KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112215338
Entry
112215338         CDS       T05605                                 

Definition
(RefSeq) melanoma receptor tyrosine-protein kinase-like isoform X1
  KO
K04361  epidermal growth factor receptor [EC:2.7.10.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04012  ErbB signaling pathway
otw04020  Calcium signaling pathway
otw04068  FoxO signaling pathway
otw04144  Endocytosis
otw04510  Focal adhesion
otw04520  Adherens junction
otw04540  Gap junction
otw04810  Regulation of actin cytoskeleton
otw04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112215338
   04012 ErbB signaling pathway
    112215338
   04068 FoxO signaling pathway
    112215338
   04020 Calcium signaling pathway
    112215338
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112215338
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112215338
   04520 Adherens junction
    112215338
   04540 Gap junction
    112215338
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112215338
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    112215338
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112215338
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112215338
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     112215338
Protein kinases [BR:otw01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   112215338
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   112215338
  Exosomal proteins of pancreatic cancer cells
   112215338
  Exosomal proteins of bladder cancer cells
   112215338
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like APH
Other DBs
NCBI-GeneID: 112215338
NCBI-ProteinID: XP_024230062
LinkDB
Position
16
AA seq 1202 aa
MRPGSGIVIAALFSLGCSMTLTADKKVCQGISNRLTLLGTVDDHYNNLVRMYSNCTVVLE
NLELTYIQEYHDLSFLKSIQEVGGYVLIAVNKAAIIPLENLRLIRGHSLYDNKYALAVMS
NYEKNHSSVTLNYTRGLRELMLRGLTDILKGGVKIAHNPLLCNVETIQWWDMVNKAGNPS
MDFKLESYGRYCGKCDPGCYNGSCWTPGPENCQTFTKLKCAEQCSGRCRGPKPSDCCNEH
CAAGCTGPRPTECLACRDFQDDGTCKDACPPTMIYNPNTHQLASNPNAKYTFGATCVKTC
PHNYVVTDHGACVRTCSGNTHEVEENGVRRCKKCDGICPKVCNGLGMGPLTAVLSINASN
IDSFKNCTKINGDVSIIGTSLNGDRYTSTPKMDPAKLDYFRTVKEISGFLLIQAWPKHLD
SLSAFENLEIIRGRTKQFGQVSFAALNVAHLKYLGLRSLREISDGNIVVKNNPHLCYSNG
GHWNGLFRLDKQFARVDNNANISTCAQLNSTCDDMCTKEGCWGPGPTMCLTCLYYARRGR
CVGACHVLEGTPREYVLNNICLECDQECMVKNRTGSCFGSGPDKCVECAHVKDGPHCVYR
CPRGVLGDVDRPIWKYADKNRECQLCHENCTDGCSGPGLNGCNARGGSVPSAVAASVVGG
LLVFVVLALGVFVLVRRRHIVRKRTLRRLLQERELVEPLTPSGEAPNQALLRILKETEFK
KIKVLGSGAFGTVFKGVWIPEGENVKIPVAIKVLREATSPKANKEILDEAYVMASVEHPH
VCRLLGICLTSTVQLITQIMPYGCLLDYVKENKDLIGSQCLLNWCVQIAKGMNYLEERHL
VHRDLAARNVLVKTPHHLKITDFGLAKLLTADEKEYHADGGKVPIKWMALESILHWTYTH
QSDVWSYGVTLWELMTFGSKPYDGIPAREISGVLEKGERLPQPPICTIDVYMIMVKCWMI
DADSRPRFRELISEFSKMARDPSRYLVIQGDDCMYLPSPTDSKFYRSLISTSEDMEDVVD
AEEYLLPDKTTQHHNSGNGHLMRENSVILRYITDPTHGGSLEKDLTDPTHRGSLKKDITD
PTHGGSLEQDLAALPEYMNQNTKLSDVFNPNYEDPSVPAWATRTSSGYDPDNKFFNSLPR
VPEGPEYLNMARSTLPRSVCESNPDYQEDFLPQATPTSSHFLPAAENLEYLGLSAAVHTP
VR
NT seq 3609 nt   +upstreamnt  +downstreamnt
atgcgacctggaagtggaatagttattgctgccttgttcagcctgggctgcagcatgaca
ctgacagcggacaagaaagtgtgtcaggggatcagcaacaggctgacgctgctggggact
gtagacgaccattacaacaacctggtgaggatgtacagcaactgtaccgtggtcctggag
aacctagagcttacctacatccaggagtaccacgacctctccttcctcaagtccattcag
gaggttggaggctatgttctgatcgccgtcaacaaggcagccatcatcccactggagaac
ctgcgtctgatccgaggacactccctctacgacaacaagtatgccctggctgtcatgtcc
aactacgagaagaaccactcctctgtgacccttaactacacacggggcctaagggagctg
atgctgagaggactgacagacattctcaagggaggggtgaaaattgcccacaatcctttg
ttgtgtaatgtggagaccatccaatggtgggacatggtaaacaaggccggcaaccccagt
atggatttcaaactggagagctatggccgttactgtggcaagtgtgaccctggatgctac
aatggatcatgctggacaccaggaccagagaactgtcaaacatttaccaagctgaagtgt
gcagagcagtgctctggaaggtgtaggggtcctaaacctagtgactgctgtaacgaacac
tgtgctgcagggtgcaccggccctaggcctacagagtgtctggcctgcagagacttccag
gatgatggcacatgtaaggatgcctgccctcctaccatgatctacaatcccaacacccac
cagctggcttccaaccctaacgccaagtacacgttcggggccacttgtgtgaagacctgc
ccacataactatgtggtgacggaccacggggcgtgtgtccgaacatgcagtggcaacaca
cacgaggtggaggagaatggtgtcaggaggtgcaagaagtgtgacggaatctgtccaaaa
gtgtgcaatggacttggaatggggccgcttactgccgtcttgtcaatcaacgcctctaac
attgattctttcaaaaactgcaccaaaatcaatggcgatgtttcaataattggaacctct
ttgaatggtgataggtacacatcaacaccaaaaatggaccctgccaaactggattatttc
agaactgtgaaggaaatttcagggtttctgctcatacaagcttggccaaagcacctcgat
tctctcagtgcatttgaaaacctggagattatcaggggaaggaccaaacagtttggtcag
gtgagttttgctgccctgaacgtggcccatctgaagtatctaggcctccgctccctacga
gagatcagcgatggcaacattgtggtgaagaacaacccccacctctgctacagcaacgga
ggccactggaatggcctgttcagactggacaaacagtttgcaagggtggacaacaacgcc
aacatcagcacatgtgcccagctgaacagtacctgtgatgacatgtgcactaaggagggc
tgctgggggcccggtccaaccatgtgcttaacctgcctgtactacgcccgtaggggccgc
tgtgtgggggcctgtcacgtactggaggggacaccaagagagtatgtgttgaacaacata
tgcctagagtgtgaccaagaatgtatggtgaagaacagaaccggaagctgctttggatct
ggccctgacaagtgtgtggagtgcgcccacgtcaaagatggcccccactgtgtctatcgg
tgcccacgcggcgttctcggggacgtggacaggcccatctggaaatacgctgacaagaac
agagaatgtcagctctgccatgagaactgcaccgacggatgctctggacctggactgaat
ggctgcaatgccagaggtggttctgtcccatcggcagtggctgccagtgtggtgggaggc
ctcctggtgtttgtggtcctggccttgggtgtgttcgtgctagtccgcagacgtcacatc
gtcaggaagaggacgctgcgccgcctgctgcaggaaagagagttggttgaacccctgacc
ccaagtggagaggcacccaaccaggccctgctccgcattctgaaggagaccgagtttaag
aagatcaaagtgttgggatcaggggcctttgggactgtctttaagggcgtgtggattcct
gagggagaaaacgtgaagatccctgttgccattaaggtgttgagagaggccacatctccc
aaagccaacaaggagattctagacgaggcctatgtgatggccagtgtggagcacccccac
gtatgtcgtcttctgggcatctgcctgacgtccacggtgcagctcatcacccagatcatg
ccctacggctgtctgctggactatgtcaaggagaacaaggacctcattggctcccagtgc
ctactcaactggtgtgtacagatcgcaaagggtatgaactacctggaggagcgtcacctg
gtgcaccgtgacctggcggccaggaacgttctggtgaagacgcctcaccatttgaagatc
acggactttggactggccaagctgctcaccgccgacgagaaggagtaccacgctgatggg
ggaaaggtgcccataaagtggatggcactggagtccatccttcactggacctatacccat
cagagtgatgtgtggagctacggtgtgacattgtgggagctgatgacatttgggtcgaag
ccctacgatggcataccggccagggagatctctggagtcctggagaaaggagagcgccta
cctcagccccccatctgtaccatagacgtctacatgatcatggtcaaatgctggatgatc
gatgcagacagcagaccacggttcagggagctcatctctgagttctccaaaatggcccgg
gatccatctcgctatctggtcattcagggagatgattgcatgtacctgcccagtcccacg
gactctaagttctaccgtagcctgatcagtacatcagaggacatggaggatgtggtcgat
gccgaggagtatcttctccccgacaagaccacccagcaccacaactcagggaatggccat
ctgatgagagagaacagtgtgatccttcgctacatcacagaccctacccacggtggttct
ctagagaaagacctcacagaccccacccacagaggttctctaaagaaagacatcacagac
cccacccacggtggttctctagagcaagatctcgctgctcttccagaatacatgaaccag
aacaccaagctctctgatgtcttcaaccccaactatgaggaccccagcgtgccagcctgg
gcaactcggacctcctctgggtacgacccggacaacaagttcttcaactccctgccacgt
gtgccggagggacccgagtatctgaacatggcccgcagtaccctccctcgctctgtatgc
gagagcaacccagactaccaggaggacttcctacctcaggccacacccaccagtagtcac
ttcctgcccgcagcagagaacctggagtacctcggattgagcgctgctgtacacacccct
gtacgctag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112226767
Entry
112226767         CDS       T05605                                 

Definition
(RefSeq) epidermal growth factor receptor-like
  KO
K04361  epidermal growth factor receptor [EC:2.7.10.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04012  ErbB signaling pathway
otw04020  Calcium signaling pathway
otw04068  FoxO signaling pathway
otw04144  Endocytosis
otw04510  Focal adhesion
otw04520  Adherens junction
otw04540  Gap junction
otw04810  Regulation of actin cytoskeleton
otw04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112226767
   04012 ErbB signaling pathway
    112226767
   04068 FoxO signaling pathway
    112226767
   04020 Calcium signaling pathway
    112226767
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112226767
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112226767
   04520 Adherens junction
    112226767
   04540 Gap junction
    112226767
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112226767
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    112226767
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112226767
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112226767
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     112226767
Protein kinases [BR:otw01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   112226767
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   112226767
  Exosomal proteins of pancreatic cancer cells
   112226767
  Exosomal proteins of bladder cancer cells
   112226767
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like PTE Kdo APH Kinase-like LapA_dom
Other DBs
NCBI-GeneID: 112226767
NCBI-ProteinID: XP_024247072
LinkDB
Position
28
AA seq 1246 aa
MKTSLKNTMATQFQIWIVFTSLVSLVSCALPEKKVCQGITNRFSLLGSKEGHYLNMVKTY
SNCTIVLENLEVTHMEDHHDLSFLRSIQEVGGYVLIALNTANRIPLDNLRIIRGHTLYND
GFALAVLMNHNKSMGAGTTELPLTSLTEILKGGVKFSGNQLCNVETIQWLDIVDIDSKPN
MQLPEPNRNRLCKNCDPGCFNGSCWAPGPEHCQTLTKLNCAQQCSKRCKGPSPIDCCNEH
CAAGCTGPRPTDCLACRDFQDDGTCKDSCPRLLLYDRNLHQLVNNPDGKYNFGATCVKTC
PHNYVVTDHGACVRTCSGDTYEVDEGGVRKCKKCDGLCPKVCNGLGMGKLDKILSINATN
IDTFKNCTKINGNIAIIYTSIHGDPFTKAPKMDPAKLDVFKTVREITGYLLIQNWPENMT
SLSPFENLEIIRGRTKHGTVSLAITQLTITHLGLRSLKEISDGDVVITRNSNLCYTKKRH
WKQLFKSDRQTIQLESNAHAAACGLQNNTCDTMCTRYGCWGPGPTMCFACQDYSRTGSCV
DSCNLLEGEPRETEVNKTCVECHPECQLLNGTQTCTGPGQEQCTQCANFKDGNNCVLGCP
RGVPGVAGGKNTFIWKYADKMKVCQLCHQNCTQGCTGPGLRGCQSIGNSGLSVIAAGVVG
GLLAFLIMGLSVFVLLRRRHIKRKRTLRRLLQERELVEPLTPSGEAPNQALLRILKETEF
KKIKVLGSGAFGTVYKGLWVPEGEDVKIPVAIKVLREATSPKANREILDEAYVMASVDNP
HVCRLLGICLTSTVQLVTQLMPYGCLLDYVKENKDNIGSQYLLNWCVQIAKGMSYLEERH
LVHRDLAARNVLVKTPQHVKITDFGLAKLLNADEKEYHADGGKVPIKWMALESILHRKYT
HQSDVWSYGVTAWELMTFGTKPYDGIPANEIAGVLEKGERLPQPPICTIDVYMIMVKCWM
IDADSRPRFRELIAEFSKMARDPPRYLVIQGDDRMHLPSPTDTKFYQSLISGEDMEEAVD
ADEYLVPQHSFFSSPSTSRTQLLHSMSQNSTLNSSIGLCQSRNENGFPVREGSMVLRYIA
DPTDRFLDHAFQPAPDYMNQNGVSDMMNPVYQHPGPPRTLLPTISSDDTETEYLNCYKNE
AVGPEYLNTLQPSLLSPTTSNGISPITSSGLTTTANSLFPMFNGLSSPSSNGLSPTSNGG
LHCVQKYQPPNSIDNPDYQQDFTPSVKTHANGHIPAAENTEYLGPN
NT seq 3741 nt   +upstreamnt  +downstreamnt
atgaagacgagtttaaaaaataccatggctacacagtttcaaatctggatcgttttcacc
tctttagtctccttggtctcgtgtgctttaccggaaaagaaagtatgccagggcatcact
aaccggttcagccttctggggtcaaaagagggccactacttgaacatggtcaagacctac
agcaattgtaccattgtcctggagaacctggaggtcacacacatggaagaccaccatgat
ctgtctttcctcaggtccattcaggaggtgggtggctatgttctgatcgccctcaacaca
gccaacaggattcccctggacaacctgcgcatcatccgaggccacactctctacaacgat
ggctttgccctggctgtgttgatgaaccataataagtcaatgggagcaggcaccaccgag
ctgcctctgaccagcctcacagagatcctgaaaggaggagtgaagttctcaggcaaccag
ctgtgtaacgtggagaccatccagtggttggacatcgtggacattgacagcaaacccaac
atgcagttacctgaacccaacagaaatcgtctctgtaaaaattgtgatcctggatgcttc
aatggttcatgttgggcgcccggcccagaacactgccagacattgacgaagctgaactgt
gcccagcagtgctctaagaggtgtaagggtccgtctcccatcgactgctgcaacgaacac
tgtgctgcaggctgcactggacccagacctacagactgtctggcctgccgggactttcag
gatgatgggacgtgtaaagactcgtgtccgcgcctcctgctctacgaccgcaaccttcac
caactagtcaacaatccagacgggaagtacaacttcggggccacctgcgtcaagacctgc
cctcataattatgtggtgacagaccatggagcgtgcgttcggacatgcagtggtgacacg
tacgaagtggacgagggaggagtcaggaagtgcaagaagtgtgatggactgtgccccaaa
gtttgcaatggacttggaatggggaaacttgacaaaattctgtcaatcaacgccaccaac
attgacacattcaaaaactgcaccaaaatcaatgggaacattgctattatctacacgtct
attcatggggacccatttaccaaagcaccaaagatggatcctgccaagctagacgttttc
aagacggtcagagaaatcactggctatctgctgattcagaactggcccgagaacatgaca
tccctaagtccctttgaaaacctggagattattagaggacggaccaaacatggtacagtg
agcttggccataacccagctaaccatcacccacctgggccttcgctcgctgaaggagatc
agcgatggagatgtggtcatcaccaggaactccaacctctgctacaccaagaagcgccac
tggaagcagctgttcaagtccgacaggcagaccatacagctggagagcaatgcccacgca
gccgcatgcgggctgcagaacaacacatgtgacacaatgtgtaccagatatggctgctgg
ggacctggacccaccatgtgtttcgcctgtcaggactacagccgaacaggaagctgtgta
gactcctgtaacctgctagagggggagccacgtgagactgaagtgaataagacgtgtgtg
gaatgtcatcctgagtgccagctcctcaatggaacccagacctgcactggaccaggccaa
gagcagtgtacccagtgcgctaacttcaaagacggcaacaactgtgtcctagggtgccct
agaggggtgccaggggtggcagggggcaagaacaccttcatctggaagtatgcagataag
atgaaggtgtgccagctgtgccaccagaactgtacccagggatgcaccggtcctggactg
agaggctgtcagtctataggtaactctggcctatcggtgatcgcggctggtgtggtgggt
gggctgcttgccttcctcatcatgggcctgtctgtctttgtgttactgaggcgacgccac
atcaagaggaagagaaccctgcgaagactactccaggagagagagttagttgaaccgttg
acccccagtggtgaggcccccaaccaggctctgctccgcattctcaaagagaccgagttt
aagaagatcaaagtgttgggatcaggggccttcggcactgtctacaagggtctgtgggtc
cctgaaggagaggacgtgaagattcctgtggccattaaggttttaagagaggccacatca
cctaaagccaacagggagatcttggacgaggcctatgtgatggccagcgtggacaacccc
catgtgtgtcgtctgctgggcatctgcctgacctccacagtgcagctggtcacccagctc
atgccctacggctgtctgctggactacgtcaaggagaacaaggacaacatcggatcccag
tacctcctcaactggtgtgtgcagatcgccaaggggatgagctacctggaggagcgtcac
ctggtgcaccgtgacctggcagcgaggaacgtcctggtgaagacccctcagcacgtcaag
atcacggactttggcctggccaaactcctcaacgctgacgagaaggagtaccacgcagac
ggaggaaaggtaccaatcaaatggatggcactggagtccatcctccacaggaaatacaca
catcagagtgatgtttggagctatggtgtgaccgcgtgggagctgatgacgtttgggacc
aagccctatgacggcatcccggccaatgagatagcaggggtgctggagaaaggggagcgg
ctgccccagccccccatctgtaccatagacgtctacatgatcatggtcaaatgctggatg
atcgacgcagacagcaggcctcgtttccgggagctgatagctgagttttccaagatggcg
cgggatcccccacgttaccttgtcatccagggtgatgaccgaatgcacctcccaagtccc
acagacaccaagttctaccagagcctaatcagtggagaggacatggaggaagctgtggac
gcagatgagtacctggtacctcagcacagcttcttctccagccccagtacctcccgtacc
cagctcctacactctatgagccaaaacagcacattgaacagcagcattggattgtgccaa
agcagaaatgagaatgggttccctgtcagagaaggaagcatggttctccggtacattgct
gaccccacagacaggttcttggaccacgccttccagccagctccagactacatgaaccag
aatggtgtgtcggacatgatgaaccctgtataccagcaccccggtccccctcgcaccctc
ctccccaccatctcctcagacgacacagagacagagtacctgaactgctataagaacgag
gcagtggggcctgagtatctcaacaccctccagccctctctcctctcccccaccacctcc
aatggcatctcccccatcacctctagtggcctcaccaccaccgccaacagccttttcccc
atgttcaatgggctctcctccccgagctccaatggcctctcccccacttccaatggcggt
ctccactgcgtccagaaataccaacccccgaacagtatagataacccagactaccagcag
gacttcaccccttccgtcaagacccatgccaatggacacatcccggccgcagagaacaca
gagtacctaggcccaaactga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112227760
Entry
112227760         CDS       T05605                                 

Definition
(RefSeq) melanoma receptor tyrosine-protein kinase-like
  KO
K04361  epidermal growth factor receptor [EC:2.7.10.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04012  ErbB signaling pathway
otw04020  Calcium signaling pathway
otw04068  FoxO signaling pathway
otw04144  Endocytosis
otw04510  Focal adhesion
otw04520  Adherens junction
otw04540  Gap junction
otw04810  Regulation of actin cytoskeleton
otw04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112227760
   04012 ErbB signaling pathway
    112227760
   04068 FoxO signaling pathway
    112227760
   04020 Calcium signaling pathway
    112227760
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112227760
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112227760
   04520 Adherens junction
    112227760
   04540 Gap junction
    112227760
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112227760
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    112227760
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112227760
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112227760
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     112227760
Protein kinases [BR:otw01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   112227760
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   112227760
  Exosomal proteins of pancreatic cancer cells
   112227760
  Exosomal proteins of bladder cancer cells
   112227760
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like Kinase-like
Other DBs
NCBI-GeneID: 112227760
NCBI-ProteinID: XP_024248375
LinkDB
Position
29
AA seq 1195 aa
MRPETGIVIAALFCMGCCVTLTAHKKVCQGISNRLTLLATVDDHYNNLVKMYSNCTVVLE
NLELTYIQDYHDLSFLKSIQEVGGYVLIALNKAASIPLENLRLIRGHSLFLDKYALTVTS
NYEKNHSSVTLNYTRGLRELKLSGLTEILKGGVKIAHNPLLCNVETIQWWDMVNKAINHS
MHFKLESYGRYCDKCDPGCYNGSCWTSGLENCQTFTKLTCAEQCSGRCRGPKPSDCCNEH
CAAGCTGPRPTECLACRDFQDDGTCKDACPPTMLYNPNTHQLASNPNAKYTFGATCVKDC
PHNYVVTDHGACVRTCSGNTHEVEENGVRRCKKCDGICPKVCDGLGMGLLTKVLSINASN
IDSFKNCTKINGAVSIMQTSLDGDRYTSTPKMDPAKLEYFKTVKEISGFLLIQAWPEHLN
SLSPFENLEIIRGRTKQFGQVSFAALNLAHLKYLGLRSLREISDGNVVVKNNPQLCYTNG
DHWKSLFRLGKQSSTVGNNVNISTCAKLNSTCDEMCTDEGCWGPGPTMCFTCLYYTRRGR
CVRACHLQEGVPREYVLNNRCLECDPECMVNGPRSCFGPGPDKCLACAHVKDGPHCVYQC
PHGVLGDGDRHIWKYTDKKRECQLCHENCTQGCSGPGLSGCSTRGGHVLSVVVARVVGGL
LVFVVLALGVFVLLRRRHLVRKRTLRRLLQERELVEPLTPSGEAPNQALLRILKETEFKK
IKVLGSGAFGTVFKGMWIPEGENVKIPVAIKVLREATSPKANKEILDEAYVMASVEHPHV
CRLLGICLTSTVQLITQIMPYGCLLDYVKENKDNIGSQCLLNWCVQIAKGMNYLEEHHLV
HRDLAARNVLVKTPHHLKITDFGLAKLLTSDEKEYHADGGKVPIKWMALESILHWTYTHQ
SDVWSYGVTVWELMTFGSKPYDGIPAIEIAGVLEKGERLPQPPICTIDVYMIMVKCWMID
AESRPRFRELISEFSKMARDPSRYLVIQGDDRMYLPSPTEPMFYRSLISTSENMEDAEEY
LHPYKDLSTRQTTQHHNSRNGHPMRENSVILRYITDPTHGGSLEKDITDPTHGGSLEKDF
PALPEYLNQNGNTRLSDVFNPSYEDPTEPAWASRPSSGYDPDVKFFNFLPCVLEIPEYHN
MARSTLPRSVCERMDNPDYQEDFLPQATPTRSHFLPAVENLEYLGLSAAVHAPVR
NT seq 3588 nt   +upstreamnt  +downstreamnt
atgcgacctgaaactggaatagttattgctgccttgttctgcatgggctgctgcgtgaca
ctgacagcgcacaagaaagtgtgtcaggggatcagcaacaggctgacgctgctggcgact
gtagacgaccactacaacaaccttgtgaagatgtacagcaactgtaccgtggtcctggag
aacctagagctcacctacatccaggactaccacgacctctccttcctcaagtccattcag
gaggttggaggatacgttctgatcgccctcaataaggcagccagcatccctctcgagaac
ctgcgtcttatccgaggacactccctcttccttgacaagtatgccctgactgtaacatcc
aattacgagaagaatcactcctctgtgaccctcaactacacccggggcctgagggagctg
aagctgagtggactgacagagattctcaagggaggtgtgaaaattgcccacaatcctttg
ctgtgtaatgtggaaaccatccagtggtgggacatggtaaataaggccataaaccatagt
atgcacttcaaactggagagctatggccgttactgtgacaagtgtgacccgggatgctac
aatggatcatgctggacctcaggactggagaactgtcaaacctttaccaagctgacgtgt
gcagagcagtgctctggaaggtgtaggggtcctaaacccagtgactgctgtaacgaacac
tgtgctgcaggctgcaccggccctaggcctacagagtgtctggcttgtagagacttccag
gatgatggcacatgtaaggatgcctgtccccctaccatgctctacaatcccaacacccac
cagttggcttccaaccctaacgccaagtacacgttcggggccacttgtgtgaaggactgc
ccacataattatgtggtgacggaccacggggcgtgtgtcagaacgtgcagcggcaacaca
cacgaggtggaggagaatggtgtcaggaggtgcaagaagtgtgacggaatctgtccgaaa
gtttgcgatggacttggaatggggctgcttactaaagtgttgtcaatcaatgcgtctaac
attgattctttcaaaaactgcaccaaaatcaatggagctgtttcaattatgcagacatct
ttggatggtgataggtacacatcaacaccaaaaatggaccccgccaaactggaatatttc
aagactgtgaaggaaatttcagggtttttgctgatacaagcttggcccgagcacctcaac
tctctcagtccatttgaaaacctagagattatcagaggaaggaccaaacagtttggtcag
gtgagtttcgctgccctcaacttggcccatctgaagtatctaggcctccgctccctgcga
gagatcagcgatggcaatgttgtggtgaagaacaacccccagctctgctacaccaacgga
gaccactggaagagcctgtttagattgggcaaacagtcctcaacagtgggcaacaacgtc
aacatcagcacctgtgccaagctaaacagtacctgtgatgagatgtgcactgacgagggt
tgctgggggcccggccccaccatgtgttttacatgcctgtattacacccgtagggggcgc
tgtgtacgggcctgtcacctacaggagggggtgccacgagagtatgtactgaataacagg
tgtctagaatgtgacccagagtgtatggtgaatggaccacgaagctgctttggaccaggc
cctgacaaatgtttggcgtgcgctcacgtcaaagatggccctcactgtgtatatcagtgc
ccacacggcgttctcggggacggggataggcacatctggaaatacactgacaagaagcga
gaatgtcagctctgccatgagaactgcacccagggatgctctggacctggactgagtggc
tgcagcaccagaggtggtcacgttttgtcggtggtggtggccagagtggtgggaggcctc
ctagtgtttgtggtcctcgccctgggtgtttttgtgctgctccgcagacgccacctcgtc
aggaagaggacactgcgccgtctgctgcaggagagagagttggttgaacccctgacccca
agtggagaggcacccaaccaggccctgctccgcattctgaaggaaactgagtttaagaag
atcaaagtgttgggatcaggggcctttggaactgtctttaagggcatgtggattcctgag
ggagaaaacgtgaagatccctgttgccattaaggtgttgagagaggccacttcaccaaaa
gccaacaaggagattctagacgaggcctatgtgatggctagcgtggagcacccccatgtg
tgtcgtctactgggcatctgcctgacatccacggtgcagctcatcacccagatcatgccc
tacggctgtctgctggactatgtcaaggagaacaaggacaacattggctcccagtgcctg
cttaactggtgtgtgcaaatcgccaagggtatgaactacctggaggagcatcacctggtg
caccgtgacctggcggccaggaacgttctggtgaagacgcctcaccacctcaagatcacc
gattttggactggccaagctgctcacctcagacgagaaggagtaccacgcagatgggggc
aaggtgcccataaagtggatggcactggagtccatccttcactggacctatacacatcag
agcgatgtgtggagctacggtgtgacagtgtgggagctgatgacgtttgggtccaagccc
tatgatggcatcccggccattgagatagctggagtcctggagaaaggagagcgcctgccc
cagccccccatctgtaccatagacgtctacatgatcatggtcaaatgctggatgatcgat
gcagagagcagaccacggttcagggagctcatctcagagttctccaaaatggcccgggat
ccatctcgctatctggtcattcagggggatgatcgcatgtacctgcccagtcccacggaa
cctatgttctaccgtagcctgatcagtacatcagagaacatggaggatgctgaggagtat
cttcacccctataaggatctctccaccagacagaccacccagcaccacaactctaggaat
ggccatccaatgagagagaacagtgtgatccttcgctacatcacagatcccacccacggt
ggttctctagagaaggacatcacagaccccacccatggtggttctctagagaaagatttc
ccagctcttccagaataccttaaccagaacgggaacaccaggctctctgacgtcttcaac
cccagctatgaggaccccactgagccagcctgggctagtaggccctcctctgggtacgac
ccagacgtcaagttcttcaacttcctgccgtgcgtgctggagatccctgagtaccacaac
atggcccgcagtaccctccctcgctccgtctgcgagcgcatggacaacccagactaccag
gaggacttcctgcctcaggccacacccaccagaagtcacttcctgcctgcagtagagaac
ctggagtacctcgggttgagcgctgctgtacatgcccctgtacgctag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112232691
Entry
112232691         CDS       T05605                                 

Definition
(RefSeq) melanoma receptor tyrosine-protein kinase-like isoform X1
  KO
K04361  epidermal growth factor receptor [EC:2.7.10.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04012  ErbB signaling pathway
otw04020  Calcium signaling pathway
otw04068  FoxO signaling pathway
otw04144  Endocytosis
otw04510  Focal adhesion
otw04520  Adherens junction
otw04540  Gap junction
otw04810  Regulation of actin cytoskeleton
otw04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112232691
   04012 ErbB signaling pathway
    112232691
   04068 FoxO signaling pathway
    112232691
   04020 Calcium signaling pathway
    112232691
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112232691
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112232691
   04520 Adherens junction
    112232691
   04540 Gap junction
    112232691
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112232691
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    112232691
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112232691
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112232691
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     112232691
Protein kinases [BR:otw01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   112232691
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   112232691
  Exosomal proteins of pancreatic cancer cells
   112232691
  Exosomal proteins of bladder cancer cells
   112232691
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like APH
Other DBs
NCBI-GeneID: 112232691
NCBI-ProteinID: XP_024255644
LinkDB
Position
Unknown
AA seq 1202 aa
MRPGSGIVIAALFSLGCSMTLTADKKVCQGISNRLTLLGTVDDHYNNLVRMYSNCTVVLE
NLELTYIQEYHDLSFLKSIQEVGGYVLIAVNKAAIIPLENLRLIRGHSLYDNKYALAVMS
NYEKNHSSVTLNYTRGLRELMLRGLTDILKGGVKIAHNPLLCNVETIQWWDMVNKAGNPS
MDFKLESYGRYCGKCDPGCYNGSCWTPGPENCQTFTKLKCAEQCSGRCRGPKPSDCCNEH
CAAGCTGPRPTECLACRDFQDDGTCKDACPPTMIYNPNTHQLASNPNAKYTFGATCVKTC
PHNYVVTDHGACVRTCSGNTHEVEENGVRRCKKCDGICPKVCNGLGMGPLTAVLSINASN
IDSFKNCTKINGDVSIIGTSLNGDRYTSTPKMDPAKLDYFRTVKEISGFLLIQAWPKHLD
SLSAFENLEIIRGRTKQFGQVSFAALNVAHLKYLGLRSLREISDGNIVVKNNPHLCYSNG
GHWNGLFRLDKQFARVDNNANISTCAQLNSTCDDMCTKEGCWGPGPTMCLTCLYYARRGR
CVGACHVLEGTPREYVLNNICLECDQECMVKNRTGSCFGSGPDKCVECAHVKDGPHCVYR
CPRGVLGDVDRPIWKYADKNRECQLCHENCTDGCSGPGLNGCNARGGSVPSAVAASVVGG
LLVFVVLALGVFVLVRRRHIVRKRTLRRLLQERELVEPLTPSGEAPNQALLRILKETEFK
KIKVLGSGAFGTVFKGVWIPEGENVKIPVAIKVLREATSPKANKEILDEAYVMASVEHPH
VCRLLGICLTSTVQLITQIMPYGCLLDYVKENKDLIGSQCLLNWCVQIAKGMNYLEERHL
VHRDLAARNVLVKTPHHLKITDFGLAKLLTADEKEYHADGGKVPIKWMALESILHWTYTH
QSDVWSYGVTLWELMTFGSKPYDGIPAREISGVLEKGERLPQPPICTIDVYMIMVKCWMI
DADSRPRFRELISEFSKMARDPSRYLVIQGDDCMYLPSPTDSKFYRSLISTSEDMEDVVD
AEEYLLPDKTTQHHNSGNGHLMRENSVILRYITDPTHGGSLEKDLTDPTHRGSLKKDITD
PTHGGSLEQDLAALPEYMNQNTKLSDVFNPNYEDPSVPAWATRTSSGYDPDNKFFNSLPR
VPEGPEYLNMARSTLPRSVCESNPDYQEDFLPQATPTSSHFLPAAENLEYLGLSAAVHTP
VR
NT seq 3609 nt   +upstreamnt  +downstreamnt
atgcgacctggaagtggaatagttattgctgccttgttcagcctgggctgcagcatgaca
ctgacagcggacaagaaagtgtgtcaggggatcagcaacaggctgacgctgctggggact
gtagacgaccattacaacaacctggtgaggatgtacagcaactgtaccgtggtcctggag
aacctagagcttacctacatccaggagtaccacgacctctccttcctcaagtccattcag
gaggttggaggctatgttctgatcgccgtcaacaaggcagccatcatcccactggagaac
ctgcgtctgatccgaggacactccctctacgacaacaagtatgccctggctgtcatgtcc
aactacgagaagaaccactcctctgtgacccttaactacacacggggcctaagggagctg
atgctgagaggactgacagacattctcaagggaggggtgaaaattgcccacaatcctttg
ttgtgtaatgtggagaccatccaatggtgggacatggtaaacaaggccggcaaccccagt
atggatttcaaactggagagctatggccgttactgtggcaagtgtgaccctggatgctac
aatggatcatgctggacaccaggaccagagaactgtcaaacatttaccaagctgaagtgt
gcagagcagtgctctggaaggtgtaggggtcctaaacctagtgactgctgtaacgaacac
tgtgctgcagggtgcaccggccctaggcctacagagtgtctggcctgcagagacttccag
gatgatggcacatgtaaggatgcctgccctcctaccatgatctacaatcccaacacccac
cagctggcttccaaccctaacgccaagtacacgttcggggccacttgtgtgaagacctgc
ccacataactatgtggtgacggaccacggggcgtgtgtccgaacatgcagtggcaacaca
cacgaggtggaggagaatggtgtcaggaggtgcaagaagtgtgacggaatctgtccaaaa
gtgtgcaatggacttggaatggggccgcttactgccgtcttgtcaatcaacgcctctaac
attgattctttcaaaaactgcaccaaaatcaatggcgatgtttcaataattggaacctct
ttgaatggtgataggtacacatcaacaccaaaaatggaccctgccaaactggattatttc
agaactgtgaaggaaatttcagggtttctgctcatacaagcttggccaaagcacctcgat
tctctcagtgcatttgaaaacctggagattatcaggggaaggaccaaacagtttggtcag
gtgagttttgctgccctgaacgtggcccatctgaagtatctaggcctccgctccctacga
gagatcagcgatggcaacattgtggtgaagaacaacccccacctctgctacagcaacgga
ggccactggaatggcctgttcagactggacaaacagtttgcaagggtggacaacaacgcc
aacatcagcacatgtgcccagctgaacagtacctgtgatgacatgtgcactaaggagggc
tgctgggggcccggtccaaccatgtgcttaacctgcctgtactacgcccgtaggggccgc
tgtgtgggggcctgtcacgtactggaggggacaccaagagagtatgtgttgaacaacata
tgcctagagtgtgaccaagaatgtatggtgaagaacagaaccggaagctgctttggatct
ggccctgacaagtgtgtggagtgcgcccacgtcaaagatggcccccactgtgtctatcgg
tgcccacgcggcgttctcggggacgtggacaggcccatctggaaatacgctgacaagaac
agagaatgtcagctctgccatgagaactgcaccgacggatgctctggacctggactgaat
ggctgcaatgccagaggtggttctgtcccatcggcagtggctgccagtgtggtgggaggc
ctcctggtgtttgtggtcctggccttgggtgtgttcgtgctagtccgcagacgtcacatc
gtcaggaagaggacgctgcgccgcctgctgcaggaaagagagttggttgaacccctgacc
ccaagtggagaggcacccaaccaggccctgctccgcattctgaaggagaccgagtttaag
aagatcaaagtgttgggatcaggggcctttgggactgtctttaagggcgtgtggattcct
gagggagaaaacgtgaagatccctgttgccattaaggtgttgagagaggccacatctccc
aaagccaacaaggagattctagacgaggcctatgtgatggccagtgtggagcacccccac
gtatgtcgtcttctgggcatctgcctgacgtccacggtgcagctcatcacccagatcatg
ccctacggctgtctgctggactatgtcaaggagaacaaggacctcattggctcccagtgc
ctactcaactggtgtgtacagatcgcaaagggtatgaactacctggaggagcgtcacctg
gtgcaccgtgacctggcggccaggaacgttctggtgaagacgcctcaccatttgaagatc
acggactttggactggccaagctgctcaccgccgacgagaaggagtaccacgctgatggg
ggaaaggtgcccataaagtggatggcactggagtccatccttcactggacctatacccat
cagagtgatgtgtggagctacggtgtgacattgtgggagctgatgacatttgggtcgaag
ccctacgatggcataccggccagggagatctctggagtcctggagaaaggagagcgccta
cctcagccccccatctgtaccatagacgtctacatgatcatggtcaaatgctggatgatc
gatgcagacagcagaccacggttcagggagctcatctctgagttctccaaaatggcccgg
gatccatctcgctatctggtcattcagggagatgattgcatgtacctgcccagtcccacg
gactctaagttctaccgtagcctgatcagtacatcagaggacatggaggatgtggtcgat
gccgaggagtatcttctccccgacaagaccacccagcaccacaactcagggaatggccat
ctgatgagagagaacagtgtgatccttcgctacatcacagaccctacccacggtggttct
ctagagaaagacctcacagaccccacccacagaggttctctaaagaaagacatcacagac
cccacccacggtggttctctagagcaagatctcgctgctcttccagaatacatgaaccag
aacaccaagctctctgatgtcttcaaccccaactatgaggaccccagcgtgccagcctgg
gcaactcggacctcctctgggtacgacccggacaacaagttcttcaactccctgccacgt
gtgccggagggacccgagtatctgaacatggcccgcagtaccctccctcgctctgtatgc
gagagcaacccagactaccaggaggacttcctacctcaggccacacccaccagtagtcac
ttcctgcccgcagcagagaacctggagtacctcggattgagcgctgctgtacacacccct
gtacgctag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112233568
Entry
112233568         CDS       T05605                                 

Definition
(RefSeq) melanoma receptor tyrosine-protein kinase-like
  KO
K04361  epidermal growth factor receptor [EC:2.7.10.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04012  ErbB signaling pathway
otw04020  Calcium signaling pathway
otw04068  FoxO signaling pathway
otw04144  Endocytosis
otw04510  Focal adhesion
otw04520  Adherens junction
otw04540  Gap junction
otw04810  Regulation of actin cytoskeleton
otw04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112233568
   04012 ErbB signaling pathway
    112233568
   04068 FoxO signaling pathway
    112233568
   04020 Calcium signaling pathway
    112233568
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112233568
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112233568
   04520 Adherens junction
    112233568
   04540 Gap junction
    112233568
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112233568
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    112233568
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112233568
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112233568
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     112233568
Protein kinases [BR:otw01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   112233568
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   112233568
  Exosomal proteins of pancreatic cancer cells
   112233568
  Exosomal proteins of bladder cancer cells
   112233568
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like Kinase-like
Other DBs
NCBI-GeneID: 112233568
NCBI-ProteinID: XP_024257072
LinkDB
Position
Unknown
AA seq 1195 aa
MRPETGIVIAALFCMGCCVTLTAHKKVCQGISNRLTLLATVDDHYNNLVKMYSNCTVVLE
NLELTYIQDYHDLSFLKSIQEVGGYVLIALNKAASIPLENLRLIRGHSLFLDKYALTVTS
NYEKNHSSVTLNYTRGLRELKLSGLTEILKGGVKIAHNPLLCNVETIQWWDMVNKAINHS
MHFKLESYGRYCDKCDPGCYNGSCWTSGLENCQTFTKLTCAEQCSGRCRGPKPSDCCNEH
CAAGCTGPRPTECLACRDFQDDGTCKDACPPTMLYNPNTHQLASNPNAKYTFGATCVKDC
PHNYVVTDHGACVRTCSGNTHEVEENGVRRCKKCDGICPKVCDGLGMGLLTKVLSINASN
IDSFKNCTKINGAVSIMQTSLDGDRYTSTPKMDPAKLEYFKTVKEISGFLLIQAWPEHLN
SLSPFENLEIIRGRTKQFGQVSFAALNLAHLKYLGLRSLREISDGNVVVKNNPQLCYTNG
DHWKSLFRLGKQSSTVGNNVNISTCAKLNSTCDEMCTDEGCWGPGPTMCFTCLYYTRRGR
CVRACHLQEGVPREYVLNNRCLECDPECMVNGPRSCFGPGPDKCLACAHVKDGPHCVYQC
PHGVLGDGDRHIWKYTDKKRECQLCHENCTQGCSGPGLSGCSTRGGHVLSVVVARVVGGL
LVFVVLALGVFVLLRRRHLVRKRTLRRLLQERELVEPLTPSGEAPNQALLRILKETEFKK
IKVLGSGAFGTVFKGMWIPEGENVKIPVAIKVLREATSPKANKEILDEAYVMASVEHPHV
CRLLGICLTSTVQLITQIMPYGCLLDYVKENKDNIGSQCLLNWCVQIAKGMNYLEEHHLV
HRDLAARNVLVKTPHHLKITDFGLAKLLTSDEKEYHADGGKVPIKWMALESILHWTYTHQ
SDVWSYGVTVWELMTFGSKPYDGIPAIEIAGVLEKGERLPQPPICTIDVYMIMVKCWMID
AESRPRFRELISEFSKMARDPSRYLVIQGDDRMYLPSPTEPMFYRSLISTSENMEDAEEY
LHPYKDLSTRQTTQHHNSRNGHPMRENSVILRYITDPTHGGSLEKDITDPTHGGSLEKDF
PALPEYLNQNGNTRLSDVFNPSYEDPTEPAWASRPSSGYDPDVKFFNFLPCVLEIPEYHN
MARSTLPRSVCERMDNPDYQEDFLPQATPTRSHFLPAVENLEYLGLSAAVHAPVR
NT seq 3588 nt   +upstreamnt  +downstreamnt
atgcgacctgaaactggaatagttattgctgccttgttctgcatgggctgctgcgtgaca
ctgacagcgcacaagaaagtgtgtcaggggatcagcaacaggctgacgctgctggcgact
gtagacgaccactacaacaaccttgtgaagatgtacagcaactgtaccgtggtcctggag
aacctagagctcacctacatccaggactaccacgacctctccttcctcaagtccattcag
gaggttggaggatacgttctgatcgccctcaataaggcagccagcatccctctcgagaac
ctgcgtcttatccgaggacactccctcttccttgacaagtatgccctgactgtaacatcc
aattacgagaagaatcactcctctgtgaccctcaactacacccggggcctgagggagctg
aagctgagtggactgacagagattctcaagggaggtgtgaaaattgcccacaatcctttg
ctgtgtaatgtggaaaccatccagtggtgggacatggtaaataaggccataaaccatagt
atgcacttcaaactggagagctatggccgttactgtgacaagtgtgacccgggatgctac
aatggatcatgctggacctcaggactggagaactgtcaaacctttaccaagctgacgtgt
gcagagcagtgctctggaaggtgtaggggtcctaaacccagtgactgctgtaacgaacac
tgtgctgcaggctgcaccggccctaggcctacagagtgtctggcttgtagagacttccag
gatgatggcacatgtaaggatgcctgtccccctaccatgctctacaatcccaacacccac
cagttggcttccaaccctaacgccaagtacacgttcggggccacttgtgtgaaggactgc
ccacataattatgtggtgacggaccacggggcgtgtgtcagaacgtgcagcggcaacaca
cacgaggtggaggagaatggtgtcaggaggtgcaagaagtgtgacggaatctgtccgaaa
gtttgcgatggacttggaatggggctgcttactaaagtgttgtcaatcaatgcgtctaac
attgattctttcaaaaactgcaccaaaatcaatggagctgtttcaattatgcagacatct
ttggatggtgataggtacacatcaacaccaaaaatggaccccgccaaactggaatatttc
aagactgtgaaggaaatttcagggtttttgctgatacaagcttggcccgagcacctcaac
tctctcagtccatttgaaaacctagagattatcagaggaaggaccaaacagtttggtcag
gtgagtttcgctgccctcaacttggcccatctgaagtatctaggcctccgctccctgcga
gagatcagcgatggcaatgttgtggtgaagaacaacccccagctctgctacaccaacgga
gaccactggaagagcctgtttagattgggcaaacagtcctcaacagtgggcaacaacgtc
aacatcagcacctgtgccaagctaaacagtacctgtgatgagatgtgcactgacgagggt
tgctgggggcccggccccaccatgtgttttacatgcctgtattacacccgtagggggcgc
tgtgtacgggcctgtcacctacaggagggggtgccacgagagtatgtactgaataacagg
tgtctagaatgtgacccagagtgtatggtgaatggaccacgaagctgctttggaccaggc
cctgacaaatgtttggcgtgcgctcacgtcaaagatggccctcactgtgtatatcagtgc
ccacacggcgttctcggggacggggataggcacatctggaaatacactgacaagaagcga
gaatgtcagctctgccatgagaactgcacccagggatgctctggacctggactgagtggc
tgcagcaccagaggtggtcacgttttgtcggtggtggtggccagagtggtgggaggcctc
ctagtgtttgtggtcctcgccctgggtgtttttgtgctgctccgcagacgccacctcgtc
aggaagaggacactgcgccgtctgctgcaggagagagagttggttgaacccctgacccca
agtggagaggcacccaaccaggccctgctccgcattctgaaggaaactgagtttaagaag
atcaaagtgttgggatcaggggcctttggaactgtctttaagggcatgtggattcctgag
ggagaaaacgtgaagatccctgttgccattaaggtgttgagagaggccacttcaccaaaa
gccaacaaggagattctagacgaggcctatgtgatggctagcgtggagcacccccatgtg
tgtcgtctactgggcatctgcctgacatccacggtgcagctcatcacccagatcatgccc
tacggctgtctgctggactatgtcaaggagaacaaggacaacattggctcccagtgcctg
cttaactggtgtgtgcaaatcgccaagggtatgaactacctggaggagcatcacctggtg
caccgtgacctggcggccaggaacgttctggtgaagacgcctcaccacctcaagatcacc
gattttggactggccaagctgctcacctcagacgagaaggagtaccacgcagatgggggc
aaggtgcccataaagtggatggcactggagtccatccttcactggacctatacacatcag
agcgatgtgtggagctacggtgtgacagtgtgggagctgatgacgtttgggtccaagccc
tatgatggcatcccggccattgagatagctggagtcctggagaaaggagagcgcctgccc
cagccccccatctgtaccatagacgtctacatgatcatggtcaaatgctggatgatcgat
gcagagagcagaccacggttcagggagctcatctcagagttctccaaaatggcccgggat
ccatctcgctatctggtcattcagggggatgatcgcatgtacctgcccagtcccacggaa
cctatgttctaccgtagcctgatcagtacatcagagaacatggaggatgctgaggagtat
cttcacccctataaggatctctccaccagacagaccacccagcaccacaactctaggaat
ggccatccaatgagagagaacagtgtgatccttcgctacatcacagatcccacccacggt
ggttctctagagaaggacatcacagaccccacccatggtggttctctagagaaagatttc
ccagctcttccagaataccttaaccagaacgggaacaccaggctctctgacgtcttcaac
cccagctatgaggaccccactgagccagcctgggctagtaggccctcctctgggtacgac
ccagacgtcaagttcttcaacttcctgccgtgcgtgctggagatccctgagtaccacaac
atggcccgcagtaccctccctcgctccgtctgcgagcgcatggacaacccagactaccag
gaggacttcctgcctcaggccacacccaccagaagtcacttcctgcctgcagtagagaac
ctggagtacctcgggttgagcgctgctgtacatgcccctgtacgctag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112260663
Entry
112260663         CDS       T05605                                 

Definition
(RefSeq) epidermal growth factor receptor-like isoform X1
  KO
K04361  epidermal growth factor receptor [EC:2.7.10.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04012  ErbB signaling pathway
otw04020  Calcium signaling pathway
otw04068  FoxO signaling pathway
otw04144  Endocytosis
otw04510  Focal adhesion
otw04520  Adherens junction
otw04540  Gap junction
otw04810  Regulation of actin cytoskeleton
otw04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112260663
   04012 ErbB signaling pathway
    112260663
   04068 FoxO signaling pathway
    112260663
   04020 Calcium signaling pathway
    112260663
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112260663
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112260663
   04520 Adherens junction
    112260663
   04540 Gap junction
    112260663
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112260663
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    112260663
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112260663
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112260663
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     112260663
Protein kinases [BR:otw01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   112260663
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   112260663
  Exosomal proteins of pancreatic cancer cells
   112260663
  Exosomal proteins of bladder cancer cells
   112260663
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like Kdo APH LapA_dom
Other DBs
NCBI-GeneID: 112260663
NCBI-ProteinID: XP_024291711
LinkDB
Position
10
AA seq 1238 aa
MFSYIRWGRMKTSLTNTMATLFQIWIIFTSLVSYALPEKKVCQGVTNRFSLLGSKEDHYL
NMVKTYSNCTVVLENLEVTYMEDDHDLSFLRSIQEVGGYVLIALNTANRIPLDNLRIIRG
HTLYDSGFALAVVLNYNKSMRAGTTELPLTSLTEILKGGVKFSDNQLCNVETIQWLDIVN
SNSKPNMQLPEPSNNRLCKRCDPGCFNGSCWAPGPEHCQTLTKLNCAQQCSKRCKGPSPI
DCCNEHCAAGCTGPRPTDCLACRDFQDDGMCKDSCPRLLLYDRNLHQLVNNPDGKYNFGA
TCVKTCPHNYVVTDHGACVRTCSGDTYEVDEGGVRKCKKCDGLCPKVCNGLGMGKLANIL
SINATNIDTFKNCTKINGNIAIIYTSIHGDTFTKAPKMDPARLEVFKTVREITGYLLIQN
WPENMTSLSPFENLEIIRGRTKRVLLSLAITQLTITHLGLRNLKEISDGDVVIAKNPNLC
YTKNHHWKQLFKSDTQTARLENNADAADCGMQNSTCDRMCTRDGCWGPGPTMCFACQDYS
RAGSCVDSCNLLEGEPRETEVNKTCVECHLECQLLNGTKTCSGPGHEQCTRCANFKDGDN
CVPWCPRGVAGGKNTFIWKYADKMKVCQLCHQNCTEGCTGPGLKGCQSKGNSGLSVIAAG
VVGGMLAFLIMGLSVFVLLRRRHIKKKRTLRRLLQERELVEPLTPSGEAPNQALLRILKE
TEFKKIKVLGSGAFGTVYKGLWVPEGEDVKISVAIKVLREATSPKANKEILDEAYVMAGV
DHPHVCRLLGICLTSTVQLVTQLMPYGCLLDYVKENKDNIGSQYLLNWCVQIAKGMSYLE
EHHLVHRDLAARNVLVKTPQHVKITDFGLAKLLNSDEKEYHADGGKVPIKWMALESILYR
TYTHQSDVWSYGVTAWELMTFGTKPYDGIPASEVAGVLEKGERLPQPPICTIDVYMIMVK
CWMIDADSRPRFRELIAEFSKMARDPPRYLVIQGDDRMHLPSPTDTKFYHSLISGEDMED
AVDADEYLVPQHGFFSSSSTSRTQLLHSTSQNSTLNSSIGMCHSRNGNGFPVREGSMVLR
YIADPTDRFLDHAFQPSPDYINQNGVSDMMNPVYQHPGPPRTLLPTISSDDAEAEYLNCY
KNGAVGPEYLNTLQPSLLSPTTSNGISNGLNPTANGHSPISNGLLSPTSNGLSPISNGGL
HHVQKNQPQNSIDNPDYQQDFTPSIKTHIPAAEYVGPN
NT seq 3717 nt   +upstreamnt  +downstreamnt
atgttttcatacattcggtggggaagaatgaagacgagtttaacaaataccatggctaca
ctgtttcaaatctggatcattttcacctctttggtctcctatgcgttgccggaaaagaaa
gtgtgccagggcgtcactaaccggttcagcctgcttgggtcaaaagaggaccactacctg
aacatggtcaagacctacagcaactgcaccgtggtcctggagaacctggaggtcacatac
atggaggacgaccatgatctgtctttcctcaggtccatccaggaggtgggtggctacgtt
ctgatcgccctcaacacagccaacaggattcccctggacaacctgcgcatcatccgaggc
cacactctctatgacagtggctttgccctggctgtggtgctgaactataacaagtccatg
cgagcaggcaccactgagctgcctctgaccagcctcacagagatcctgaaaggaggagtg
aagttctcagacaaccagctgtgtaacgtggagaccatccagtggttggacattgtaaac
agtaacagcaaacccaacatgcagttacctgaacccagcaacaatcggctctgtaaaaga
tgtgatcctggatgcttcaatggttcctgttgggcgcccggcccagaacactgccagacg
ttgacgaagctgaactgtgcccagcagtgctctaagaggtgtaagggtccgtcccccatc
gactgctgcaacgaacactgtgctgcaggctgcactggacccagacctacagactgtctg
gcctgccgtgactttcaggatgatgggatgtgtaaagactcgtgtccccgcctcctgctc
tacgaccgcaaccttcaccaattggtcaacaacccagacgggaagtacaactttggggcc
acctgcgtcaagacttgtcctcataactatgtggtgacggaccatggagcgtgcgttcgg
acatgcagtggtgacacatacgaggtggacgagggaggggtcaggaagtgcaagaagtgt
gatggactgtgccccaaagtttgcaatggacttggaatgggaaaacttgccaatattctg
tcaattaatgccaccaacattgacacatttaaaaactgtaccaaaatcaatgggaacatt
gctattatctacacatctatccatggggacacgttcaccaaagcacctaagatggatccg
gccaggctagaagttttcaagacagttagagaaattaccgggtacttgctgattcagaac
tggcctgagaacatgacgtccctcagtccatttgagaacctggagatcatccgtggacgg
accaagcgtgttctgttgagcttggccataacccagttaaccatcacccacctggggctg
cgtaacctgaaggagatcagtgacggagacgtggtcattgcaaaaaaccccaacctctgc
tacaccaagaatcaccactggaagcagttgttcaagtccgacactcagaccgcccggctg
gagaacaacgccgacgcagccgactgcgggatgcagaacagcacgtgtgacaggatgtgt
accagagatggctgctggggtcctggacccaccatgtgtttcgcctgtcaggactacagc
cgagcaggaagctgtgtcgactcctgcaacctactggagggggagccacgggagactgaa
gtgaataagacgtgtgtggagtgtcaccttgagtgtcagctcctcaacgggaccaagacc
tgctctggaccaggtcatgagcagtgtacccggtgtgccaacttcaaagatggagacaac
tgtgtcccatggtgccctagaggggtggctgggggcaagaacaccttcatctggaaatac
gcagataagatgaaggtgtgccagctgtgccaccagaactgtaccgagggatgtactggt
cctggtctgaaaggctgtcagtctaaaggtaactctgggctgtcagtgattgcagctggt
gtggtgggcgggatgctggcctttctcatcatgggcctgtccgtcttcgtgttgctaaga
cgacgccacatcaagaagaagaggaccctgcgaagactcctccaggagagagagttagtt
gaaccgctgacccccagtggggaggcgcccaaccaggctctgctccgtatcctgaaggag
acagagtttaagaagatcaaagttttgggatcaggggccttcggcactgtctacaagggt
ctgtgggtccctgaaggagaggatgtgaagatctctgtggccatcaaggttttaagagag
gccacatcacctaaagccaacaaggagatattggacgaggcctatgtgatggccggtgtg
gaccacccccatgtttgtcgtctgctgggcatctgcctgacctctacagtccagctggtc
acccagctcatgccctatggctgtctgctggactatgtcaaggagaacaaggacaacatc
gggtcccagtaccttctcaactggtgtgtacagatagccaaggggatgagctacctggag
gagcatcacctggtgcatcgtgacctggcagcgaggaacgtcctggtgaagacccctcag
catgtcaagatcactgacttcggcctggccaaactcctcaactctgacgagaaggagtac
cacgcagacggaggaaaggtaccaatcaaatggatggcactggagtccatcctctaccgg
acatatacacatcaaagtgacgtgtggagctatggtgtgaccgcgtgggagctaatgacg
tttgggaccaagccctatgacggcatcccagccagtgaggtagcaggggtgctggagaaa
ggcgagcggctcccccagcctcccatctgtaccatagacgtctacatgatcatggtcaaa
tgttggatgatcgacgcagacagcaggcctcgtttccgggagctgatagcagagttttcc
aagatggcgcgggatcccccacgttaccttgtcatccagggtgacgaccggatgcacctc
cccagccccactgacaccaagttctaccacagtctgatcagtggagaggacatggaagat
gctgtggacgcagacgagtacctagtgcctcagcacggcttcttcagtagctccagtacc
tcccgcacacagctcctacactctacgagccagaacagcacgttgaacagcagcattgga
atgtgccacagcagaaatgggaacgggttcccagtcagagaaggaagcatggttctccgg
tacattgctgaccccacagataggttcttggaccacgccttccagccatctccagactac
attaaccagaacggagtttcggacatgatgaaccctgtataccagcaccctggtccccct
cgcaccctcctccccaccatatcctcagacgacgcagaggcagagtacctgaactgctat
aagaacggggcagtggggcctgagtacctcaacaccctccagccttccctcctctccccc
accacctccaatggcatctccaatggcctcaaccccactgctaacggccattcccccata
tccaatggtctcctctcccccacctccaatggcctctccccaatttccaatggtggtctc
caccacgtccagaaaaaccagccccaaaacagtatagataacccagactaccagcaggac
ttcaccccctccatcaagacccacatcccagccgcagagtacgtgggcccaaactga

DBGET integrated database retrieval system