagtcaat
gagacaccctaccatcaggacagcaactaccaaggacaaggccaagagagagcagacgtc
gcgttgtctatcagtgactccccaattctgagctacacagatctggtgggctttagctac
caagtggctaagggcatggacttcctggcatccaagaattgtgttcatcgtgacctggct
gccagaaatgttctcatctgcgagggaaagctggtgaagatctgtgactttggcctggcc
cgtgatgtcatgaacgactccaactacatagccaaaggcaaaacattcctgccactgaag
tggatggctccagagagtatcttccagaacctctacacaaccttgagcgatgtttggtct
tttggcattctgctttcagagatctttactctaggaggaacgccctatcctggcattccc
atgaatgagcagttctacactgccttgaagagaggctacaggatgcctaaacctgctcat
gctacagacgagatctatgatatcatgtgcaagtgttgggatgagaaattcaagaagagg
ccactcttctcctctctggttaatttgacgggaaacctgctgactgatgcttacaaaaag
aaatacacccaggtgaatgagagctttctgaagagcgaccaccatgctgcaatcaggtcc
aaacctataccagcagggaacccggctgtgtcttcagatgaccactcctcaggggatcga
acgggtcaggagacaggggagatagaggagactgggacggaggctggcccctcccagact
gactacataatcgccatcccagatatccatgtagccgaagaggcagaagcaggtggtgag
gtgctggacaccgccacacagagtacatcaagtcctccaagcacaaccgaccaggctgat
acagcctccctggatggaccagaagcacccctagaagaaccagtacccacagaggaagcg
gtgcttgcccccacagaggaagcggtgcttgcccccacgcaagaagacaagctcccccag
tctccatgtgtccctgaagtggaggagagtttcctgtag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112232691
Entry
112232691         CDS       T05605                                 

Definition
(RefSeq) melanoma receptor tyrosine-protein kinase-like isoform X1
  KO
K04361  epidermal growth factor receptor [EC:2.7.10.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04012  ErbB signaling pathway
otw04020  Calcium signaling pathway
otw04068  FoxO signaling pathway
otw04144  Endocytosis
otw04510  Focal adhesion
otw04520  Adherens junction
otw04540  Gap junction
otw04810  Regulation of actin cytoskeleton
otw04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112232691
   04012 ErbB signaling pathway
    112232691
   04068 FoxO signaling pathway
    112232691
   04020 Calcium signaling pathway
    112232691
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112232691
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112232691
   04520 Adherens junction
    112232691
   04540 Gap junction
    112232691
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112232691
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    112232691
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112232691
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112232691
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     112232691
Protein kinases [BR:otw01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   112232691
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   112232691
  Exosomal proteins of pancreatic cancer cells
   112232691
  Exosomal proteins of bladder cancer cells
   112232691
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like APH
Other DBs
NCBI-GeneID: 112232691
NCBI-ProteinID: XP_024255644
LinkDB
Position
Unknown
AA seq 1202 aa
MRPGSGIVIAALFSLGCSMTLTADKKVCQGISNRLTLLGTVDDHYNNLVRMYSNCTVVLE
NLELTYIQEYHDLSFLKSIQEVGGYVLIAVNKAAIIPLENLRLIRGHSLYDNKYALAVMS
NYEKNHSSVTLNYTRGLRELMLRGLTDILKGGVKIAHNPLLCNVETIQWWDMVNKAGNPS
MDFKLESYGRYCGKCDPGCYNGSCWTPGPENCQTFTKLKCAEQCSGRCRGPKPSDCCNEH
CAAGCTGPRPTECLACRDFQDDGTCKDACPPTMIYNPNTHQLASNPNAKYTFGATCVKTC
PHNYVVTDHGACVRTCSGNTHEVEENGVRRCKKCDGICPKVCNGLGMGPLTAVLSINASN
IDSFKNCTKINGDVSIIGTSLNGDRYTSTPKMDPAKLDYFRTVKEISGFLLIQAWPKHLD
SLSAFENLEIIRGRTKQFGQVSFAALNVAHLKYLGLRSLREISDGNIVVKNNPHLCYSNG
GHWNGLFRLDKQFARVDNNANISTCAQLNSTCDDMCTKEGCWGPGPTMCLTCLYYARRGR
CVGACHVLEGTPREYVLNNICLECDQECMVKNRTGSCFGSGPDKCVECAHVKDGPHCVYR
CPRGVLGDVDRPIWKYADKNRECQLCHENCTDGCSGPGLNGCNARGGSVPSAVAASVVGG
LLVFVVLALGVFVLVRRRHIVRKRTLRRLLQERELVEPLTPSGEAPNQALLRILKETEFK
KIKVLGSGAFGTVFKGVWIPEGENVKIPVAIKVLREATSPKANKEILDEAYVMASVEHPH
VCRLLGICLTSTVQLITQIMPYGCLLDYVKENKDLIGSQCLLNWCVQIAKGMNYLEERHL
VHRDLAARNVLVKTPHHLKITDFGLAKLLTADEKEYHADGGKVPIKWMALESILHWTYTH
QSDVWSYGVTLWELMTFGSKPYDGIPAREISGVLEKGERLPQPPICTIDVYMIMVKCWMI
DADSRPRFRELISEFSKMARDPSRYLVIQGDDCMYLPSPTDSKFYRSLISTSEDMEDVVD
AEEYLLPDKTTQHHNSGNGHLMRENSVILRYITDPTHGGSLEKDLTDPTHRGSLKKDITD
PTHGGSLEQDLAALPEYMNQNTKLSDVFNPNYEDPSVPAWATRTSSGYDPDNKFFNSLPR
VPEGPEYLNMARSTLPRSVCESNPDYQEDFLPQATPTSSHFLPAAENLEYLGLSAAVHTP
VR
NT seq 3609 nt   +upstreamnt  +downstreamnt
atgcgacctggaagtggaatagttattgctgccttgttcagcctgggctgcagcatgaca
ctgacagcggacaagaaagtgtgtcaggggatcagcaacaggctgacgctgctggggact
gtagacgaccattacaacaacctggtgaggatgtacagcaactgtaccgtggtcctggag
aacctagagcttacctacatccaggagtaccacgacctctccttcctcaagtccattcag
gaggttggaggctatgttctgatcgccgtcaacaaggcagccatcatcccactggagaac
ctgcgtctgatccgaggacactccctctacgacaacaagtatgccctggctgtcatgtcc
aactacgagaagaaccactcctctgtgacccttaactacacacggggcctaagggagctg
atgctgagaggactgacagacattctcaagggaggggtgaaaattgcccacaatcctttg
ttgtgtaatgtggagaccatccaatggtgggacatggtaaacaaggccggcaaccccagt
atggatttcaaactggagagctatggccgttactgtggcaagtgtgaccctggatgctac
aatggatcatgctggacaccaggaccagagaactgtcaaacatttaccaagctgaagtgt
gcagagcagtgctctggaaggtgtaggggtcctaaacctagtgactgctgtaacgaacac
tgtgctgcagggtgcaccggccctaggcctacagagtgtctggcctgcagagacttccag
gatgatggcacatgtaaggatgcctgccctcctaccatgatctacaatcccaacacccac
cagctggcttccaaccctaacgccaagtacacgttcggggccacttgtgtgaagacctgc
ccacataactatgtggtgacggaccacggggcgtgtgtccgaacatgcagtggcaacaca
cacgaggtggaggagaatggtgtcaggaggtgcaagaagtgtgacggaatctgtccaaaa
gtgtgcaatggacttggaatggggccgcttactgccgtcttgtcaatcaacgcctctaac
attgattctttcaaaaactgcaccaaaatcaatggcgatgtttcaataattggaacctct
ttgaatggtgataggtacacatcaacaccaaaaatggaccctgccaaactggattatttc
agaactgtgaaggaaatttcagggtttctgctcatacaagcttggccaaagcacctcgat
tctctcagtgcatttgaaaacctggagattatcaggggaaggaccaaacagtttggtcag
gtgagttttgctgccctgaacgtggcccatctgaagtatctaggcctccgctccctacga
gagatcagcgatggcaacattgtggtgaagaacaacccccacctctgctacagcaacgga
ggccactggaatggcctgttcagactggacaaacagtttgcaagggtggacaacaacgcc
aacatcagcacatgtgcccagctgaacagtacctgtgatgacatgtgcactaaggagggc
tgctgggggcccggtccaaccatgtgcttaacctgcctgtactacgcccgtaggggccgc
tgtgtgggggcctgtcacgtactggaggggacaccaagagagtatgtgttgaacaacata
tgcctagagtgtgaccaagaatgtatggtgaagaacagaaccggaagctgctttggatct
ggccctgacaagtgtgtggagtgcgcccacgtcaaagatggcccccactgtgtctatcgg
tgcccacgcggcgttctcggggacgtggacaggcccatctggaaatacgctgacaagaac
agagaatgtcagctctgccatgagaactgcaccgacggatgctctggacctggactgaat
ggctgcaatgccagaggtggttctgtcccatcggcagtggctgccagtgtggtgggaggc
ctcctggtgtttgtggtcctggccttgggtgtgttcgtgctagtccgcagacgtcacatc
gtcaggaagaggacgctgcgccgcctgctgcaggaaagagagttggttgaacccctgacc
ccaagtggagaggcacccaaccaggccctgctccgcattctgaaggagaccgagtttaag
aagatcaaagtgttgggatcaggggcctttgggactgtctttaagggcgtgtggattcct
gagggagaaaacgtgaagatccctgttgccattaaggtgttgagagaggccacatctccc
aaagccaacaaggagattctagacgaggcctatgtgatggccagtgtggagcacccccac
gtatgtcgtcttctgggcatctgcctgacgtccacggtgcagctcatcacccagatcatg
ccctacggctgtctgctggactatgtcaaggagaacaaggacctcattggctcccagtgc
ctactcaactggtgtgtacagatcgcaaagggtatgaactacctggaggagcgtcacctg
gtgcaccgtgacctggcggccaggaacgttctggtgaagacgcctcaccatttgaagatc
acggactttggactggccaagctgctcaccgccgacgagaaggagtaccacgctgatggg
ggaaaggtgcccataaagtggatggcactggagtccatccttcactggacctatacccat
cagagtgatgtgtggagctacggtgtgacattgtgggagctgatgacatttgggtcgaag
ccctacgatggcataccggccagggagatctctggagtcctggagaaaggagagcgccta
cctcagccccccatctgtaccatagacgtctacatgatcatggtcaaatgctggatgatc
gatgcagacagcagaccacggttcagggagctcatctctgagttctccaaaatggcccgg
gatccatctcgctatctggtcattcagggagatgattgcatgtacctgcccagtcccacg
gactctaagttctaccgtagcctgatcagtacatcagaggacatggaggatgtggtcgat
gccgaggagtatcttctccccgacaagaccacccagcaccacaactcagggaatggccat
ctgatgagagagaacagtgtgatccttcgctacatcacagaccctacccacggtggttct
ctagagaaagacctcacagaccccacccacagaggttctctaaagaaagacatcacagac
cccacccacggtggttctctagagcaagatctcgctgctcttccagaatacatgaaccag
aacaccaagctctctgatgtcttcaaccccaactatgaggaccccagcgtgccagcctgg
gcaactcggacctcctctgggtacgacccggacaacaagttcttcaactccctgccacgt
gtgccggagggacccgagtatctgaacatggcccgcagtaccctccctcgctctgtatgc
gagagcaacccagactaccaggaggacttcctacctcaggccacacccaccagtagtcac
ttcctgcccgcagcagagaacctggagtacctcggattgagcgctgctgtacacacccct
gtacgctag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112233568
Entry
112233568         CDS       T05605                                 

Definition
(RefSeq) melanoma receptor tyrosine-protein kinase-like
  KO
K04361  epidermal growth factor receptor [EC:2.7.10.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04012  ErbB signaling pathway
otw04020  Calcium signaling pathway
otw04068  FoxO signaling pathway
otw04144  Endocytosis
otw04510  Focal adhesion
otw04520  Adherens junction
otw04540  Gap junction
otw04810  Regulation of actin cytoskeleton
otw04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112233568
   04012 ErbB signaling pathway
    112233568
   04068 FoxO signaling pathway
    112233568
   04020 Calcium signaling pathway
    112233568
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112233568
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112233568
   04520 Adherens junction
    112233568
   04540 Gap junction
    112233568
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112233568
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    112233568
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112233568
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112233568
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     112233568
Protein kinases [BR:otw01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   112233568
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   112233568
  Exosomal proteins of pancreatic cancer cells
   112233568
  Exosomal proteins of bladder cancer cells
   112233568
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like Kinase-like
Other DBs
NCBI-GeneID: 112233568
NCBI-ProteinID: XP_024257072
LinkDB
Position
Unknown
AA seq 1195 aa
MRPETGIVIAALFCMGCCVTLTAHKKVCQGISNRLTLLATVDDHYNNLVKMYSNCTVVLE
NLELTYIQDYHDLSFLKSIQEVGGYVLIALNKAASIPLENLRLIRGHSLFLDKYALTVTS
NYEKNHSSVTLNYTRGLRELKLSGLTEILKGGVKIAHNPLLCNVETIQWWDMVNKAINHS
MHFKLESYGRYCDKCDPGCYNGSCWTSGLENCQTFTKLTCAEQCSGRCRGPKPSDCCNEH
CAAGCTGPRPTECLACRDFQDDGTCKDACPPTMLYNPNTHQLASNPNAKYTFGATCVKDC
PHNYVVTDHGACVRTCSGNTHEVEENGVRRCKKCDGICPKVCDGLGMGLLTKVLSINASN
IDSFKNCTKINGAVSIMQTSLDGDRYTSTPKMDPAKLEYFKTVKEISGFLLIQAWPEHLN
SLSPFENLEIIRGRTKQFGQVSFAALNLAHLKYLGLRSLREISDGNVVVKNNPQLCYTNG
DHWKSLFRLGKQSSTVGNNVNISTCAKLNSTCDEMCTDEGCWGPGPTMCFTCLYYTRRGR
CVRACHLQEGVPREYVLNNRCLECDPECMVNGPRSCFGPGPDKCLACAHVKDGPHCVYQC
PHGVLGDGDRHIWKYTDKKRECQLCHENCTQGCSGPGLSGCSTRGGHVLSVVVARVVGGL
LVFVVLALGVFVLLRRRHLVRKRTLRRLLQERELVEPLTPSGEAPNQALLRILKETEFKK
IKVLGSGAFGTVFKGMWIPEGENVKIPVAIKVLREATSPKANKEILDEAYVMASVEHPHV
CRLLGICLTSTVQLITQIMPYGCLLDYVKENKDNIGSQCLLNWCVQIAKGMNYLEEHHLV
HRDLAARNVLVKTPHHLKITDFGLAKLLTSDEKEYHADGGKVPIKWMALESILHWTYTHQ
SDVWSYGVTVWELMTFGSKPYDGIPAIEIAGVLEKGERLPQPPICTIDVYMIMVKCWMID
AESRPRFRELISEFSKMARDPSRYLVIQGDDRMYLPSPTEPMFYRSLISTSENMEDAEEY
LHPYKDLSTRQTTQHHNSRNGHPMRENSVILRYITDPTHGGSLEKDITDPTHGGSLEKDF
PALPEYLNQNGNTRLSDVFNPSYEDPTEPAWASRPSSGYDPDVKFFNFLPCVLEIPEYHN
MARSTLPRSVCERMDNPDYQEDFLPQATPTRSHFLPAVENLEYLGLSAAVHAPVR
NT seq 3588 nt   +upstreamnt  +downstreamnt
atgcgacctgaaactggaatagttattgctgccttgttctgcatgggctgctgcgtgaca
ctgacagcgcacaagaaagtgtgtcaggggatcagcaacaggctgacgctgctggcgact
gtagacgaccactacaacaaccttgtgaagatgtacagcaactgtaccgtggtcctggag
aacctagagctcacctacatccaggactaccacgacctctccttcctcaagtccattcag
gaggttggaggatacgttctgatcgccctcaataaggcagccagcatccctctcgagaac
ctgcgtcttatccgaggacactccctcttccttgacaagtatgccctgactgtaacatcc
aattacgagaagaatcactcctctgtgaccctcaactacacccggggcctgagggagctg
aagctgagtggactgacagagattctcaagggaggtgtgaaaattgcccacaatcctttg
ctgtgtaatgtggaaaccatccagtggtgggacatggtaaataaggccataaaccatagt
atgcacttcaaactggagagctatggccgttactgtgacaagtgtgacccgggatgctac
aatggatcatgctggacctcaggactggagaactgtcaaacctttaccaagctgacgtgt
gcagagcagtgctctggaaggtgtaggggtcctaaacccagtgactgctgtaacgaacac
tgtgctgcaggctgcaccggccctaggcctacagagtgtctggcttgtagagacttccag
gatgatggcacatgtaaggatgcctgtccccctaccatgctctacaatcccaacacccac
cagttggcttccaaccctaacgccaagtacacgttcggggccacttgtgtgaaggactgc
ccacataattatgtggtgacggaccacggggcgtgtgtcagaacgtgcagcggcaacaca
cacgaggtggaggagaatggtgtcaggaggtgcaagaagtgtgacggaatctgtccgaaa
gtttgcgatggacttggaatggggctgcttactaaagtgttgtcaatcaatgcgtctaac
attgattctttcaaaaactgcaccaaaatcaatggagctgtttcaattatgcagacatct
ttggatggtgataggtacacatcaacaccaaaaatggaccccgccaaactggaatatttc
aagactgtgaaggaaatttcagggtttttgctgatacaagcttggcccgagcacctcaac
tctctcagtccatttgaaaacctagagattatcagaggaaggaccaaacagtttggtcag
gtgagtttcgctgccctcaacttggcccatctgaagtatctaggcctccgctccctgcga
gagatcagcgatggcaatgttgtggtgaagaacaacccccagctctgctacaccaacgga
gaccactggaagagcctgtttagattgggcaaacagtcctcaacagtgggcaacaacgtc
aacatcagcacctgtgccaagctaaacagtacctgtgatgagatgtgcactgacgagggt
tgctgggggcccggccccaccatgtgttttacatgcctgtattacacccgtagggggcgc
tgtgtacgggcctgtcacctacaggagggggtgccacgagagtatgtactgaataacagg
tgtctagaatgtgacccagagtgtatggtgaatggaccacgaagctgctttggaccaggc
cctgacaaatgtttggcgtgcgctcacgtcaaagatggccctcactgtgtatatcagtgc
ccacacggcgttctcggggacggggataggcacatctggaaatacactgacaagaagcga
gaatgtcagctctgccatgagaactgcacccagggatgctctggacctggactgagtggc
tgcagcaccagaggtggtcacgttttgtcggtggtggtggccagagtggtgggaggcctc
ctagtgtttgtggtcctcgccctgggtgtttttgtgctgctccgcagacgccacctcgtc
aggaagaggacactgcgccgtctgctgcaggagagagagttggttgaacccctgacccca
agtggagaggcacccaaccaggccctgctccgcattctgaaggaaactgagtttaagaag
atcaaagtgttgggatcaggggcctttggaactgtctttaagggcatgtggattcctgag
ggagaaaacgtgaagatccctgttgccattaaggtgttgagagaggccacttcaccaaaa
gccaacaaggagattctagacgaggcctatgtgatggctagcgtggagcacccccatgtg
tgtcgtctactgggcatctgcctgacatccacggtgcagctcatcacccagatcatgccc
tacggctgtctgctggactatgtcaaggagaacaaggacaacattggctcccagtgcctg
cttaactggtgtgtgcaaatcgccaagggtatgaactacctggaggagcatcacctggtg
caccgtgacctggcggccaggaacgttctggtgaagacgcctcaccacctcaagatcacc
gattttggactggccaagctgctcacctcagacgagaaggagtaccacgcagatgggggc
aaggtgcccataaagtggatggcactggagtccatccttcactggacctatacacatcag
agcgatgtgtggagctacggtgtgacagtgtgggagctgatgacgtttgggtccaagccc
tatgatggcatcccggccattgagatagctggagtcctggagaaaggagagcgcctgccc
cagccccccatctgtaccatagacgtctacatgatcatggtcaaatgctggatgatcgat
gcagagagcagaccacggttcagggagctcatctcagagttctccaaaatggcccgggat
ccatctcgctatctggtcattcagggggatgatcgcatgtacctgcccagtcccacggaa
cctatgttctaccgtagcctgatcagtacatcagagaacatggaggatgctgaggagtat
cttcacccctataaggatctctccaccagacagaccacccagcaccacaactctaggaat
ggccatccaatgagagagaacagtgtgatccttcgctacatcacagatcccacccacggt
ggttctctagagaaggacatcacagaccccacccatggtggttctctagagaaagatttc
ccagctcttccagaataccttaaccagaacgggaacaccaggctctctgacgtcttcaac
cccagctatgaggaccccactgagccagcctgggctagtaggccctcctctgggtacgac
ccagacgtcaagttcttcaacttcctgccgtgcgtgctggagatccctgagtaccacaac
atggcccgcagtaccctccctcgctccgtctgcgagcgcatggacaacccagactaccag
gaggacttcctgcctcaggccacacccaccagaagtcacttcctgcctgcagtagagaac
ctggagtacctcgggttgagcgctgctgtacatgcccctgtacgctag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112249110
Entry
112249110         CDS       T05605                                 

Gene name
pdgfra
Definition
(RefSeq) platelet-derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04020  Calcium signaling pathway
otw04144  Endocytosis
otw04510  Focal adhesion
otw04540  Gap junction
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112249110 (pdgfra)
   04020 Calcium signaling pathway
    112249110 (pdgfra)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112249110 (pdgfra)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112249110 (pdgfra)
   04540 Gap junction
    112249110 (pdgfra)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112249110 (pdgfra)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112249110 (pdgfra)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:otw04090]
    112249110 (pdgfra)
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     112249110 (pdgfra)
Protein kinases [BR:otw01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   112249110 (pdgfra)
CD molecules [BR:otw04090]
 Proteins
  112249110 (pdgfra)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase I-set Ig_3 ig Ig_2 V-set Receptor_2B4 C2-set_2 Kinase-like
Other DBs
NCBI-GeneID: 112249110
NCBI-ProteinID: XP_024274534
LinkDB
Position
1
AA seq 1466 aa
MDEMKRCLIIGVVLFGLLSVTCGLTPPTIVSTEDEFVLEPLSVFNISCTSKRNVAWVEPL
PVNTFVLPGFYMATLFIYNASVTHTGYYICKYQDEEGDEEDDEDNEAVIYVFVPDPKVPF
VPEEPGSMVVLVYPGETIIPCRVSDPRSPVVLKSVPSGVEVDAAYDNKIGFIGNLDAGLY
VCETIVNGVTMTSDIYTVKDNKLMEDFHVEVKASEEAVRLGEPFNITCVAPPGLPYQQQW
LHPMKQAVDAVQLKQALPDRVVYTLSIPAASSQDSGVYECSITNNFSGEIRANMVAVTVF
EENSFVMLDHSGIGAVEFVSMMEDTEFTISIEAFPAPKVTWLKDGIAITENSYFLTKTRR
LAGNHYQSTLTLRQSLEKDSGNYTVVVLSSAHTAQFSFTLKVKESGPVLFQPASAPVLFP
QREEWIVPLHTPFTLTCRGEAELAWDTPVYLSEQTEEDNSGLFITTVTVENATAGHTGFY
TCFYKGGNSTEEGEDSSIYIYVPDPEVPFVPSLVPFGNHVLNGHDEMEIQCRVSDPGANV
TLVNADTQQAVPMVVYDSKRGAVGFFSAGTYVCKALVNGEEHLSEEYIVHGWAGGSELRV
ELKAQKTALLVGDTITVICVARGSEILEDHWKYPGKLVDRGLKSVRENKRDQEIQYTLTV
PQASAKDSGIYVCSITDIISNENQTKKLAITVYERPFVSLRPAFSSQESADLDEVRQFQA
DIDSFPSAQVTWLKDGLPLNDVAAEITTSLRQVSETRYQSVLTLIRAKEEDSGNYTIRVQ
NGNQTHSHNFSLQVKVPAVIVDLMDLHHGSASGQSVVCIAGGMPTPKVEWFICKNIKHCA
NDSSEWVPLPTNNTEITVEAHIDQDNQLESQVIFGHLENTLAVRCLARNEMATVSREVKL
VSQDPHSELTVAAAALVLLVFVIISLIVLVIIWKQKPRYEIRWRVIESVSPDGHEYIYVD
PMQLPYDSRWEFSRDGLVLGRILGSGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSS
EKQALMSELKIMTHLGPHLNIVNLLGACTKSGPTYIITEYCFYGDLVNYLHKNRENFVSV
HPEKTKKDLDIFGINPADESSRSYVILSFESGKGDYMDMKQADTTQYVPMLEMSDASKYS
DIQRSEYNHPPSQKGDSEMDNMLSGDGNEGLSTTDLLSFTYQVARGMEFLSSKNCVHRDL
AARNVLLSQGKIVKICDFGLARDIMHDNNYVSKGSTFLPVKWMAPESIFDNMYTTLSDVW
SYGILLWEIFSLGGTPYPGMVVDSSFYNKIKSGYRMAKPEHAPTDVYEMMMKCWNSEPEK
RPSFFSLSESVASLLPSGYKRCFERVNHEFLKSDHPAVTRVQVENDDTYVGITYKNQGKS
KDRESGFDEQRLSSDSGYIIPLPDLDPLSDDEYCKRNRHSSQTSEESAIESGSSSTLAKR
EGETLEDITLLDEMCLDSELVEDSFL
NT seq 4401 nt   +upstreamnt  +downstreamnt
atggatgaaatgaagagatgtctcatcattggggtggtcttgtttggattgttatcggtt
acctgcggactgacgccaccgaccattgtatcaactgaagatgagtttgttctcgagcca
ctctctgttttcaacatcagctgcactagtaaaaggaacgttgcttgggtcgagccctta
ccggtcaacacattcgttttgcctggattttacatggccacgctcttcatctataacgct
tccgtgacacacaccggatattacatctgcaaataccaagacgaagagggcgatgaagag
gatgatgaagacaatgaagcagtcatatacgtttttgtcccagatcccaaggttccgttc
gtgcccgaggagccaggtagcatggtagttctagtctatcctggtgaaaccatcatccca
tgcagggtgtcagaccctcgatccccggtggtcctaaagagtgttcccagtggagtagag
gtggacgctgcttatgacaacaagatcggcttcattggcaacctggacgctggactctac
gtctgtgagaccatcgtgaacggcgtgacaatgaccagtgacatctacaccgtgaaggac
aacaaactgatggaggacttccatgtggaggtgaaggccagcgaggaggcagtgagactg
ggggaacccttcaacatcacctgtgtggcacctccaggactgccctaccagcagcagtgg
cttcaccccatgaaacaggctgtggatgcagtccagttgaagcaggctctgcctgataga
gtggtctacaccctcagtatcccagcagcctcctctcaggacagtggggtgtatgagtgc
tctatcaccaacaacttcagtggagagatcagagccaacatggtggctgtcactgtcttc
gaggagaactcctttgtgatgttggaccacagtgggattggagcggtggagtttgtcagt
atgatggaggacacagaattcaccatcagtattgaagccttccctgctcctaaagtcacc
tggctgaaagacggtatcgccatcactgagaacagctacttcctcaccaagaccagacgt
ctggcgggcaaccactatcagagcactctgactcttcggcagtcactagagaaggacagt
gggaattacaccgtcgtggtcctcagcagcgctcacactgcccagttctccttcaccctc
aaagtgaaagaatcaggcccagtactgttccagccagcctcagcgccagtgctgttcccc
cagagagaggagtggattgttcccctccacacccccttcaccctgacctgcaggggcgag
gccgagctggcctgggacacgcccgtctacctatcggagcagaccgaggaggacaacagc
ggcctgttcatcaccactgttaccgtagagaacgcgacagcagggcacactggcttctac
acctgcttctacaaaggagggaactccactgaggaaggagaggacagcagcatctacata
tatgtgccagatccagaggtgcccttcgtaccctcgctggtgccctttggaaaccacgtc
ctgaatggtcatgatgagatggagatccagtgtcgcgtatcagaccccggtgccaatgtg
accctggtcaacgctgatacccagcaggccgtgcccatggtggtttacgacagcaagagg
ggtgccgtgggcttcttcagcgcaggaacctacgtctgtaaggccctcgtcaacggagag
gagcacctcagtgaggagtacatcgtccacggctgggcaggggggtcggagctgcgtgtg
gagctgaaggcccagaagacagccctcttggtgggagacaccattactgtcatttgtgtg
gcccgggggtctgagatactggaagaccactggaagtaccctggaaaactggtggaccgg
ggcttgaagtcggtgcgtgagaataagagggaccaggagatccagtacacattgactgtc
ccccaggcctcagccaaagacagtggcatctatgtctgctccatcactgacatcatcagc
aacgagaaccagaccaagaagctggccatcactgtctatgagaggccattcgtgtcgctg
cgcccggcgttcagttcacaggagtcagcagatttggatgaggtcagacagttccaggct
gacattgactcctttcccagcgctcaggtcacatggctcaaagatggcctccctctcaac
gacgtggcggctgagataaccaccagcctccggcaggtcagcgagaccaggtaccagagt
gttctgaccctgattcgggccaaagaggaggacagtggaaactacaccatcagagtgcag
aacgggaaccagacccacagccacaacttcagcctgcaggtcaaagtgcctgcagtcatt
gtggacctgatggacctccaccatggctcagcctcaggccagtctgtagtgtgtatcgct
ggaggcatgcccactcctaaggtggagtggttcatctgcaagaacatcaaacactgtgcc
aacgactcgtctgagtgggtgcccctgcctaccaacaacacagagatcactgtggaagcg
cacatcgaccaggacaaccagctggagagtcaggtgatctttgggcatctggagaacacc
ttggctgttcgctgcctggccaggaacgagatggccaccgtcagcagggaggtcaaactg
gtgtcacaagaccctcactcagagctgactgtagctgctgctgccctggtgctgctggtc
tttgtcatcatctcactcattgttctggtcattatctggaaacagaagcctcgctatgag
atccgttggagggtgatagagtcagtgagccctgatggtcatgagtacatctacgtggac
cccatgcagctgccctatgactccagatgggagttctctcgtgatgggctcgtactggga
cgtatcctgggctctggggcgtttgggaaggtggtggagggaactgcatacggactcagc
cgctcccagcccgtcatgaaggtggccgtgaagatgctgaaacccacggcccgctccagt
gagaaacaggccctgatgtcagagctgaagattatgactcacctgggccctcacctcaac
atcgtcaacctgcttggggcctgtaccaagtcaggccccacctacatcatcactgagtac
tgcttctatggagaccttgtcaactacctgcacaagaacagagaaaactttgtcagcgtg
cacccagagaagaccaagaaagacctggacatctttggcatcaaccctgcagacgagagc
agcaggagctatgtgatcctgtcctttgagagtggtaaaggggactacatggacatgaag
caggcagacaccacgcagtacgtgcccatgctggagatgagtgacgcctccaagtactcc
gacatccagaggtccgaatacaaccacccgccatcacagaagggtgatagtgagatggac
aacatgctgtcaggggatggtaacgagggcctcagcaccacagacctgctcagcttcacc
taccaggtggccagaggcatggagttcctatcctctaagaactgtgtgcatcgggacctg
gctgccaggaatgtcctgctctctcaggggaagatagtaaagatctgtgactttggcctg
gccagagacatcatgcacgacaacaactacgtctccaaaggcagcaccttcctgccagtg
aagtggatggccccggagagtatctttgacaacatgtacaccaccctcagtgacgtctgg
tcctacggcatcctcctctgggagatcttctctctaggtggcaccccatacccagggatg
gtagtggactccagcttctacaacaagatcaagagtggctacaggatggccaaacctgag
catgcccccactgatgtgtatgagatgatgatgaagtgttggaatagtgagcctgagaag
aggccttccttcttcagcctgagtgagagcgtggcctcactgctgccttccggctacaag
aggtgtttcgagagggtgaaccatgagttcctgaagagtgaccacccggcagtgaccagg
gtccaggtggagaatgacgacacctacgttgggatcacctataagaaccagggcaagtcg
aaagacagggagagtggcttcgacgagcagcgcctcagctctgacagtggttacatcatc
ccccttcctgacctggaccccctgtctgatgacgagtactgcaagaggaatcgccacagc
tctcagacgtctgaggagagtgccatagagtcgggctccagctccacgctggccaagaga
gaaggagagaccctggaggacatcaccctattggatgagatgtgtctggactcagagctg
gtggaggacagctttctgtga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112249135
Entry
112249135         CDS       T05605                                 

Gene name
kdr
Definition
(RefSeq) vascular endothelial growth factor receptor 2 isoform X1
  KO
K05098  kinase insert domain protein receptor [EC:2.7.10.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04020  Calcium signaling pathway
otw04370  VEGF signaling pathway
otw04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112249135 (kdr)
   04370 VEGF signaling pathway
    112249135 (kdr)
   04020 Calcium signaling pathway
    112249135 (kdr)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112249135 (kdr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112249135 (kdr)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:otw04090]
    112249135 (kdr)
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     112249135 (kdr)
Protein kinases [BR:otw01001]
 Receptor tyrosine kinases (RTK)
  VEGFR family [OT]
   112249135 (kdr)
CD molecules [BR:otw04090]
 Proteins
  112249135 (kdr)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Ig_3 I-set Pkinase Ig_2 ig VEGFR-2_TMD V-set Ig_6 V-set_CD47
Other DBs
NCBI-GeneID: 112249135
NCBI-ProteinID: XP_024274573
LinkDB
Position
1
AA seq 1361 aa
MAKAFSVITLYFVAILLGASRMIALELRFMPDPPTLSIQEKVLRINTSDTLAITCSGRQS
LEWTTSYNRSRAGSRLSIVDCSGSGFFCIKLHISSATVNETGKYQCSYRDLAVEDRKTSV
AVYVYVQDYKVPFVPSDKDYDVVFISEGVQVVIPCRGSVENLNVTLHTKYPTKELNPNGK
DIFWDSMKGVSVPSHLISYAGLVFCQTRIHNETYKSPLYIVTVVGYKIHDLTLTPAHERL
SVGEKLVLNCTAYTELSVAIDFTWTHPISLAPVNGSGRTYTTSHKKKLWSSLELSNTLTV
ENVTGNYTGKYTCTASSGKMVKTASASLVVFEKPFIDFDDHKWVKVLGVNAGAQNIKIPV
KFDAYPEPTVRWYKNGQPIYKDDYRFKPTRDSLMILGLGEKDAGNYTVVLINKITKEEQR
RSVQLLVNVPPHIIEKEVAVDTDVHMYGSSPTLRCTARGIPTPTRIQWQWMSREDCPLLF
QSGVVSSGVKMEDCTKWRDISNTTGQNPIARISSDTDHVHKTVSSLKIQKAKVHALYKCL
TFNKVGQDSRIIVFHVTRGLELSVSPSREPIEQDQVVLRCKADRLIYGNLAWFRVENEFD
TEQVPAVQSCRGLSLSQQPLSQAVLSGLQGTNVTLELPLTNVSRRDQGVYACQVENIKTG
ERTCLLRHLTLRALEAARILNNLTDQRVNVSATTMLICEVTGTPTPTVMWTKHNQTVVEG
SGVILSRLNQTLTILRVKEEDGGLYTCTACNSRGCDTSQSNLITEGAEEKTNVELIVPIG
SVVIAMFFWLLIVFVIRSRKRTNNGDMKTGYLSIILDSEDMPMDEHCERLTYDANKWEFP
RDRLKLGDQLGRGAFGQVVEAAAFGIEKATTCTTVAVKMLKEGATSSEYRALMSELKILI
HIGHHLNVVNLLGACTKPGSPLMVIVEYCKHGNLSSYLKSKRGEYSPFKRRRPRSGQWER
MEEDVTEGDLGLGTSTHLDICTGTAVCSRLGEESSVSHVEEEEAESCEWEEHLTMEDLIS
YSFQVAKGMEFLSSRKCIHRDLAARNILLSENNIVKICDFGLARDVYKDPDYVRKGDARL
PLKWMAPETIFDRVYTTQSDVWSFGILLWEIFSLGASPYPGVGIDEAFCRRLKEGTRMRA
PDYATTEIYQTMLDCWLDKPTDRPNFTELVEHLGNLLQASAHQDGKDYIPLTAVEVQGGS
LSPEPRNPFTRIIREETHVPQIHCDNTPAISLGLSQQSDRCSRPLSVKTFDDVPVGHSSV
MEGQTDSGMCLSPEEMKSLDHQRHRTSNFSHIQRCKSKESLASESSNQTSGYQSGYHSDD
TDAPIYANEEMIMKRSIVKKPLPPKTADKFSVEVRYSTPPV
NT seq 4086 nt   +upstreamnt  +downstreamnt
atggcaaaggcattctccgtcattactttatatttcgtggccattcttctgggagccagc
cggatgattgcattagaactccggttcatgcctgatcccccaacactgagcatccaggag
aaagtcctcaggatcaacacctcagacacactggcgatcacctgcagtggccgtcagagc
ctggaatggaccacatcctataatcgcagccgtgctggcagtcgactctccatagtagac
tgcagtgggtcaggattcttctgcatcaaattacacatttcctcggccaccgtcaatgag
actgggaagtatcagtgctcctacagagacctggcggtggaggatagaaaaacctctgtg
gccgtttatgtctatgtccaagactataaagtgccatttgtgccctctgacaaggactat
gacgttgtgttcatcagtgagggagtacaggtggtcatcccatgccgagggtccgtggaa
aatctcaatgtcacgctacataccaagtatcccacgaaagaacttaatccgaacgggaag
gacattttttgggatagcatgaagggtgtctcagtccccagtcacctgatcagctacgct
ggactggtcttctgtcagacacgcatacacaatgagacctacaagtcacctctctacatt
gttacagttgttggatataagatccatgacctcaccctgaccccggcacatgagaggctg
tctgttggggagaaattggtgctaaactgcactgcctacacagagctcagcgtggccatc
gacttcacctggacacaccctatcagcctggccccagtgaatggctctggtcggacctac
accacgtcacacaagaagaagctgtggagctctctggaactgtccaacacactcacagtg
gagaacgtgaccggcaactacacaggaaagtatacctgcacagcctccagtggaaaaatg
gtcaaaactgcatctgcatctcttgtggtctttgaaaagccttttattgattttgatgac
cacaagtgggttaaggttctgggggtgaacgctggtgcccagaacattaagatcccagtc
aagttcgacgcctacccagaacctacagtcagatggtataagaatggccagcctatttac
aaggatgactatagatttaaacctaccagggactcgctcatgatccttggcctaggtgaa
aaggatgctgggaattacaccgtggtcttgatcaataagataacaaaagaagagcagaga
cgctccgtccagctcttggtcaatgtccctccccatatcattgagaaggaggttgccgtg
gacactgatgttcacatgtacggcagcagccccaccctcaggtgcactgcccgtggaatc
cccacccctacacgcatccaatggcagtggatgtccagagaggactgcccactcctcttt
cagtcgggagtggtgagctctggggtcaagatggaggactgtaccaaatggagggacatc
agcaataccacagggcagaatcctatcgcccgaattagcagtgacacagatcacgtacac
aagactgtgagttctctgaagatccagaaagccaaggtccacgccctctacaaatgcctg
acttttaacaaagtgggacaagattcacgcattatcgtcttccatgtgacacgtggtctg
gagctgagtgtgtctccgtcccgtgaacccattgagcaggaccaggtggttctgaggtgt
aaggcagacaggctgatctatggaaatctggcctggttccgtgtggaaaatgagtttgac
acagagcaggtccctgctgtgcagtcctgtcggggcctgtccctatcccagcagcccttg
tcccaggctgtcctctctgggctgcagggcaccaacgttaccctggagctgcccctgact
aatgtgtctcggagggaccagggggtgtacgcctgccaggtggagaacatcaagactggg
gagaggacctgtctcctccgacacctcaccctcagagcacttgaggccgcgaggatcctg
aacaatttgacagaccaaagagtgaacgtcagtgcgacgaccatgctaatatgtgaggtg
accggtacacccaccccaaccgtgatgtggaccaaacacaaccaaacagtggtggagggc
tctggtgtgattctgagccgattgaaccagaccctgaccatcctgcgtgtgaaggaggag
gacggtggtctgtatacctgtactgcctgtaacagccggggctgcgacacatctcagagc
aaccttatcactgaaggtgcagaggagaagactaatgtagagctgattgttcctattggc
tctgtggtcattgccatgttcttctggcttctcatcgtcttcgtcatccgcagcaggaaa
agaacaaataatggggacatgaagacagggtacctgtccatcatccttgactctgaggac
atgcccatggacgagcactgtgagaggctcacatacgacgccaacaagtgggagttccct
cgtgacaggctgaaactaggtgaccaattggggcgtggagcttttggacaagtagtagag
gcagcagcctttggcatagagaaagccactacctgtactacagtggcagtcaagatgctg
aaagagggagccacatccagtgagtaccgtgcactgatgtcagagctgaagatcctcatc
cacatcggccaccatctcaatgtggtcaacctgctgggggcctgcaccaaaccagggagt
ccattgatggtgattgtggagtactgtaaacacggcaacctctccagctatttaaagagc
aagcgtggagagtacagccccttcaagaggaggcggcctcggtcaggtcagtgggagcgg
atggaggaggacgtgactgaaggggacctgggtttggggaccagcacccacttggacatt
tgcactgggacagcagtctgctccagactgggagaagagagctctgttagccacgtagag
gaggaggaggcagagagttgtgagtgggaggagcacctgaccatggaggacctgatcagc
tacagcttccaggtggccaagggcatggagttcctatcctctcgcaagtgcatccatcgg
gacctagcagctaggaacatcttgctctcagaaaacaacattgtgaagatctgtgacttt
ggtctggccagagacgtctacaaagaccccgactacgtccgcaagggagacgcgcggctc
cctctgaaatggatggctcctgagaccatcttcgaccgggtctataccacacagagcgac
gtgtggtcctttggcattctgctctgggagatcttctctctgggggcatctccataccct
ggtgttggcattgatgaggccttctgcaggaggctgaaggaagggaccaggatgagagca
ccagactacgccaccactgagatatatcaaaccatgttggactgctggctggacaaacct
accgacagaccaaatttcaccgagctcgtagaacatctggggaacctgctacaggccagc
gctcatcaggatgggaaggactacatccctttgacagcagtggaggtgcaggggggctca
ctcagccctgaacccaggaaccccttcaccaggatcatcagagaggaaacccatgtcccc
cagatacactgtgacaacacacccgccatctccctcgggctctcccagcagagtgacagg
tgcagtcgaccactcagtgtgaagacttttgatgacgtccctgtggggcatagcagcgtc
atggagggtcagacggacagcggtatgtgcctatcaccagaggagatgaagagtctggac
catcagcgtcaccgcacgtccaacttcagtcacatccagcgatgtaagagtaaggagtct
ctggcctccgagtcgtccaatcagacgagtgggtaccagtcaggctaccactcagacgac
actgacgcacccatttatgctaatgaggagatgatcatgaagagaagcattgtgaagaag
ccactgccgcccaaaacagcagacaagttcagtgttgaggtgcgctacagtacaccccct
gtttag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112251129
Entry
112251129         CDS       T05605                                 

Definition
(RefSeq) platelet-derived growth factor receptor alpha-like isoform X1
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04020  Calcium signaling pathway
otw04144  Endocytosis
otw04510  Focal adhesion
otw04540  Gap junction
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112251129
   04020 Calcium signaling pathway
    112251129
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112251129
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112251129
   04540 Gap junction
    112251129
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112251129
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112251129
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:otw04090]
    112251129
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     112251129
Protein kinases [BR:otw01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   112251129
CD molecules [BR:otw04090]
 Proteins
  112251129
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 V-set Receptor_2B4 Kinase-like
Other DBs
NCBI-GeneID: 112251129
NCBI-ProteinID: XP_024277649
LinkDB
Position
5
AA seq 1476 aa
MDEMKTCLIIGVFLFGLLSVTRGLATPTIVSTEDEFVLEPLSVFNISCTGKRNVAWVEPL
PDDTFVLPGYYTSTLFIYNASVTHTGYYSCKYQDKEGDEEVDGVANDAFIYVFVPDPEIP
FVPQEPDRMLVPVYPNRTIIPCRVSDPQSQVVLKSAPSGVEVDAAYKNKIGFIGNLDAGL
YICETTVNSMTITSDTYTVEANKQIENVHVEVKASEEAVRLGEPFNITCVAPPGLPNQQQ
WLHPRKQAVDAVQMKQTLPDRMVYTLSIPAATSQDSGVYECSITNNISGEIRANRVAVTV
FEENPFVMLDHSGIGVVEFVSMMEETEFTISIEAFPAPKVTWLKDGIAITENSYFLTKTS
LLEGNKHQSTLTLRQPLEEDSGNYTIMVLSIPHTAQFSFTLKVKASAPVLFQPASAPVLF
QPASAPVLIPQREEMVVPLHTPFTLTCRGEAELAWDTPVYLSEQTEEDNSGLFVTTVTVE
NATAANTGFYTCFYNGGNSTEEGEDSSIYIYVPDPEVPFVPSLVPFGNHVLNGHDEMEIQ
CRVSDPSANVTLVNTDTQQAVPMTVYDSKRGAVGFFSAGTYVCKALVNGEEHLSEEYIVH
GWAGGSELRVELKALKTALLVGDTITVTCVARGSEILEDHWKYPGKLVNRGLKSVRENKR
DQEIQYIMTVPQASAKDSGIYACSITDIISNESQTKELAITVYESPFVSLRPVFSSQESA
DLDESREFRADIDSFPSAQVTWLKDGLPLNYVAAEITNSLQQLSETRYLSVLTLIRAKEE
DSGNYTIRVQNGNQTHSHSFSLQVKVPAVIVDLMDLHHGSASGQSVVCIAGGMPTPEVEW
FICKNIKHCANDSSQWVPLPTNDTDITVEAHFDQDNQLESQVIXVRLENTLAVRCLARNE
MAAVSREVKLVSQGPHSELPVTAAVLVLLVIVIISLIVLVIIWKQKPRYEIRWRVIESVS
PDGHEYIYVDPMQLPYDSRWEFSRDGLVLGRVLGSGAFGKVVEGTAYGLSRSQPVMKVAV
KMLKPTARSSEKQALMSELKIMTHLGPHLNIVNLLGACTKSGPTYIITEYCFYGDLVNYL
HKNRENFLSLHSEKSKKDLDIFGINPADESSRSYVILSFESGKGDYMEMKQADTTQYVPM
LEMSDASKYSDIQRSEYDHPPSQKGDNEMDNLLSEDGNEGLSTTDLLSFTYQVARGMEFL
SSKNCVHRDLAARNVLLSQGKIVKICDFGLARDIMHDNNYVSKGSTFLPVKWMAPESIFD
NMYTTLSDVWSYGILLWEIFSLGGTPYPGMVVDSSFYNKIKSGYRMAKPEHAPADVYEMM
IKCWNSEPEKRPSFLSLSESVASLLPSGYKRCFERASHEFLKSDHPAVTRVQVESDDTYI
GITYKSQDKLKDRESGFDEQRLSSDSGYIIPLPDLDPLSDDEYVKRNRHSSQTSEESAIE
TGSSFTLAKREGETLEDISLLDEMCLDSELVEDSFL
NT seq 4431 nt   +upstreamnt  +downstreamnt
atggatgaaatgaagacatgtctcatcattggggttttcttgtttgggttgttatcagtt
acccgcgggctggccacaccgaccattgtatcaactgaagatgagtttgttctcgagccg
ctctcggtgttcaacatcagctgcactggtaaaaggaacgttgcttgggtcgagccccta
ccggacgacacattcgttttgcctggatattacacctccacgctcttcatatacaacgct
tctgtgacacacaccggatattactcctgcaaataccaagacaaagagggcgatgaagag
gtggatggcgtagccaatgatgcgttcatatacgttttcgtcccagatcctgagattcca
tttgtgccccaggagccagatcgcatgctagtcccagtctatcccaatagaaccatcatc
ccatgcagggtgtcagaccctcaatcccaggtggtcctaaagagcgctcccagtggagta
gaggtggacgcagcttataagaacaagatcggcttcattggcaacctggacgctggattg
tacatctgtgagaccaccgtgaacagcatgacaattacgagtgacacttacaccgtggag
gccaacaaacagatagagaacgtccatgtggaggtgaaggccagcgaagaggcagtgaga
ctaggggaacccttcaacatcacctgtgtggcacctcctggactgcccaaccagcagcag
tggctccaccccaggaaacaggctgtggatgcagtccagatgaaacagactctgcctgat
agaatggtctacaccctcagtatcccagcagccacctctcaggacagtggggtgtatgag
tgctccatcaccaacaacatcagtggagagatcagagccaacagggtggctgtcactgtc
tttgaagagaacccctttgtgatgttggaccacagtgggattggagtggtggagtttgtc
agtatgatggaggagacagagttcaccatcagtattgaagccttccctgctcctaaagtc
acctggctgaaagatggcatcgccatcactgagaacagctacttcctcaccaagaccagc
cttctggaggggaacaagcatcagagcactctgactcttcggcagccactagaggaggac
agtggtaactacaccatcatggtcctcagcatccctcacactgcccagttctccttcacc
ctcaaagtgaaagcctcagccccagtgctgttccagccagcctcagccccagtgctgttc
cagccagcctcagctccggtgctgatcccccagagagaggagatggttgttcccctccac
acccccttcactctgacttgcaggggcgaggccgagctggcctgggacacgcccgtctac
ctatcagagcagacagaggaggacaacagcggcctgttcgtcaccacggttaccgtagag
aacgccactgcggcaaacactggtttctatacctgcttctacaacggagggaactccact
gaggagggagaggacagcagcatctacatatatgtgccagatccagaggtgccctttgtc
ccctctctggtgccctttggcaaccacgtcctgaatggtcatgatgagatggagatccag
tgtcgcgtgtcagaccccagtgccaatgtgaccctggtcaacactgatacccagcaggcc
gtgcccatgactgtctacgacagcaagaggggcgccgtgggcttcttcagtgcaggaacc
tatgtctgcaaggccctcgtcaatggagaggagcacctcagtgaggagtacatcgtccac
ggctgggcaggggggtcggagctgcgtgtggagctgaaggccctgaagactgctctcttg
gtgggagacaccatcactgtcacctgtgtggcccgggggtctgagatactggaagaccac
tggaagtaccctggaaaactggtgaaccgtggcttgaagtcggtgcgtgagaataagagg
gaccaggagatccagtacatcatgactgtcccccaggcctcagccaaagacagcggcatc
tacgcctgctccattactgacatcatcagcaatgagagccagaccaaggagctggccatc
actgtctatgagagcccatttgtgtcgctgcgccctgtgttcagttctcaggagtcagca
gacctggatgagagcagagagttccgggccgacatcgactcattccccagcgcccaggtc
acatggctcaaagatggcctccccctcaactatgtggcggctgagataaccaacagcctc
cagcagctcagcgagaccaggtacctgagtgttctgaccctgatccgggccaaggaggag
gacagtgggaactacaccatcagagtgcagaacgggaaccagacccacagccacagcttc
agtctgcaggtcaaagtacctgcagtcattgtggacctgatggacctccaccatggctca
gcctcaggccagtctgtagtgtgtatcgctggaggcatgcccactcctgaggtggagtgg
ttcatctgcaagaacataaaacactgcgccaatgactcatctcagtgggtgcccctgcca
accaacgacacagatatcactgtggaagcgcattttgatcaggacaaccagctggagagc
caggtgatcttmgtgcgtcttgagaacactctggccgtccgctgcctggccaggaacgag
atggccgccgtcagcagggaggtgaagctggtgtcacaaggcccccactctgagctgcct
gtaactgctgctgttttggtgctgctggtcattgtcatcatctcactcattgtcctggtc
attatctggaaacagaagcctcgctatgagatccgctggagggtgatagagtcagtgagc
cctgatggccatgagtacatctatgttgaccccatgcaactgccctatgactccagatgg
gagttctctcgcgatgggctcgtactgggtcgtgttctgggctctggggcgtttgggaag
gtggtggagggaactgcatatggactcagccgctcccagcccgtcatgaaggtggctgtg
aagatgctgaaacccacggcccgctccagtgagaaacaggccctgatgtcagagctgaag
atcatgactcacctgggccctcacctcaacatcgtcaacctgctgggggcctgcaccaag
tcaggccccacctacatcatcactgagtactgcttctatggagacctggtcaactacctg
cacaagaacagagagaacttcctcagcttgcactcagagaagagcaagaaagacctggac
atctttggcataaaccctgcagatgagagcagcaggagctatgtgatcctgtcctttgaa
agtggtaagggggactacatggaaatgaagcaggcagacaccacgcagtacgtgcccatg
ctggagatgagtgatgcctccaagtactccgacatccagaggtctgaatatgaccaccca
ccatcacagaagggtgataatgagatggacaacctgctgtcagaagacggcaacgagggc
ctcagcaccacagatctgctcagctttacctaccaggtggccagaggcatggagttcctg
tcctctaagaactgtgtgcatcgggacctggctgctaggaacgtcctgctctctcagggg
aagatagtgaagatctgtgactttggcctggccagagacatcatgcatgacaacaactat
gtctccaaaggcagcaccttcctgccagtgaagtggatggctcctgagagtatctttgac
aacatgtacaccaccctcagtgatgtctggtcctacggcatcctcctctgggagattttc
tctctaggtggcaccccatacccagggatggtagtggactccagcttctacaacaagatc
aagagtggctacaggatggccaaacctgagcacgcccccgctgatgtgtatgagatgatg
ataaagtgttggaacagtgagcctgagaagaggccttccttcctcagcctgagtgagagt
gtggcttcactgctgccctccggctacaagaggtgcttcgagagggcaagccatgagttc
ctgaagagcgaccatccagcagtgaccagggtccaggtggagagtgatgacacctacatt
gggatcacctataagagtcaggacaagttgaaggacagggagagtggcttcgacgagcag
cgcctcagctctgacagcggttacattatccccctccccgacctggaccctctgtctgat
gatgagtacgtcaagaggaaccgccacagctctcagacatctgaagagagtgccatagag
acaggctccagcttcacgctggccaagagagaaggagagaccctggaggacatcagcttg
ttggatgagatgtgtttggactcagagctggtggaagacagtttcctgtga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112251205
Entry
112251205         CDS       T05605                                 

Definition
(RefSeq) platelet-derived growth factor receptor alpha-like isoform X1
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04020  Calcium signaling pathway
otw04144  Endocytosis
otw04510  Focal adhesion
otw04540  Gap junction
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112251205
   04020 Calcium signaling pathway
    112251205
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112251205
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112251205
   04540 Gap junction
    112251205
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112251205
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112251205
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:otw04090]
    112251205
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     112251205
Protein kinases [BR:otw01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   112251205
CD molecules [BR:otw04090]
 Proteins
  112251205
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 V-set Receptor_2B4 Kinase-like
Other DBs
NCBI-GeneID: 112251205
NCBI-ProteinID: XP_024277810
LinkDB
Position
5
AA seq 1476 aa
MDEMKTCLIIGVFLFGLLSVTRGLATPTIVSTEDEFVLEPLSVFNISCTGKRNVAWVEPL
PDDTFVLPGYYTSTLFIYNASVTHTGYYSCKYQDKEGDEEVDGVANDAFIYVFVPDPEIP
FVPQEPDRMLVPVYPNRTIIPCRVSDPQSQVVLKSAPSGVEVDAAYKNKIGFIGNLDAGL
YICETTVNSMTITSDTYTVEANKQIENVHVEVKASEEAVRLGEPFNITCVAPPGLPNQQQ
WLHPRKQAVDAVQMKQTLPDRMVYTLSIPAATSQDSGVYECSITNNISGEIRANRVAVTV
FEENPFVMLDHSGIGVVEFVSMMEETEFTISIEAFPAPKVTWLKDGIAITENSYFLTKTS
LLEGNKHQSTLTLRQPLEEDSGNYTIMVLSIPHTAQFSFTLKVKASAPVLFQPASAPVLF
QPASAPVLIPQREEMVVPLHTPFTLTCRGEAELAWDTPVYLSEQTEEDNSGLFVTTVTVE
NATAANTGFYTCFYNGGNSTEEGEDSSIYIYVPDPEVPFVPSLVPFGNHVLNGHDEMEIQ
CRVSDPSANVTLVNTDTQQAVPMTVYDSKRGAVGFFSAGTYVCKALVNGEEHLSEEYIVH
GWAGGSELRVELKALKTALLVGDTITVTCVARGSEILEDHWKYPGKLVNRGLKSVRENKR
DQEIQYIMTVPQASAKDSGIYACSITDIISNESQTKELAITVYESPFVSLRPVFSSQESA
DLDESREFRADIDSFPSAQVTWLKDGLPLNYVAAEITNSLQQLSETRYLSVLTLIRAKEE
DSGNYTIRVQNGNQTHSHSFSLQVKVPAVIVDLMDLHHGSASGQSVVCIAGGMPTPEVEW
FICKNIKHCANDSSQWVPLPTNDTDITVEAHFDQDNQLESQVIXVRLENTLAVRCLARNE
MAAVSREVKLVSQGPHSELPVTAAVLVLLVIVIISLIVLVIIWKQKPRYEIRWRVIESVS
PDGHEYIYVDPMQLPYDSRWEFSRDGLVLGRVLGSGAFGKVVEGTAYGLSRSQPVMKVAV
KMLKPTARSSEKQALMSELKIMTHLGPHLNIVNLLGACTKSGPTYIITEYCFYGDLVNYL
HKNRENFLSLHSEKSKKDLDIFGINPADESSRSYVILSFESGKGDYMEMKQADTTQYVPM
LEMSDASKYSDIQRSEYDHPPSQKGDNEMDNLLSEDGNEGLSTTDLLSFTYQVARGMEFL
SSKNCVHRDLAARNVLLSQGKIVKICDFGLARDIMHDNNYVSKGSTFLPVKWMAPESIFD
NMYTTLSDVWSYGILLWEIFSLGGTPYPGMVVDSSFYNKIKSGYRMAKPEHAPADVYEMM
IKCWNSEPEKRPSFLSLSESVASLLPSGYKRCFERASHEFLKSDHPAVTRVQVESDDTYI
GITYKSQDKLKDRESGFDEQRLSSDSGYIIPLPDLDPLSDDEYVKRNRHSSQTSEESAIE
TGSSFTLAKREGETLEDISLLDEMCLDSELVEDSFL
NT seq 4431 nt   +upstreamnt  +downstreamnt
atggatgaaatgaagacatgtctcatcattggggttttcttgtttgggttgttatcagtt
acccgcgggctggccacaccgaccattgtatcaactgaagatgagtttgttctcgagccg
ctctcggtgttcaacatcagctgcactggtaaaaggaacgttgcttgggtcgagccccta
ccggacgacacattcgttttgcctggatattacacctccacgctcttcatatacaacgct
tctgtgacacacaccggatattactcctgcaaataccaagacaaagagggcgatgaagag
gtggatggcgtagccaatgatgcgttcatatacgttttcgtcccagatcctgagattcca
tttgtgccccaggagccagatcgcatgctagtcccagtctatcccaatagaaccatcatc
ccatgcagggtgtcagaccctcaatcccaggtggtcctaaagagcgctcccagtggagta
gaggtggacgcagcttataagaacaagatcggcttcattggcaacctggacgctggattg
tacatctgtgagaccaccgtgaacagcatgacaattacgagtgacacttacaccgtggag
gccaacaaacagatagagaacgtccatgtggaggtgaaggccagcgaagaggcagtgaga
ctaggggaacccttcaacatcacctgtgtggcacctcctggactgcccaaccagcagcag
tggctccaccccaggaaacaggctgtggatgcagtccagatgaaacagactctgcctgat
agaatggtctacaccctcagtatcccagcagccacctctcaggacagtggggtgtatgag
tgctccatcaccaacaacatcagtggagagatcagagccaacagggtggctgtcactgtc
tttgaagagaacccctttgtgatgttggaccacagtgggattggagtggtggagtttgtc
agtatgatggaggagacagagttcaccatcagtattgaagccttccctgctcctaaagtc
acctggctgaaagatggcatcgccatcactgagaacagctacttcctcaccaagaccagc
cttctggaggggaacaagcatcagagcactctgactcttcggcagccactagaggaggac
agtggtaactacaccatcatggtcctcagcatccctcacactgcccagttctccttcacc
ctcaaagtgaaagcctcagccccagtgctgttccagccagcctcagccccagtgctgttc
cagccagcctcagctccggtgctgatcccccagagagaggagatggttgttcccctccac
acccccttcactctgacttgcaggggcgaggccgagctggcctgggacacgcccgtctac
ctatcagagcagacagaggaggacaacagcggcctgttcgtcaccacggttaccgtagag
aacgccactgcggcaaacactggtttctatacctgcttctacaacggagggaactccact
gaggagggagaggacagcagcatctacatatatgtgccagatccagaggtgccctttgtc
ccctctctggtgccctttggcaaccacgtcctgaatggtcatgatgagatggagatccag
tgtcgcgtgtcagaccccagtgccaatgtgaccctggtcaacactgatacccagcaggcc
gtgcccatgactgtctacgacagcaagaggggcgccgtgggcttcttcagtgcaggaacc
tatgtctgcaaggccctcgtcaatggagaggagcacctcagtgaggagtacatcgtccac
ggctgggcaggggggtcggagctgcgtgtggagctgaaggccctgaagactgctctcttg
gtgggagacaccatcactgtcacctgtgtggcccgggggtctgagatactggaagaccac
tggaagtaccctggaaaactggtgaaccgtggcttgaagtcggtgcgtgagaataagagg
gaccaggagatccagtacatcatgactgtcccccaggcctcagccaaagacagcggcatc
tacgcctgctccattactgacatcatcagcaatgagagccagaccaaggagctggccatc
actgtctatgagagcccatttgtgtcgctgcgccctgtgttcagttctcaggagtcagca
gacctggatgagagcagagagttccgggccgacatcgactcattccccagcgcccaggtc
acatggctcaaagatggcctccccctcaactatgtggcggctgagataaccaacagcctc
cagcagctcagcgagaccaggtacctgagtgttctgaccctgatccgggccaaggaggag
gacagtgggaactacaccatcagagtgcagaacgggaaccagacccacagccacagcttc
agtctgcaggtcaaagtacctgcagtcattgtggacctgatggacctccaccatggctca
gcctcaggccagtctgtagtgtgtatcgctggaggcatgcccactcctgaggtggagtgg
ttcatctgcaagaacataaaacactgcgccaatgactcatctcagtgggtgcccctgcca
accaacgacacagatatcactgtggaagcgcattttgatcaggacaaccagctggagagc
caggtgatcttkgtgcgtcttgagaacactctggccgtccgctgcctggccaggaacgag
atggccgccgtcagcagggaggtgaagctggtgtcacaaggcccccactctgagctgcct
gtaactgctgctgttttggtgctgctggtcattgtcatcatctcactcattgtcctggtc
attatctggaaacagaagcctcgctatgagatccgctggagggtgatagagtcagtgagc
cctgatggccatgagtacatctatgttgaccccatgcaactgccctatgactccagatgg
gagttctctcgcgatgggctcgtactgggtcgtgttctgggctctggggcgtttgggaag
gtggtggagggaactgcatatggactcagccgctcccagcccgtcatgaaggtggctgtg
aagatgctgaaacccacggcccgctccagtgagaaacaggccctgatgtcagagctgaag
atcatgactcacctgggccctcacctcaacatcgtcaacctgctgggggcctgcaccaag
tcaggccccacctacatcatcactgagtactgcttctatggagacctggtcaactacctg
cacaagaacagagagaacttcctcagcttgcactcagagaagagcaagaaagacctggac
atctttggcataaaccctgcagatgagagcagcaggagctatgtgatcctgtcctttgaa
agtggtaagggggactacatggaaatgaagcaggcagacaccacgcagtacgtgcccatg
ctggagatgagtgatgcctccaagtactccgacatccagaggtctgaatatgaccaccca
ccatcacagaagggtgataatgagatggacaacctgctgtcagaagacggcaacgagggc
ctcagcaccacagatctgctcagctttacctaccaggtggccagaggcatggagttcctg
tcctctaagaactgtgtgcatcgggacctggctgctaggaacgtcctgctctctcagggg
aagatagtgaagatctgtgactttggcctggccagagacatcatgcatgacaacaactat
gtctccaaaggcagcaccttcctgccagtgaagtggatggctcctgagagtatctttgac
aacatgtacaccaccctcagtgatgtctggtcctacggcatcctcctctgggagattttc
tctctaggtggcaccccatacccagggatggtagtggactccagcttctacaacaagatc
aagagtggctacaggatggccaaacctgagcacgcccccgctgatgtgtatgagatgatg
ataaagtgttggaacagtgagcctgagaagaggccttccttcctcagcctgagtgagagt
gtggcttcactgctgccctccggctacaagaggtgcttcgagagggcaagccatgagttc
ctgaagagcgaccatccagcagtgaccagggtccaggtggagagtgatgacacctacatt
gggatcacctataagagtcaggacaagttgaaggacagggagagtggcttcgacgagcag
cgcctcagctctgacagcggttacattatccccctccccgacctggaccctctgtctgat
gatgagtacgtcaagaggaaccgccacagctctcagacatctgaagagagtgccatagag
acaggctccagcttcacgctggccaagagagaaggagagaccctggaggacatcagcttg
ttggatgagatgtgtttggactcagagctggtggaagacagtttcctgtga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112252377
Entry
112252377         CDS       T05605                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: insulin-like growth factor 1 receptor
  KO
K05087  insulin-like growth factor 1 receptor [EC:2.7.10.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04068  FoxO signaling pathway
otw04114  Oocyte meiosis
otw04140  Autophagy - animal
otw04144  Endocytosis
otw04150  mTOR signaling pathway
otw04510  Focal adhesion
otw04520  Adherens junction
otw04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112252377
   04068 FoxO signaling pathway
    112252377
   04150 mTOR signaling pathway
    112252377
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112252377
   04140 Autophagy - animal
    112252377
  09143 Cell growth and death
   04114 Oocyte meiosis
    112252377
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112252377
   04520 Adherens junction
    112252377
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    112252377
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112252377
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:otw04090]
    112252377
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     112252377
Protein kinases [BR:otw01001]
 Receptor tyrosine kinases (RTK)
  INSR family [OT]
   112252377
CD molecules [BR:otw04090]
 Proteins
  112252377
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain Pkinase Furin-like fn3 Insulin_TMD Kinase-like
Other DBs
NCBI-GeneID: 112252377
NCBI-ProteinID: XP_024279300
LinkDB
Position
6
AA seq 1416 aa
MRSGTERNTLTLFWGLTLSVSTIYLWTANGEICGPSIDIRNDISEFKRLENCTVVEGFLQ
ILLIGDKTNNLNQELFRSLSFPKLTVITDYLLLFRVSGLDSLSTLFPNLNVIHGRNLFYN
YALVIFEMTSLKDIGLYNLRNITRGAIRIEKNPELCYLDSVDWSLIMDAEFNNFIAGNKQ
SKECGDVCPGITEDNAQCIKTSFNGNFNSRCWTSNHCQKVCPEKKCERRACTDGGECCHA
QCLGSCTEPDDDMACAACLHYYHEGRCVQDCPPDTYKFEGWRCITMDLCARVHLPSDFDF
VIHEGECMPECPSGFTRNESNNHSMFCSACDGLCDKICDSKTIDSVDAAQSLMGCTVIKG
NLQINIRRGNNIASELESFMGLIQTVTGYVRIRHSHTLGSLSFLKSLRYINGEELMEGMY
AFSAIDNQRLQYLWDWTQHNLTIRAGRLSFRFNPKLCMSEIHNMWEKTDITEKFEEGDFR
NNGDRASCESHILKFKSNSTMSNRIKLTWERYRPPDYRDLISFIVYYKEAPHQNITEFDG
QDGCGSNSWNMVDVDLPQDKEIDPGVLLSPLKPWTQYAIFVKAITLVVEDKHIPGAKSDV
VYIRTSPSEPSMPMDTRAYSNSSSKLVVKWSPPLNPNGNLTFYLIRWQQQAEDKELYQHN
YCSKELKIPIRISATGLAEMEDDTKPTKPDLSGGDKGPCCPCPKTKEDLKAEIDDASYRK
VFENFLHNSIFTPRPPDRRRRDLFGVANSTLARGGNTTGLEGNGTDGESPEREFPFMEDR
SKTEFIEIPNLQPFTVYRIDIHACNQEVRRCSAGAFVFSRTKPADKADDMPGTVNQERDS
KVEGSVLLRWPEPVNPNGLILMYEIKFRQGTEPEKHECVSRQHYRVHKGARLTNLGSGNY
SARVRATSLAGNGSWTEPVSFYVTPRTRDYDITFYLVIIIPIIVIILIASLITALFFINK
KRNSDRLGNGVLYASVNPEYFSAAEMYVPDEWEVAREKITMHKELGQGSFGMVYEGLAKG
VVKDDPETRVAIKTVNESASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIME
LMTRGDLKSHLRSLRKENTSSQVLPPLKKMIQMAGEIADGMAYLNANKFVHRDLAARNCM
VAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTNSDVWSFGVVL
WEISTLSEQPYQGMSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEI
INSLKEELEPPFSEMSFFFSEENKPPDTEELDMEVENMENVPLDPAPSRPPTAVPLPSQG
PMGATGGXAPPPPQQLSPMQCPSNTLKGPGSPSTSVPAASVSASPGLALDKHSGQISANG
PVVVLRPNFEDTQNYAHMNGGRKNERALPLPQSSAC
NT seq 4251 nt   +upstreamnt  +downstreamnt
atgagatctgggacagagaggaatactttgaccttgttttggggtctgacgctatctgtc
tccactatctacctatggacggcaaatggagaaatctgtggtccaagtattgacatacgt
aatgacatcagtgagttcaagcgtctggagaactgcacggtggtggagggcttcctgcag
atactcctcatcggagacaagaccaacaacctcaaccaggagctcttccgctccctcagc
ttccccaagctgaccgtcatcaccgactacctgctcctgttccgggtctccggcctggac
agcctcagcacgctcttccccaacctcaacgtcattcacggacgcaacctcttctacaac
tatgccctggttatctttgagatgaccagtctgaaggacatcggcttgtacaacctgagg
aacatcacgcgaggggccatccggatcgagaagaacccggagctctgctacctggactct
gtggactggtctctcatcatggacgcagagttcaacaacttcattgcggggaacaagcaa
tccaaggagtgtggtgatgtgtgtccaggcatcacggaggacaacgctcagtgcatcaag
accagctttaacggcaactttaactctcgctgctggacatccaaccactgccagaaagtg
tgcccagagaagaagtgtgagcggcgggcatgtacggacggtggtgagtgttgccatgcc
cagtgcctgggaagctgtacggagccggacgacgacatggcctgcgcagcctgcctgcac
tactaccacgagggccgctgcgtgcaggactgccccccagacacttacaagtttgagggc
tggcgctgcatcaccatggacctgtgtgcccgcgtgcacctgcccagcgactttgacttt
gtcattcacgaaggagagtgcatgcctgagtgtccatcaggcttcacacgcaatgagagc
aataatcacagtatgttctgcagtgcctgtgatggcttgtgtgataagatctgcgactcc
aagaccatcgactccgtggatgctgctcagtctctaatgggctgcacagtcatcaaaggc
aacctgcaaatcaacatccgccgtggcaataacattgcctcagagctggagagcttcatg
gggctgatccagacagtgacaggctatgtgaggatccgacattcccacacactaggatcg
ctctccttcctcaagagcctgcgctacatcaacggggaggagctcatggaagggatgtat
gctttttctgccattgacaaccagcgcctgcagtacctgtgggactggacccaacacaac
ctgaccatcagggctgggaggctgtccttccgcttcaaccccaaactctgcatgtctgag
atccacaatatgtgggagaagacggacatcactgagaagtttgaggagggcgatttccgc
aacaatggagacagagcaagctgtgagagtcatatcctgaagttcaaatccaacagcacg
atgagtaaccggatcaagctgacttgggagcgctaccgaccaccagactacagagacctc
atcagcttcatcgtctactacaaggaagcacctcaccagaacatcacagagtttgatggc
caggatgggtgtggctccaacagttggaacatggttgacgtggacctaccgcaagacaaa
gagatagaccctggtgtgctgctgtccccactgaagccctggacccagtacgccatcttt
gtcaaggccatcaccctggtggtggaggacaaacacatccctggagccaagagtgacgtg
gtctatatacgcaccagcccctcggagccatctatgccaatggatacccgggcgtattcc
aactcgtcctccaagctggtggtgaaatggtcacctcccctcaaccctaacggcaatctc
actttttacctgatccgctggcagcagcaagctgaagacaaggagctgtaccaacacaac
tactgctccaaagagctgaagatccccattagaatctcagccacggggttggcagagatg
gaggacgacaccaagcccaccaagcctgacctgtctgggggggacaagggcccctgctgc
ccctgccccaagaccaaggaggacctgaaagcagagatagatgacgcatcctaccgcaaa
gtctttgagaacttcctgcacaactccatcttcacccccaggcccccagaccggcggcgt
agggatctatttggggtggctaacagcaccttggcgcggggtggcaacaccacaggcctg
gagggtaatgggacagacggagaatcccccgagagggagttccccttcatggaggaccgg
agcaagacagagtttatagagatccccaacctacagcccttcactgtttaccgcatcgac
atccacgcctgtaaccaggaggtccgtcgctgcagcgctggagccttcgtcttctccagg
accaaacctgcagacaaagcggatgacatgccaggcacggtgaatcaggagagggattcg
aaggtggaggggtcggtgctgctgaggtggccggagcctgtcaaccccaacggtctcatc
ctaatgtatgagattaagtttcgccaaggcactgagcctgagaaacatgagtgtgtgtca
cgccagcactacagagtgcacaaaggagctcgtctgaccaacctaggctctgggaactac
tctgcccgcgtgcgcgccacctccctggcaggaaatgggtcctggactgagccagtgtcc
ttctacgtaaccccacgcacacgggactacgacatcacgttctatctggtcatcatcatc
cccatcatagtgataattcttatcgccagcctcattactgcactcttttttatcaacaaa
aaaaggaacagtgacaggctgggtaatggtgtcctctatgcttctgtcaaccctgagtac
ttcagtgctgctgagatgtatgttccagatgagtgggaggtggccagggaaaagatcacc
atgcacaaggagttgggccagggttcctttggcatggtgtacgagggcctcgctaagggc
gtggttaaagacgacccagagacgcgcgtggccatcaagacggtcaacgagtcagccagc
atgagggagaggatagagttcctcaatgaggcttccgtcatgaaggagttcaactgtcac
cacgtggtgcgtctgctgggagtggtctctcagggacagcccaccttggtgataatggag
ctgatgacccgtggagacctgaagagtcacctgcgctcgctccgtaaagagaacacgtcc
agccaggttctgcccccgctgaagaagatgatccagatggcaggggagattgcggacggc
atggcatacctcaacgccaacaagttcgtccacagagacctggctgccaggaactgcatg
gtggcggaggacttcaccgtcaagatcggggactttggcatgacgcgagacatctacgag
acggattactatcggaaaggagggaagggccttctgccagtccgctggatgtccccagag
tcgctgaaagacggagtgttcaccacaaactctgatgtctggtcatttggggtggtgctg
tgggagatttctaccttgtctgagcagccgtatcagggcatgtccaacgagcaggtgctg
cgtttcgtcatggagggaggactcctggacaagcctgacaactgtcctgacatgctgttt
gagctgatgcggatgtgctggcagtacaaccccaagatgcgtccttccttcctggagata
atcaacagcctcaaggaggagctggagcctccgttcagtgagatgagcttcttcttcagc
gaggagaacaagcccccggacactgaggagctggacatggaggtggagaacatggagaac
gtgccactggaccctgcacccagcagaccccccactgctgttcctctaccctcccaggga
cccatgggggccacagggggctragcaccccctcctccccagcagttatccccaatgcaa
tgcccttctaataccctgaagggacctggctctccctccacctcagtcccggctgcctct
gtctcggcctccccaggcctggccttggacaagcactcaggacagatatcggccaacggg
ccagtggtggtgctgcggcccaactttgaggacacacagaactacgctcacatgaacggg
gggcgcaagaatgagcgggcgctgccactgccccagtcttcagcctgctga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112252650
Entry
112252650         CDS       T05605                                 

Definition
(RefSeq) hepatocyte growth factor receptor-like
  KO
K05099  proto-oncogene tyrosine-protein kinase Met [EC:2.7.10.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04020  Calcium signaling pathway
otw04510  Focal adhesion
otw04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112252650
   04020 Calcium signaling pathway
    112252650
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112252650
   04520 Adherens junction
    112252650
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112252650
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     112252650
Protein kinases [BR:otw01001]
 Receptor tyrosine kinases (RTK)
  MET family
   112252650
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Sema Pkinase TIG Kinase-like Pkinase_fungal
Other DBs
NCBI-GeneID: 112252650
NCBI-ProteinID: XP_024279857
LinkDB
Position
6
AA seq 1431 aa
MKNICLLDIAHIVIIRWALCFSGSVVMGQCNEAAENSKLNLSVTYDLPTFEAISAIQNLV
TFEGTVYIGAVNRIYALSENLTKLSEYQTGPVSEGAVRRRCGPSCQDGACGKTNAVVDNY
NMALLVERYYDDELFSCGSADAGVCRRHLLERKKVDREVQCMYSPKTDQGGRHGCPDCVT
SPLGSRVLNVESGGVVRFFVGNSEIPGSPSRMISSPQAQQPQHHTISVRQMKETQDGFRF
FSDQSYMNLAPGLRGDHHLQYVYSFQSGYHAYFLTVQREGHSSQVYHTRIVRMCGTDPEL
RRYVEMPFECILTERRRRRRSASIEVFNVLQAAHVAKAGRELRQEMGLKEGEDVLFAAFA
RSKPDSPEPSANSAVCVISLADVNNFFKDFIQKCHTKQPYHFTGSEEKRCYNGSSSDNSF
GCGKHEEGYRLEVTSTMARLDYFSGQFSNVLLTSIAVATAQEQTVASLGTADGRLIQVVV
SRSKRSTPHVDFRLDDSRPVSPEVALLSPQRHDGSPQRSQDGSLLLVTGNKITKVPLIGP
GCEQQWMCSSCLLAPGFMGCGWCDGRCTRAAQCHPASLWTQESCPPVITTISPANGPLGG
STKVTVCGRNFGFNKTERFDHTLISLDVAGAPCKLLKRESNSNRLVCVPASPVNSSLASS
VVKVHSGKEMSQTQGFTFVNPVIREIFPAFGPKSGGTVLTIRGSFLDSGNTRQVTVGNAT
CEILSVSVTMLMCRTPPQSAQSLQAVYVRVDSVVREAPVLFAYNEDPLISSIQPTRSFIS
GGSTVVAQGFYLHSASPPQMVLIPTAQDGKVFTVSCTQGEDRLTILCTTPSLKDLGLQPP
VVTKVAFVLDGFTAPQFDLLYVEDPRFEDFQRPTVTSKGNKSILEIKVPGRVDVEAMKGE
VLKVSNRTCESVTVVGNTLECTVPMELRDATNELEVEWRQASSSVSLGRVMLAHEQDYRG
LIAGCVCVSLLLLLLLALFIWKRRNKHIDDLAEGKVWYDGRAHIQHLDMLANARSVSPTN
EMVSHESVDYRTTLLEDQGVERPESCRGAPPIYGGHGELLSPRLGLGGMGMGMGIGLGVE
GELVSPLLSASVHIDTSQLHPDLLKEVQHVVIAREHLLLHLNQVIGRGHFGCVFHGTLLE
ADGQKQHCAIKSLNRITDLEEVSQFLKEGIIMKDFSHPNVLSLLGICLPTEGSPLVVLPY
MKHGDLRNFIREETHNPTVKDLMGFGLQVARGMEYLASKKFVHRDLAARNCMLDESYTVK
VADFGLARDVYDKEYYSIHNKSGVKLPVKWMALESLQTHKFTPKSDVWSFGVLLWELMTR
GAPPYSDVNSFDITVFLLQGRRLLQPEFCPDPLYNVMVECWHPKSERRPTFSELVSLINA
IFSSFSGEHYILLNTTYVNIDKMSPYPPLISSSSSTSSTPHGHPLERDCCT
NT seq 4296 nt   +upstreamnt  +downstreamnt
atgaagaatatctgcttgttggacatcgctcacattgtgatcatccgctgggctctttgt
ttctctgggtccgtggtgatgggtcagtgtaatgaggcagctgagaactccaagctcaac
ctgtctgtgacctatgacctgcccacctttgaggccatctccgccattcagaacctggta
accttcgaggggaccgtctacattggtgccgtgaaccgaatctacgcactgtcagagaac
ctgaccaagctgtcggagtaccagaccgggcccgtgtctgaaggcgctgtcagaaggcgg
tgtggtcctagttgtcaggatggagcctgcggtaagaccaacgctgtggtggacaactat
aacatggccctgctggtggagcgttattatgacgatgagctgttcagctgcggctcagca
gacgccggtgtctgccgtcgccacctgctggagagaaagaaggtggacagagaggtacag
tgcatgtattcacccaagacagatcaaggaggacggcacggctgccccgactgcgtgact
agccccctggggtcccgtgtgctcaacgtggagagcggaggcgtggtgcgattcttcgta
ggaaactcggagatccccggaagcccatcccggatgatctccagcccccaggcccagcag
ccacaacaccacaccatctcagtgcgtcagatgaaagaaacccaagatggtttccgcttc
ttctccgaccagtcctacatgaatttggccccgggcctccgcggcgaccaccacctccag
tatgtctattccttccagagcggctaccacgcctacttcctcaccgtgcagcgcgagggc
cacagctctcaggtttaccacacccgcatcgtccgcatgtgcggcacggacccggagctg
cggcgctacgtagagatgccattcgagtgcatcctgacggagaggaggaggcggcggcgc
tcagccagcatcgaggtgtttaatgtcctccaggcagcccacgtggccaaggcaggccgc
gagctgaggcaggagatggggctgaaggaaggggaggacgtgctgttcgccgcctttgcc
cggtccaagccagactccccggaacccagtgcaaactcggccgtctgcgtcatctcactg
gcagacgtcaacaacttcttcaaggacttcatccagaagtgccacaccaagcagccgtac
catttcacaggctccgaggagaagcgctgctacaacgggagttcgtcagacaactcgttt
ggctgtgggaagcatgaggagggctaccgtctggaggtgaccagtaccatggccagacta
gactacttcagcgggcagttcagcaacgtcctgctcacctccattgccgtggcgactgca
caggagcagaccgtggccagcctgggcaccgcagacggacgcctcatacaggtggtggtc
tcccgttccaaacgcagcacgccccacgtggacttccgcctggatgactcgcgccccgtg
tcccccgaggtggctctcctgtctccccagcgccacgacggctccccccagcgcagccag
gacggctcactcttgttggtgacaggaaataagatcaccaaggtccctctgattggtcct
ggctgtgagcaacagtggatgtgtagttcctgcctgctggcgccaggttttatgggatgt
ggctggtgtgacggccgctgcaccagggcagcccagtgtcacccagcgtccctctggacc
caggagtcctgccctcccgtcatcaccacgatctccccagccaacggccccctgggaggg
agcaccaaggtgacggtgtgtgggaggaactttggcttcaacaagacggagaggtttgac
cacacactcatcagcctggacgtggccggagcaccctgcaaactactgaaacgagagagc
aacagcaacaggttggtgtgtgttccggcgtctcctgtgaactcgtctctggctagtagt
gtggtgaaggtccacagtggcaaggagatgtcccaaacacagggattcacctttgtgaac
ccagtaatcagggagatcttccctgcattcggtcctaagtcaggaggcaccgtgctcacc
atcagaggctctttcttagacagtggcaacaccagacaggtcactgtggggaacgcaacc
tgtgagatcctgagtgtgtcagttaccatgctgatgtgcaggacccctccccagtcggcc
cagtccctccaggcggtgtatgtgagggtggactctgtggtccgagaggcccctgtactc
ttcgcctacaatgaagaccctctcatctccagcatccagcccacacggtccttcatcagc
ggaggcagcactgtggtggcccagggcttctaccttcactcggcttccccgcctcagatg
gtgctcatccccacagcccaggacggcaaggtcttcactgtgagctgtacgcagggtgag
gacaggctgaccatcctgtgtaccactccctccctgaaggacctgggcctgcagcctcct
gtggtcaccaaggtggcgttcgtcctggatggtttcaccgcgccccagtttgacctgctg
tatgtagaggaccctcgcttcgaggacttccagagacccaccgtcacatccaaaggcaac
aagagcatcctggagattaaggtgccaggtcgtgtggatgtggaggcgatgaagggggag
gtgctgaaggtgtctaacaggacctgtgagagtgtgactgtggtgggtaacaccctggag
tgtactgtccccatggagttacgggatgccaccaatgaactggaggtggagtggcgtcag
gcatcgtcttcagtgagtctgggaagagtgatgttggctcatgaacaggactacagaggg
ctgatagctggctgtgtgtgtgtcagcctgttactacttctgctgctcgctctattcatc
tggaaaaggaggaacaagcacattgatgatctggctgagggtaaggtttggtatgatggc
cgggctcacattcagcacttggacatgttggcaaatgcccgaagcgtcagccctactaac
gaaatggtgtcccatgagtcggtggactatagaaccaccctgctggaggaccagggcgtg
gagaggccagagtcgtgcaggggggctccccccatctacgggggccatggggaactcctg
tcccccaggctggggctgggtggcatggggatggggatggggataggtctgggggtggag
ggggagctggtgtcccctctcctgtcggcctcggtccacatcgacacgtcccagctgcac
cctgacctgctgaaggaggttcaacatgtggtcatcgccagggaacacctgctgttacac
ctaaaccaggtcataggcagaggtcactttggctgtgtgttccatgggaccttgttagag
gctgacggtcagaaacagcactgtgccatcaagtccctcaaccggatcactgacctggag
gaggtgtctcagttcctgaaggaggggatcatcatgaaggacttcagccaccccaacgtg
ctgtctctactagggatctgtctgcccactgagggctctcctctggtggtgctgccgtac
atgaagcacggagacctcaggaacttcatacgggaagagacacataaccccacagtgaag
gatctgatgggctttggtctgcaggtggcccggggcatggagtatctggccagcaagaag
tttgtccacagagacctagccgcaaggaactgcatgctggatgaaagctacacagtgaag
gtggcagactttggcctggccagggatgtgtatgataaggagtactacagcatccacaac
aagagtggagtcaaactacctgtcaagtggatggccctggagagcctgcagacacacaag
ttcaccccaaagtctgatgtgtggtcgtttggcgtgttgctatgggaactgatgacccgg
ggagcaccgccgtattcggacgtcaactctttcgacatcactgtgttcctactgcaaggg
agacggctgctgcagccagagttctgccctgacccactgtataacgtgatggtcgagtgc
tggcacccaaagtcggagaggaggcccaccttctcagagctggtatcccttatcaacgcc
atcttctccagcttcagcggagagcactacatccttctcaacaccacctatgtcaacata
gacaagatgagcccctacccccctctcatctcctcatcctcctctacctcctccacccct
cacggccaccccctggagcgagactgctgcacctga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112256098
Entry
112256098         CDS       T05605                                 

Definition
(RefSeq) platelet-derived growth factor receptor beta-like isoform X1
  KO
K05089  platelet-derived growth factor receptor beta [EC:2.7.10.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04020  Calcium signaling pathway
otw04510  Focal adhesion
otw04540  Gap junction
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112256098
   04020 Calcium signaling pathway
    112256098
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112256098
   04540 Gap junction
    112256098
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112256098
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112256098
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:otw04090]
    112256098
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     112256098
Protein kinases [BR:otw01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   112256098
CD molecules [BR:otw04090]
 Proteins
  112256098
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase I-set Ig_3 Ig_2 ig V-set C2-set_2 Psg1 DUF4715
Other DBs
NCBI-GeneID: 112256098
NCBI-ProteinID: XP_024284854
LinkDB
Position
8
AA seq 1094 aa
MRSVRVSTLHLTALLTALLHFCPEYRCVEISPSNSEVVMTPGDSMIFTCSSWGTVGWRFK
RNDDIPYFGVENQNTTSVLILDNVTWKHTGVYVCAEALTDEAREVAVFVPDPEVWFIESS
HGMVTKTSEEGTIPCVVTNPQINVTLYETDSDMHLKGVYIPSEGYRASLEDRTYVCRGEL
KGEEKESQEFYVLSIVVPETIDAYINASKTVLKQGEPLTVNCTVHGVELVFFSWDYPNRD
VDFIEPLTDILLSQSMRSCLTVSKATLANTGQYVCHVHESVQDQRATANINITVLERGFV
ELRSVQERNVSAQLHQNVELRVEIESYPAPRVRWTKDNATVNGDNTVITRQEHETRYVSI
LTLVRIRTEQKGLYTVLVANGDDTKEVTFDLEVKVPPQITDLSDHHLPGKRHAVTCVAEG
VPSPSIQFFSCDSMLKCSNRSTVWHPLVSDPETLSIQTNISFNESRKVGQVRSQVTFHKP
QQVTVRCEASNEGGVRRRDVKLVSSTLFSQVAVLAAVLPLVVILITSIIILIAVWRKKPR
YEIRWKVIESVSLDGHEYIYVDPIHLPYDLAWEMARDSLVLGRTLGSGAFGRVVEATAYG
LSHSQSSTKVAVKMLKSTARRSETQALMSELKIMSHLGPHLNIVNLLGACTKQGPLYLVT
EYCRYGDLVDYLHRNKHTFLQYYAEKNQEDSGCRISGGSTPLSQRKGYVSFGSEFDGGYM
DMSKDEPTVYVPMQELKDTIKYTDIQPSPYESPYQHHLYQEQDQTTVDSALVISDCPTLS
YSDLIGFSYQVAKGMEFLASKNCVHRDLAARNVLICEGKLVKICDFGLARDIMHDSNYVS
KGSTFLPLKWMAPESIFHNLYTTLSDVWSYGILLWEIFTLGGAPYPDLPMNELFYSALKR
GYRMAKPNHATDEVYEVMQKCWDEKYERRPEFSFLVHTMGNMLTDSYKKRYCQVNDEFFK
RDHPAVVRTKPRLSSHFPTPALTPSTAPATPQDTNPYPLTGDFRSEADGEEASYNDYIIP
IPDPKPEEEVCSEANDMPTKSLASSRALEDEEADSISQETVEADTIPEEKYLHANQALIP
LESSGTPEAEDSFL
NT seq 3285 nt   +upstreamnt  +downstreamnt
atgaggagtgtcagagtgtccactctccatctgacagccctactaacagctcttttgcac
ttctgccctgagtaccgttgcgtggagatctcccctagcaacagcgaggtcgtcatgaca
ccgggcgactccatgatcttcacctgttctagctgggggacagtcggatggaggttcaag
cggaatgacgacattccttattttggagtggagaaccagaacacaaccagtgttctcatt
ctggacaacgtgacgtggaaacacacaggagtgtacgtctgtgccgaggctttgacggac
gaggctagagaggtggcagtctttgtgccggaccctgaagtgtggttcattgagagctcc
cacggcatggtgaccaagaccagcgaggaggggaccatcccctgtgtggtcaccaacccc
cagatcaacgtcaccctctacgagacggacagtgacatgcacctaaaaggggtctacatc
cccagtgagggctacagggcatccctggaggacaggacctatgtgtgtcgtggggagctg
aaaggagaggagaaagagtcccaggaattctacgtcttaagtattgttgtcccggagaca
atcgacgcctacatcaatgcgtctaagacggtgctgaagcagggtgagcctttgacagtg
aactgcacggtgcatggagtggagctggtcttcttctcctgggactaccccaacagagac
gtggacttcatcgagccattgacagacatcctgttgtcccagagcatgcgctcctgcctc
accgtctctaaggcgacgctggccaacacagggcagtacgtgtgtcacgttcacgagagt
gtccaggaccagagggcaaccgccaacatcaacatcaccgtcctcgagcgaggcttcgtg
gagctgaggtctgtccaggagcgtaacgtctcggcccagctgcaccagaacgtagagctg
agggttgagatcgagtcctaccctgctccacgtgtccgctggaccaaagacaacgccacc
gtcaacggagacaacaccgtcatcaccaggcaggagcacgagaccaggtacgtcagcata
ttgaccttggtgaggatcaggacggaacagaagggactttacactgttctcgtcgccaac
ggagacgacaccaaggaagtgacatttgatctggaggtcaaagttccccctcagataaca
gacctgtcggaccaccacctcccagggaagaggcatgcagtgacctgtgtggccgagggg
gtcccctccccatccatacagtttttcagctgtgacagcatgctcaagtgcagtaaccgg
agcacagtgtggcatcccctggtgtcagaccctgagaccctgagtatccagaccaacatc
agtttcaatgagagccgtaaggtgggccaggtccgcagccaggtcaccttccacaagccc
caacaggtgaccgtccgctgtgaggccagcaacgagggaggagtccgcaggagagacgtc
aaactggtgtccagcactctgttctcccaggtggcagtgttggctgcggttctacccctg
gtggtcatcctcatcacctccatcatcatcctcatcgctgtgtggaggaagaagcctcgc
tatgagattagatggaaggtgatagagtcagtgagtctggatggccatgagtacatctac
gtcgaccccatccacctgccctacgacctggcatgggagatggctcgagacagcctggtg
ctgggtcgtactcttgggtccggggcgtttggcagggtggtcgaggcgactgcctacggt
ctcagtcattcccagtccagcacgaaggtggcagtaaaaatgctcaaatccacagccagg
aggagtgagacccaggctctgatgtcagagctgaagatcatgagccacctggggcctcac
ctcaacatcgtcaacctgctgggagcctgcaccaaacagggtcctctctacctggtgacg
gagtactgtcgctatggagacctggtggactacttacacaggaacaagcacacgttcctg
cagtactacgctgagaagaaccaggaggactctggttgccgcatctctggagggagcacc
cctctcagccagaggaaaggctacgtgtcgtttggcagtgagtttgacggtggctacatg
gacatgagtaaggacgagcccacggtgtacgtccccatgcaggagcttaaagacaccatc
aaatacactgacatccaaccttctccatatgagtcgccctaccagcaccacctttaccag
gaacaagaccagaccacagtggacagtgccctggtcatcagtgactgccctaccctcagc
tattctgacctcattggcttcagctaccaggtggccaagggcatggagttccttgcctcc
aagaactgtgtccatcgtgacctggccgccaggaacgtgttgatctgtgaggggaagctg
gtgaagatctgtgactttggtctggccagagacatcatgcacgactccaactacgtctcc
aaaggcagcaccttccttcctcttaagtggatggccccagagagtattttccataacctg
tacaccaccctgagtgacgtgtggtcctatggcatcctgctctgggagatcttcaccctg
ggaggagccccctaccctgatctgcccatgaatgagctgttctacagtgccttaaagaga
ggatatcgcatggccaaacctaaccacgccactgatgaagtttatgaagtcatgcagaag
tgctgggatgagaagtacgagagaagaccagagttctcttttctggtgcacacaatgggg
aacatgctcacagacagctataaaaagagatactgccaggtcaacgatgagttcttcaag
cgtgaccacccagccgtggtccgcaccaaacccaggctctcctctcacttccccactccg
gccctaaccccgtccaccgcccctgctaccccccaggacacaaacccctaccccctcact
ggggacttcagatccgaggcagatggtgaggaagcttcctacaacgactacatcatcccc
atcccagaccccaagcctgaggaggaagtctgctccgaggctaacgacatgccaacgaaa
agcctcgcaagttctcgggctctggaggacgaggaggctgattccatctcccaggagaca
gtggaggcagacaccattccagaggagaaatatctccatgccaaccaggccctgattcca
ctggagtcctctggaacaccggaagcggaagacagcttcctgtaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112256198
Entry
112256198         CDS       T05605                                 

Definition
(RefSeq) vascular endothelial growth factor receptor kdr-like
  KO
K05096  FMS-like tyrosine kinase 1 [EC:2.7.10.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04020  Calcium signaling pathway
otw04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112256198
   04020 Calcium signaling pathway
    112256198
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112256198
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112256198
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     112256198
Protein kinases [BR:otw01001]
 Receptor tyrosine kinases (RTK)
  VEGFR family [OT]
   112256198
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Ig_3 Pkinase I-set Ig_2 ig VEGFR-2_TMD V-set Ig_4
Other DBs
NCBI-GeneID: 112256198
NCBI-ProteinID: XP_024285037
LinkDB
Position
8
AA seq 1246 aa
MAPLNCAKLSVVFHLITTISGQVSLPAPLLLPSEDTHLLHAGNSLNLTCRGASQLHWRLP
WRNVTSEGVHVEECEPQANAHCSKLLVRNLIPNDTGLYSCRYAQPSADISSTYVYVKDEK
HPFVEHHFHNPSTLFSYRHEATLVIPCRTTSPDQIVTLEAWPPLSKEVEQGKEWDPKMGF
KIPYGPYKFYHLLTCVTSVNGQRVQSKYIPLRTTILLRNVKINPRRIKLLVGDSLVLNCS
AETTFNGRINFTWEYPKRMVHRNPIINKSKEDPALVTSMYQAITLSNITMDNRGVYRCTA
DIGSAETGNKKHASAKVTIYEHPYLNVSYKNERARRVVYTEGRNKLMFEPKVNALPPPDT
MTWYKDGVPINENSTCYESSGYNLFVKDVKQKDAGVFTIALGNKERGLYRNLSYTLIVQV
RPKISEEEVASEYVQPYMFGMQHQLTCTAFGVPMPNITWLWQPCHPDPTDKECTLYTEPI
PVQIDDKGNYSHNRIENIYNKNQLVKGKNKTVSTLVVGAAHISGIYSCVAENELGNCTLR
TIFYVDDHPQHLAIEPQTAIEGDDVTLTCRGTRYLYTDLQWYNPQNYTVTPANITALQLS
PYAISLSLSLHNVSRSHTTGYQCWAGNLHSKRVIVQTVLTVDERKRPWLRQNLTNQDVNS
SSTLTMACYALGMPPPYITWYKDKLPVQEGPGITLREDGVLTIERVKKDDEGLYECLASN
NEGSVKASAVVTVVGDEGKPNIEVIVLVCTGAAATFLWLMLILFIRKLRKPDYMMGPSII
IDPDECPLDEQCERLQYDGSKWEFPRDRLRLGKTLGHGAFGKVVEASAFGIDKLSTCKTV
AVKMLKGGATTNERKALMSELKILIHIGHHLNVVNLLGACTKPGGPLMMIVEYCKYGNLS
NYLRSKRADFIVYKSQDGKVVTSGSGCDLSELIKRRLESVASTGSSASSGFVEDKSYCDS
EEEEEEPEDLYKRVLTMEDLICYIFQVAKGMEFLASRKCIHRDLAARNILLSENNVVKIC
DFGLARDIYKDPDYVRKGDARLPLKWMAPEAIFDKIYTTQSDVWSFGVLMWEIFSLGASP
YPGLHIDEDFCCRLKEGTRMRAPEYSSSEIYQTMLDCWQAEPGDRPTFTELVERLGDLLQ
ASVQQEGKHYIPIAALLSKEGDPSNTALSEETNTRPLSYRDSGSTWNIKIRPASVKTFDE
VTMENGSNDNHEGGQSDSGMGLLSDDMNTLKRLESLARPLSIMALA
NT seq 3741 nt   +upstreamnt  +downstreamnt
atggccccgctcaactgtgccaaactctcagtcgtctttcatttaatcacaactataagc
ggtcaggtcagccttccagcccctctgctgctgccctctgaggacacacaccttctacac
gcagggaattcactcaacctcacctgcagaggtgcgtcccagctgcactggaggctgccc
tggcggaacgtcacctcggagggggttcatgtggaggagtgtgagccccaggcgaacgcc
cactgtagtaagctgctggtgagaaacctgatccccaacgacacggggctctacagctgc
aggtacgcccagccctccgccgacatcagctctacctacgtatatgtcaaagatgaaaaa
catccgtttgtggagcaccatttccacaatccatccaccctgtttagctacagacatgaa
gccaccctagtgattccctgtagaacaacttctcctgaccagatcgttactcttgaagcg
tggccacccttatcaaaggaggttgaacaagggaaggaatgggaccccaaaatgggcttc
aagatcccatacggtccctacaaattctatcatctcctaacctgtgtcaccagcgtcaac
ggccaacgggtccagtccaaatacatccctctgaggactactatcttgctgaggaacgtg
aagatcaacccaagacgtatcaagctgttagtgggagatagcctggtcctcaactgctcc
gcagagaccaccttcaatggaaggatcaacttcacttgggaatacccaaagagaatggtc
catcggaaccctatcatcaacaagtccaaagaagatccggctttggtcaccagtatgtac
caagcaatcaccttgtccaacatcaccatggacaacaggggcgtgtacaggtgcacagct
gatatagggagcgctgagacggggaacaagaagcacgcctcagccaaagtcaccatctac
gaacatccatacctgaatgtgtcctataagaatgaacgggccaggagagtggtctacacc
gagggtagaaacaagctgatgtttgaacccaaggtcaatgcactgccaccacccgacact
atgacatggtataaggatggcgtccccatcaacgagaactccacctgttacgagtcttca
ggctacaacctcttcgtcaaggacgtgaagcagaaggatgccggggtcttcaccatcgcc
ctgggcaacaaagagagaggcctctacaggaatctcagctacactctgatagtccaagtg
agaccaaagatctccgaagaggaggtggcctcggagtacgtgcagccctacatgttcggc
atgcagcaccagctaacctgcaccgcctttggagtgcccatgcccaacatcacgtggctc
tggcaaccatgccatcctgaccccaccgacaaagagtgtaccctttacactgagccaatc
ccggttcaaattgacgataaggggaactactcacacaaccggattgagaacatatacaac
aaaaatcaactggtaaaagggaagaacaagactgtgagtacgctagtggtgggagcggct
cacatctcggggatctactcctgcgtggccgagaatgaacttggcaactgcacactgaga
accattttctatgtggacgatcaccctcagcacctggccatcgagccccagactgccatc
gagggtgatgacgtcactctgacttgtcgcggcactcggtacctgtacacagacctgcag
tggtacaaccctcagaactacactgtcacccccgccaacatcacggccctgcagctcagc
ccgtacgctatctctctctccctctccctgcacaacgtgtccaggagtcacacaacaggc
taccagtgctgggcgggtaacctccacagcaagagggtcatagtccagactgtgctgact
gtggatgagaggaagaggccgtggctgagacagaacctgaccaatcaggatgtaaacagc
agcagcactctgactatggcctgctacgccctgggtatgccgccaccctacatcacctgg
tacaaagacaagctaccagtacaggagggtccaggtattactctgagggaggatggggtg
ctgacgatcgagagagtgaagaaagatgatgagggcttgtacgagtgtctggccagcaac
aatgaggggagtgtgaaagccagcgctgtcgtcactgtcgtgggtgatgaggggaagccc
aacattgaggtgatcgtcctggtgtgtacaggagctgccgccaccttcctctggctcatg
ctcatcctcttcatccgcaagctgaggaagccggactacatgatgggtccatccatcatc
attgacccagacgagtgtcctctggacgagcagtgtgaacgcctgcagtacgatggcagc
aaatgggagtttccccgagaccgcctcagactgggcaaaactctgggccatggagccttc
gggaaagtggtggaggcctctgcttttgggattgacaagctmtcgacctgcaagactgtg
gccgtcaaaatgctgaaaggaggagctacgacaaatgagcgcaaggctctgatgtcggag
ctgaagatcctgatccacattggtcaccatctgaacgtggtcaacctcctgggagcctgc
accaagcctggaggtccattgatgatgatagtggagtactgcaaatatggaaacttgtca
aactacttgagaagcaagagggctgatttcatcgtttataagagccaggacggtaaggtg
gtgacgtcggggtcgggctgtgacctaagcgagctcatcaagcggcgcctggagagcgtg
gccagcaccggaagctcggccagctccggctttgtggaagataagagctactgcgactca
gaggaagaggaggaagagccagaggatctgtacaagagagtgctgacaatggaagatttg
atttgctacattttccaagttgcaaaaggcatggagttcctggcttcacgcaagtgtatt
catcgtgatctggctgcaagaaacatcctactgtctgagaataatgttgtgaagatatgc
gattttggactggccagagacatctacaaagacccagactacgttcgcaaaggagatgcc
agactgcccctcaagtggatggcgccagaggccatttttgacaagatctacaccactcag
agcgatgtgtggtcctttggagttctgatgtgggagatcttctctctgggtgcctctccg
tatcccggcttacacatcgacgaggacttctgctgccgactgaaggaagggaccaggatg
agagctccggaatactcctcctctgaaatataccagaccatgttggactgctggcaggct
gagccaggagaccggccaaccttcactgaactggtggagagactaggagacctgctacag
gccagcgtacagcaggagggaaagcattacatccctatagcagccctgctgtctaaggag
ggagacccctccaacacggctctgtcagaggagaccaacaccaggccactctcttaccgc
gactcagggagcacctggaacattaagatccgtccagcaagtgtgaagacctttgatgag
gttaccatggagaacggttctaacgacaaccatgaggggggccagtcggacagtgggatg
ggcctgttgtctgatgatatgaacaccctgaagcgcctggagtccttggcccgaccactc
agcatcatggccctggcgtga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112260663
Entry
112260663         CDS       T05605                                 

Definition
(RefSeq) epidermal growth factor receptor-like isoform X1
  KO
K04361  epidermal growth factor receptor [EC:2.7.10.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04012  ErbB signaling pathway
otw04020  Calcium signaling pathway
otw04068  FoxO signaling pathway
otw04144  Endocytosis
otw04510  Focal adhesion
otw04520  Adherens junction
otw04540  Gap junction
otw04810  Regulation of actin cytoskeleton
otw04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112260663
   04012 ErbB signaling pathway
    112260663
   04068 FoxO signaling pathway
    112260663
   04020 Calcium signaling pathway
    112260663
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112260663
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112260663
   04520 Adherens junction
    112260663
   04540 Gap junction
    112260663
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112260663
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    112260663
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112260663
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112260663
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     112260663
Protein kinases [BR:otw01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   112260663
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   112260663
  Exosomal proteins of pancreatic cancer cells
   112260663
  Exosomal proteins of bladder cancer cells
   112260663
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like Kdo APH LapA_dom
Other DBs
NCBI-GeneID: 112260663
NCBI-ProteinID: XP_024291711
LinkDB
Position
10
AA seq 1238 aa
MFSYIRWGRMKTSLTNTMATLFQIWIIFTSLVSYALPEKKVCQGVTNRFSLLGSKEDHYL
NMVKTYSNCTVVLENLEVTYMEDDHDLSFLRSIQEVGGYVLIALNTANRIPLDNLRIIRG
HTLYDSGFALAVVLNYNKSMRAGTTELPLTSLTEILKGGVKFSDNQLCNVETIQWLDIVN
SNSKPNMQLPEPSNNRLCKRCDPGCFNGSCWAPGPEHCQTLTKLNCAQQCSKRCKGPSPI
DCCNEHCAAGCTGPRPTDCLACRDFQDDGMCKDSCPRLLLYDRNLHQLVNNPDGKYNFGA
TCVKTCPHNYVVTDHGACVRTCSGDTYEVDEGGVRKCKKCDGLCPKVCNGLGMGKLANIL
SINATNIDTFKNCTKINGNIAIIYTSIHGDTFTKAPKMDPARLEVFKTVREITGYLLIQN
WPENMTSLSPFENLEIIRGRTKRVLLSLAITQLTITHLGLRNLKEISDGDVVIAKNPNLC
YTKNHHWKQLFKSDTQTARLENNADAADCGMQNSTCDRMCTRDGCWGPGPTMCFACQDYS
RAGSCVDSCNLLEGEPRETEVNKTCVECHLECQLLNGTKTCSGPGHEQCTRCANFKDGDN
CVPWCPRGVAGGKNTFIWKYADKMKVCQLCHQNCTEGCTGPGLKGCQSKGNSGLSVIAAG
VVGGMLAFLIMGLSVFVLLRRRHIKKKRTLRRLLQERELVEPLTPSGEAPNQALLRILKE
TEFKKIKVLGSGAFGTVYKGLWVPEGEDVKISVAIKVLREATSPKANKEILDEAYVMAGV
DHPHVCRLLGICLTSTVQLVTQLMPYGCLLDYVKENKDNIGSQYLLNWCVQIAKGMSYLE
EHHLVHRDLAARNVLVKTPQHVKITDFGLAKLLNSDEKEYHADGGKVPIKWMALESILYR
TYTHQSDVWSYGVTAWELMTFGTKPYDGIPASEVAGVLEKGERLPQPPICTIDVYMIMVK
CWMIDADSRPRFRELIAEFSKMARDPPRYLVIQGDDRMHLPSPTDTKFYHSLISGEDMED
AVDADEYLVPQHGFFSSSSTSRTQLLHSTSQNSTLNSSIGMCHSRNGNGFPVREGSMVLR
YIADPTDRFLDHAFQPSPDYINQNGVSDMMNPVYQHPGPPRTLLPTISSDDAEAEYLNCY
KNGAVGPEYLNTLQPSLLSPTTSNGISNGLNPTANGHSPISNGLLSPTSNGLSPISNGGL
HHVQKNQPQNSIDNPDYQQDFTPSIKTHIPAAEYVGPN
NT seq 3717 nt   +upstreamnt  +downstreamnt
atgttttcatacattcggtggggaagaatgaagacgagtttaacaaataccatggctaca
ctgtttcaaatctggatcattttcacctctttggtctcctatgcgttgccggaaaagaaa
gtgtgccagggcgtcactaaccggttcagcctgcttgggtcaaaagaggaccactacctg
aacatggtcaagacctacagcaactgcaccgtggtcctggagaacctggaggtcacatac
atggaggacgaccatgatctgtctttcctcaggtccatccaggaggtgggtggctacgtt
ctgatcgccctcaacacagccaacaggattcccctggacaacctgcgcatcatccgaggc
cacactctctatgacagtggctttgccctggctgtggtgctgaactataacaagtccatg
cgagcaggcaccactgagctgcctctgaccagcctcacagagatcctgaaaggaggagtg
aagttctcagacaaccagctgtgtaacgtggagaccatccagtggttggacattgtaaac
agtaacagcaaacccaacatgcagttacctgaacccagcaacaatcggctctgtaaaaga
tgtgatcctggatgcttcaatggttcctgttgggcgcccggcccagaacactgccagacg
ttgacgaagctgaactgtgcccagcagtgctctaagaggtgtaagggtccgtcccccatc
gactgctgcaacgaacactgtgctgcaggctgcactggacccagacctacagactgtctg
gcctgccgtgactttcaggatgatgggatgtgtaaagactcgtgtccccgcctcctgctc
tacgaccgcaaccttcaccaattggtcaacaacccagacgggaagtacaactttggggcc
acctgcgtcaagacttgtcctcataactatgtggtgacggaccatggagcgtgcgttcgg
acatgcagtggtgacacatacgaggtggacgagggaggggtcaggaagtgcaagaagtgt
gatggactgtgccccaaagtttgcaatggacttggaatgggaaaacttgccaatattctg
tcaattaatgccaccaacattgacacatttaaaaactgtaccaaaatcaatgggaacatt
gctattatctacacatctatccatggggacacgttcaccaaagcacctaagatggatccg
gccaggctagaagttttcaagacagttagagaaattaccgggtacttgctgattcagaac
tggcctgagaacatgacgtccctcagtccatttgagaacctggagatcatccgtggacgg
accaagcgtgttctgttgagcttggccataacccagttaaccatcacccacctggggctg
cgtaacctgaaggagatcagtgacggagacgtggtcattgcaaaaaaccccaacctctgc
tacaccaagaatcaccactggaagcagttgttcaagtccgacactcagaccgcccggctg
gagaacaacgccgacgcagccgactgcgggatgcagaacagcacgtgtgacaggatgtgt
accagagatggctgctggggtcctggacccaccatgtgtttcgcctgtcaggactacagc
cgagcaggaagctgtgtcgactcctgcaacctactggagggggagccacgggagactgaa
gtgaataagacgtgtgtggagtgtcaccttgagtgtcagctcctcaacgggaccaagacc
tgctctggaccaggtcatgagcagtgtacccggtgtgccaacttcaaagatggagacaac
tgtgtcccatggtgccctagaggggtggctgggggcaagaacaccttcatctggaaatac
gcagataagatgaaggtgtgccagctgtgccaccagaactgtaccgagggatgtactggt
cctggtctgaaaggctgtcagtctaaaggtaactctgggctgtcagtgattgcagctggt
gtggtgggcgggatgctggcctttctcatcatgggcctgtccgtcttcgtgttgctaaga
cgacgccacatcaagaagaagaggaccctgcgaagactcctccaggagagagagttagtt
gaaccgctgacccccagtggggaggcgcccaaccaggctctgctccgtatcctgaaggag
acagagtttaagaagatcaaagttttgggatcaggggccttcggcactgtctacaagggt
ctgtgggtccctgaaggagaggatgtgaagatctctgtggccatcaaggttttaagagag
gccacatcacctaaagccaacaaggagatattggacgaggcctatgtgatggccggtgtg
gaccacccccatgtttgtcgtctgctgggcatctgcctgacctctacagtccagctggtc
acccagctcatgccctatggctgtctgctggactatgtcaaggagaacaaggacaacatc
gggtcccagtaccttctcaactggtgtgtacagatagccaaggggatgagctacctggag
gagcatcacctggtgcatcgtgacctggcagcgaggaacgtcctggtgaagacccctcag
catgtcaagatcactgacttcggcctggccaaactcctcaactctgacgagaaggagtac
cacgcagacggaggaaaggtaccaatcaaatggatggcactggagtccatcctctaccgg
acatatacacatcaaagtgacgtgtggagctatggtgtgaccgcgtgggagctaatgacg
tttgggaccaagccctatgacggcatcccagccagtgaggtagcaggggtgctggagaaa
ggcgagcggctcccccagcctcccatctgtaccatagacgtctacatgatcatggtcaaa
tgttggatgatcgacgcagacagcaggcctcgtttccgggagctgatagcagagttttcc
aagatggcgcgggatcccccacgttaccttgtcatccagggtgacgaccggatgcacctc
cccagccccactgacaccaagttctaccacagtctgatcagtggagaggacatggaagat
gctgtggacgcagacgagtacctagtgcctcagcacggcttcttcagtagctccagtacc
tcccgcacacagctcctacactctacgagccagaacagcacgttgaacagcagcattgga
atgtgccacagcagaaatgggaacgggttcccagtcagagaaggaagcatggttctccgg
tacattgctgaccccacagataggttcttggaccacgccttccagccatctccagactac
attaaccagaacggagtttcggacatgatgaaccctgtataccagcaccctggtccccct
cgcaccctcctccccaccatatcctcagacgacgcagaggcagagtacctgaactgctat
aagaacggggcagtggggcctgagtacctcaacaccctccagccttccctcctctccccc
accacctccaatggcatctccaatggcctcaaccccactgctaacggccattcccccata
tccaatggtctcctctcccccacctccaatggcctctccccaatttccaatggtggtctc
caccacgtccagaaaaaccagccccaaaacagtatagataacccagactaccagcaggac
ttcaccccctccatcaagacccacatcccagccgcagagtacgtgggcccaaactga

DBGET integrated database retrieval system