KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112215344
Entry
112215344         CDS       T05605                                 

Definition
(RefSeq) apoptosis regulator Bcl-2-like
  KO
K02161  apoptosis regulator Bcl-2
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04115  p53 signaling pathway
otw04140  Autophagy - animal
otw04141  Protein processing in endoplasmic reticulum
otw04210  Apoptosis
otw04217  Necroptosis
otw04261  Adrenergic signaling in cardiomyocytes
otw04340  Hedgehog signaling pathway
otw04510  Focal adhesion
otw04621  NOD-like receptor signaling pathway
otw05132  Salmonella infection
otw05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    112215344
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    112215344
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112215344
  09143 Cell growth and death
   04210 Apoptosis
    112215344
   04217 Necroptosis
    112215344
   04115 p53 signaling pathway
    112215344
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112215344
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    112215344
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112215344
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112215344
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    112215344
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:otw01009]
    112215344
Protein phosphatases and associated proteins [BR:otw01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     112215344
SSDB
Motif
Pfam: Bcl-2 Bcl-2_3 BH4 DUF4350
Other DBs
NCBI-GeneID: 112215344
NCBI-ProteinID: XP_024230072
LinkDB
Position
16
AA seq 228 aa
MMANENPYNSRFIVEKYIHHKLLKVGFVWKFQGENDSPNNGFGDPSTPNSPEVFARRSQP
TAAGEDTDSPYQNSSPQPDPHARLHRVLREAGGEIERMYQRDFAEMSGQLHFTPSTAQRR
FTAVIDELFSDGVNWGRIVAFFEFGGTMCVESVNREMTSQVDNIARWMTEYLNGPLQNWI
QENGGWDAFVEIYEQQRISHSWSYLKTVFGLAALGAAGVTIGALFTQK
NT seq 687 nt   +upstreamnt  +downstreamnt
atgatggcaaacgagaatccttataacagtcgctttattgtcgaaaaatacatccatcac
aaactgttgaaagtgggatttgtatggaaatttcaaggagaaaacgattctccaaataat
ggctttggggacccctctacacccaactcccccgaagtttttgcacggaggtcccagccc
actgccgcgggagaggacaccgactctccttaccaaaacagcagtccgcaacctgaccca
catgccaggctccacagggtcctgcgcgaggctggtggcgagattgaaagaatgtatcag
cgggactttgcagagatgtcggggcagttgcattttacacccagcacggcacagagaagg
tttaccgctgtaatagatgagctcttcagcgacggggtaaactggggtcggattgtggct
ttctttgagtttggagggacaatgtgcgtggagagcgtcaaccgggagatgacgtcccaa
gtagacaacatcgctcgttggatgacggagtacttgaacggacccctacagaactggatc
caggagaatggtggctgggacgcctttgtggagatctatgagcagcagaggatctctcac
tcctggtcgtacttaaagacagtgttcggcctggccgccctgggagccgccggagtcacc
atcggagccttgttcacccagaagtga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112226859
Entry
112226859         CDS       T05605                                 

Definition
(RefSeq) apoptosis regulator Bcl-2-like
  KO
K02161  apoptosis regulator Bcl-2
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04115  p53 signaling pathway
otw04140  Autophagy - animal
otw04141  Protein processing in endoplasmic reticulum
otw04210  Apoptosis
otw04217  Necroptosis
otw04261  Adrenergic signaling in cardiomyocytes
otw04340  Hedgehog signaling pathway
otw04510  Focal adhesion
otw04621  NOD-like receptor signaling pathway
otw05132  Salmonella infection
otw05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    112226859
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    112226859
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112226859
  09143 Cell growth and death
   04210 Apoptosis
    112226859
   04217 Necroptosis
    112226859
   04115 p53 signaling pathway
    112226859
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112226859
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    112226859
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112226859
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112226859
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    112226859
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:otw01009]
    112226859
Protein phosphatases and associated proteins [BR:otw01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     112226859
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3 DUF4350
Other DBs
NCBI-GeneID: 112226859
NCBI-ProteinID: XP_024247250
LinkDB
Position
28
AA seq 226 aa
MANDDNRFIVEKYICHKLLKRGYAWDFEDAEEEEGAANNGSMISPRPGLARRCHGANNAG
PGSVPRLSKWLSQPDPHAAIHRVLREAGDELERLYQPDFAEMSHQLYLTSSTAERRFREV
IDELFRDGVNWGRIIAFFEFGGTICVECVNKEMTSQVDHIAVWMTEYLNGPLLNWIQENG
GWEAFVELYDRQRDSVFCSWPSIKTVFGLAALGAASLTIGAYLTQK
NT seq 681 nt   +upstreamnt  +downstreamnt
atggcaaacgacgacaaccgctttatagtggaaaagtacatttgtcacaaactcttgaaa
cgaggatatgcgtgggatttcgaggatgccgaggaggaggaaggtgctgctaataatggg
tcgatgatttctcctcggccgggtttggcacggcggtgccacggggccaataacgccgga
ccgggcagcgtccctcgtctttccaaatggctctcccaaccggacccgcatgcagctatt
cacagagttttgcgtgaggccggggacgaactcgaaagactgtaccagcccgacttcgca
gagatgtcacaccagctgtatctcacatcctccacggctgagaggagatttagagaggtg
atagacgagctgttcagggatggggttaactggggacggattatcgccttcttcgagttc
gggggcacaatatgcgtggaatgcgtgaacaaggagatgacgtcgcaggtggatcacatc
gcggtgtggatgacagagtatctaaatggaccactgctcaactggattcaggagaacggg
ggatgggaggcttttgttgagctctatgacagacagagggactcggtgttctgttcgtgg
ccgtccatcaagaccgtcttcggcctggctgcactgggggccgcaagccttaccatcgga
gcataccttacacagaagtga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112227752
Entry
112227752         CDS       T05605                                 

Definition
(RefSeq) apoptosis regulator Bcl-2-like
  KO
K02161  apoptosis regulator Bcl-2
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04115  p53 signaling pathway
otw04140  Autophagy - animal
otw04141  Protein processing in endoplasmic reticulum
otw04210  Apoptosis
otw04217  Necroptosis
otw04261  Adrenergic signaling in cardiomyocytes
otw04340  Hedgehog signaling pathway
otw04510  Focal adhesion
otw04621  NOD-like receptor signaling pathway
otw05132  Salmonella infection
otw05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    112227752
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    112227752
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112227752
  09143 Cell growth and death
   04210 Apoptosis
    112227752
   04217 Necroptosis
    112227752
   04115 p53 signaling pathway
    112227752
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112227752
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    112227752
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112227752
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112227752
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    112227752
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:otw01009]
    112227752
Protein phosphatases and associated proteins [BR:otw01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     112227752
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3 DUF2200
Other DBs
NCBI-GeneID: 112227752
NCBI-ProteinID: XP_024248368
LinkDB
Position
29
AA seq 230 aa
MMANDNPYNSRFIVEKYIHHKLLKKGFVWEFYPENDSPNNGFGEPSPPNSPEVFARRSQP
YAEGVDTDSPLQNRIPQPDRHARLHRVLREAGDEIEIMYQRDFAEMSGQLHFTPSTAQRR
FTAVIEELFSDGVNWGRIVAFFEFGGTMCVESVNREMTSQVDNIAHWMTEYLNGPLQNWI
QENGDWDAFVEIYGQQRISAFHSWPYLKTVFGLAALGAAGVTIGALFIQK
NT seq 693 nt   +upstreamnt  +downstreamnt
atgatggcaaacgataatccttataacagtcgctttattgttgaaaaatacatacatcac
aaactgttgaagaagggatttgtatgggaattttatccagaaaacgattccccaaataat
ggttttggggagccctctccccctaactcccccgaagtttttgcacggaggtcccaaccc
tacgccgaaggcgtggacactgactctccgctccaaaacaggatcccgcaaccggaccga
catgcccggctccatagggtgctgcgcgaggcgggggacgagattgaaataatgtatcag
cgggactttgcagagatgtcggggcagttgcattttacgcccagtacggcacagagaagg
tttactgctgttatagaggagctcttcagcgacggtgtaaactggggtcggattgtggct
ttctttgaatttggagggacaatgtgcgtggagagcgtcaaccgggagatgacgtcccag
gtagacaacattgcccattggatgacagagtacctgaacggacccctgcagaactggatc
caggagaatggtgactgggacgcctttgtggagatctatgggcagcagaggatctctgcc
ttccactcctggccctacctaaagacagtgttcggcctggccgccctgggtgcagccgga
gtcaccattggagccttgttcatccagaagtga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112232698
Entry
112232698         CDS       T05605                                 

Definition
(RefSeq) apoptosis regulator Bcl-2-like
  KO
K02161  apoptosis regulator Bcl-2
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04115  p53 signaling pathway
otw04140  Autophagy - animal
otw04141  Protein processing in endoplasmic reticulum
otw04210  Apoptosis
otw04217  Necroptosis
otw04261  Adrenergic signaling in cardiomyocytes
otw04340  Hedgehog signaling pathway
otw04510  Focal adhesion
otw04621  NOD-like receptor signaling pathway
otw05132  Salmonella infection
otw05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    112232698
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    112232698
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112232698
  09143 Cell growth and death
   04210 Apoptosis
    112232698
   04217 Necroptosis
    112232698
   04115 p53 signaling pathway
    112232698
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112232698
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    112232698
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112232698
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112232698
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    112232698
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:otw01009]
    112232698
Protein phosphatases and associated proteins [BR:otw01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     112232698
SSDB
Motif
Pfam: Bcl-2 Bcl-2_3 BH4 DUF4350
Other DBs
NCBI-GeneID: 112232698
NCBI-ProteinID: XP_024255653
LinkDB
Position
Unknown
AA seq 228 aa
MMANENPYNSRFIVEKYIHHKLLKVGFVWKFQGENDSPNNGFGDPSTPNSPEVFARRSQP
TAAGEDTDSPYQNSSPQPDPHARLHRVLREAGGEIERMYQRDFAEMSGQLHFTPSTAQRR
FTAVIDELFSDGVNWGRIVAFFEFGGTMCVESVNREMTSQVDNIARWMTEYLNGPLQNWI
QENGGWDAFVEIYEQQRISHSWSYLKTVFGLAALGAAGVTIGALFTQK
NT seq 687 nt   +upstreamnt  +downstreamnt
atgatggcaaacgagaatccttataacagtcgctttattgtcgaaaaatacatccatcac
aaactgttgaaagtgggatttgtatggaaatttcaaggagaaaacgattctccaaataat
ggctttggggacccctctacacccaactcccccgaagtttttgcacggaggtcccagccc
actgccgcgggagaggacaccgactctccttaccaaaacagcagtccgcaacctgaccca
catgccaggctccacagggtcctgcgcgaggctggtggcgagattgaaagaatgtatcag
cgggactttgcagagatgtcggggcagttgcattttacacccagcacggcacagagaagg
tttaccgctgtaatagatgagctcttcagcgacggggtaaactggggtcggattgtggct
ttctttgagtttggagggacaatgtgcgtggagagcgtcaaccgggagatgacgtcccaa
gtagacaacatcgctcgttggatgacggagtacttgaacggacccctacagaactggatc
caggagaatggtggctgggacgcctttgtggagatctatgagcagcagaggatctctcac
tcctggtcgtacttaaagacagtgttcggcctggccgccctgggagccgccggagtcacc
atcggagccttgttcacccagaagtga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112233575
Entry
112233575         CDS       T05605                                 

Definition
(RefSeq) apoptosis regulator Bcl-2-like
  KO
K02161  apoptosis regulator Bcl-2
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04115  p53 signaling pathway
otw04140  Autophagy - animal
otw04141  Protein processing in endoplasmic reticulum
otw04210  Apoptosis
otw04217  Necroptosis
otw04261  Adrenergic signaling in cardiomyocytes
otw04340  Hedgehog signaling pathway
otw04510  Focal adhesion
otw04621  NOD-like receptor signaling pathway
otw05132  Salmonella infection
otw05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    112233575
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    112233575
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112233575
  09143 Cell growth and death
   04210 Apoptosis
    112233575
   04217 Necroptosis
    112233575
   04115 p53 signaling pathway
    112233575
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112233575
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    112233575
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112233575
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112233575
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    112233575
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:otw01009]
    112233575
Protein phosphatases and associated proteins [BR:otw01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     112233575
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3 DUF2200
Other DBs
NCBI-GeneID: 112233575
NCBI-ProteinID: XP_024257080
LinkDB
Position
Unknown
AA seq 230 aa
MMANDNPYNSRFIVEKYIHHKLLKKGFVWEFYPENDSPNNGFGEPSPPNSPEVFARRSQP
YAEGVDTDSPLQNRIPQPDRHARLHRVLREAGDEIEIMYQRDFAEMSGQLHFTPSTAQRR
FTAVIEELFSDGVNWGRIVAFFEFGGTMCVESVNREMTSQVDNIAHWMTEYLNGPLQNWI
QENGDWDAFVEIYGQQRISAFHSWPYLKTVFGLAALGAAGVTIGALFIQK
NT seq 693 nt   +upstreamnt  +downstreamnt
atgatggcaaacgataatccttataacagtcgctttattgttgaaaaatacatacatcac
aaactgttgaagaagggatttgtatgggaattttatccagaaaacgattccccaaataat
ggttttggggagccctctccccctaactcccccgaagtttttgcacggaggtcccaaccc
tacgccgaaggcgtggacactgactctccgctccaaaacaggatcccgcaaccggaccga
catgcccggctccatagggtgctgcgcgaggcgggggacgagattgaaataatgtatcag
cgggactttgcagagatgtcggggcagttgcattttacgcccagtacggcacagagaagg
tttactgctgttatagaggagctcttcagcgacggtgtaaactggggtcggattgtggct
ttctttgaatttggagggacaatgtgcgtggagagcgtcaaccgggagatgacgtcccag
gtagacaacattgcccattggatgacagagtacctgaacggacccctgcagaactggatc
caggagaatggtgactgggacgcctttgtggagatctatgggcagcagaggatctctgcc
ttccactcctggccctacctaaagacagtgttcggcctggccgccctgggtgcagccgga
gtcaccattggagccttgttcatccagaagtga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112260550
Entry
112260550         CDS       T05605                                 

Definition
(RefSeq) apoptosis regulator Bcl-2-like
  KO
K02161  apoptosis regulator Bcl-2
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04115  p53 signaling pathway
otw04140  Autophagy - animal
otw04141  Protein processing in endoplasmic reticulum
otw04210  Apoptosis
otw04217  Necroptosis
otw04261  Adrenergic signaling in cardiomyocytes
otw04340  Hedgehog signaling pathway
otw04510  Focal adhesion
otw04621  NOD-like receptor signaling pathway
otw05132  Salmonella infection
otw05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    112260550
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    112260550
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112260550
  09143 Cell growth and death
   04210 Apoptosis
    112260550
   04217 Necroptosis
    112260550
   04115 p53 signaling pathway
    112260550
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112260550
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    112260550
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112260550
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112260550
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    112260550
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:otw01009]
    112260550
Protein phosphatases and associated proteins [BR:otw01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     112260550
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Other DBs
NCBI-GeneID: 112260550
NCBI-ProteinID: XP_024291520
LinkDB
Position
10
AA seq 224 aa
MANDDNRCIVEKYICHKLLKRGYAWDFENAEEDADNNGSMISPPPGLXRRCHGANNARPG
SVPHLSKRLSQTDPHAAIHRVLREAGDELERLYQPDFAEMSHQLYLTSSMAERRFREVID
ELFRDGVNWGRIVAFFEFGGTICVECVNKEMTSQVDHIAGWMAEYLNGPLHNWIQENGGW
EAFVELYDRQRDSVFGSWPSIKTVFGLAALGAASLTIGAYLTQK
NT seq 675 nt   +upstreamnt  +downstreamnt
atggcaaacgacgacaaccgctgtatagtggaaaagtacatttgtcacaaactcttgaaa
aggggatatgcgtgggatttcgagaatgccgaggaagatgctgataataatgggtcgatg
atttctcctccgcctggtttgrcacggcggtgccacggggccaataacgccagaccgggc
agcgtcccccatctttccaaacggctctcccaaacggacccgcatgcagctattcacaga
gttttgcgtgaggccggggacgaactcgaacgactgtaccagcccgactttgcggagatg
tcacaccaattgtatctcacgtcttctatggcagaaaggagattcagagaggtgatagac
gagctgttcagggacggggttaactggggacgaattgtagccttcttcgagttcggtggc
acaatatgtgtggaatgcgtgaacaaggaaatgacgtcgcaggttgaccacatcgccggg
tggatggcggagtatctaaatggaccgctgcacaactggattcaagagaacgggggatgg
gaggcctttgttgagctctatgacagacagagggactccgtgttcggttcatggccgtcc
atcaagactgtctttggcctggctgcactgggggccgcaagccttaccatcggagcttac
cttacacagaagtga

DBGET integrated database retrieval system