KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112215347
Entry
112215347         CDS       T05605                                 

Definition
(RefSeq) 5'-AMP-activated protein kinase subunit gamma-1-like isoform X1
  KO
K07200  5'-AMP-activated protein kinase, regulatory gamma subunit
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04371  Apelin signaling pathway
otw04530  Tight junction
otw04910  Insulin signaling pathway
otw04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    112215347
   04068 FoxO signaling pathway
    112215347
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    112215347
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112215347
   04920 Adipocytokine signaling pathway
    112215347
SSDB
Motif
Pfam: CBS
Other DBs
NCBI-GeneID: 112215347
NCBI-ProteinID: XP_024230074
LinkDB
Position
16
AA seq 564 aa
MPFLVRDADHMDTDGIRKGGGGCHSVSPTKGFFTRGPFSRPSSPKSAPARTKNSPGSPKT
IFPYPSSQQDSPPKSSRRLSFNGIFRSSSRDSTSNSTSPVSVKVFSRARKASGISSPPST
PPTQSVKQPPAFLLEAYRSEPERPEARMRSYSSPPDTGQRFSLPCTKPPMTPSAPIATSQ
SQPVDSLVENMLKKLELEDEAVEESERDIYMRFMKSHKCYDIVPTSSKLVVFDTTLQVKK
AFFALVANGVRAAPLWETKKQSFVGMLTITDFINILHRYYKSPMVQIYELEEHKIETWRE
LYLQETFKPLVNISPDASIFDAVYSLIKNKIHRLPVIDPVSGNALYILTHKRILKFLQLF
VCEMPKPAFMKQTLEELTIGTYHNIAFIHPDTPIIKALNIFVVRRVSALPVVDESGKVVD
IYSKFDVINLAAEKTYNNLDITVTQALRHRSQYFEGVMKCNRLETLETIVDRIVKAEVHR
LVVVGDNAHIVGIVSLSDILQALVLTPAGIGRKSSQARSKAEVEAEAPPETLVEAEAPPE
TLVEAEAPPETLVEAEAQVVGAGN
NT seq 1695 nt   +upstreamnt  +downstreamnt
atgcccttcttggtgagagatgccgaccatatggatacggacggcatacggaagggtgga
gggggttgccactcagtcagcccgacgaaaggtttcttcacccggggacccttcagtcgg
ccctccagtcccaagtcagcccctgccaggactaagaacagcccaggctcccccaaaacc
atcttcccctacccttcgtcccaacaggactccccacccaagtcatctcgtcgcctgagc
ttcaacggcatcttccgctcctcctccagggactctacctccaactccacctctcccgtc
agcgtcaaggtcttctccagggccaggaaagcctctgggatctcctcgcccccctcaact
cctccaacgcagtccgtcaagcagccgccggcgttcctgctggaggcctatcggagtgag
ccggagaggccggaggcacggatgcgctcctactcttccccgccagacaccgggcaacgc
ttcagtctaccctgcaccaaaccacccatgactccctccgcccccatcgctacctcacaa
tcacaaccagtcgacagtttagttgaaaacatgctgaagaaacttgagctagaagatgaa
gctgttgaagaatccgaaagggatatctacatgcgctttatgaagtcacacaagtgctac
gacattgttcctaccagctccaagctcgttgtttttgacactactctgcaagtaaagaag
gctttctttgccttggttgccaacggggtgcgggcagccccgctatgggagacgaagaag
cagagctttgtcggaatgttaaccatcacagacttcatcaacatcctccacagatactac
aagtctcccatggtacaaatatatgagctggaggagcataaaattgaaacgtggagagag
ctctacctacaagaaacctttaagccgttagtgaacatatcacctgatgcaagtatattt
gacgcagtatactcgctcatcaagaacaagatccaccggctgcccgtcatcgacccagtc
agcggaaacgcactttatatcctcacacacaagagaatcctcaagttcctccagctcttt
gtgtgtgagatgccaaagcctgcctttatgaagcagaccctggaggagctgaccatcggc
acctaccacaacatcgccttcatccaccccgacacacccatcatcaaggccctgaacatc
ttcgtggtccggagggtgtccgcactgccagtggtggacgagtcagggaaagtcgtggat
atttattccaagtttgatgtcattaaccttgctgctgagaagacctacaacaacctggac
atcacggtgacccaggctctgaggcatcgctcgcagtactttgagggcgtgatgaagtgc
aaccggctcgagacactggagaccatcgtggacagaatagtcaaagcagaggtccacagg
ctggtggtggtgggcgacaacgcccacatcgtgggcatcgtttccctgtcggacatcctg
caggccctggtgctcacccctgcaggcatcggcaggaagagcagccaagcacgatcaaaa
gcagaggtagaggcagaggcaccaccagaaacattggtagaggcagaggcaccaccagaa
acattggtagaggcagaggcaccaccagaaacattggtagaggcagaggcacaggtagta
ggggctggaaactga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112217541
Entry
112217541         CDS       T05605                                 

Definition
(RefSeq) 5'-AMP-activated protein kinase subunit gamma-1-like isoform X1
  KO
K07200  5'-AMP-activated protein kinase, regulatory gamma subunit
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04371  Apelin signaling pathway
otw04530  Tight junction
otw04910  Insulin signaling pathway
otw04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    112217541
   04068 FoxO signaling pathway
    112217541
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    112217541
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112217541
   04920 Adipocytokine signaling pathway
    112217541
SSDB
Motif
Pfam: CBS Cbl_N3
Other DBs
NCBI-GeneID: 112217541
NCBI-ProteinID: XP_024233660
LinkDB
Position
2
AA seq 441 aa
MRNQKEVLLEGAIAISRASGGVPVIPRHLSPRSFHAISPAKFNKPIPWEKVRRENNIWLF
TSLPYRTKQGRDSEWKMECMPLSVDDVDCKKEPLLEDSDYNVYTRFMKSHRCYDLVPTSS
KLVVFDTSLQVKKAFFALVSNGVRAAPLWDCKKQCFVGMLTITDFINILHRYYKSPLVQI
YELEEHKIETWREVYLQDSFKPLVSISPNESLYDAVSSLLKNKIHRLPVIDPLTGNTLYI
LTHKRILKFLKLFISEMPKPAFLGQTLEELGIGTFHKIAVVRSDTPLYTALGIFVEQRVS
ALPVVDDNGRVVDIYSKFDVINLAAEKTYNNLDVTVTKALQHRSQYFEGVLTCNTHDTLE
SIINRLVEAEVHRLVVVDEQEVVKGIVSLSDILQALVLTNGDGDKSKHKPALCTDLDESN
ENNELLEGVMKGSLLQKDEDK
NT seq 1326 nt   +upstreamnt  +downstreamnt
atgcgcaatcagaaggaagtactgttagagggagcaatcgcaatctctcgcgcttccggg
ggagttccagtcattccaaggcatctttctcctcgttcatttcacgctatcagtccagct
aagtttaataaaccgataccttgggaaaaagtccggcgtgagaataacatttggttgttt
acttcgctaccttacaggaccaagcaaggacgagacagtgaatggaaaatggagtgtatg
ccactttctgttgatgatgtggattgtaaaaaggagccacttctagaagactctgattat
aatgtctacacccggtttatgaagtctcatcgatgctatgacttggtccctaccagctcc
aagttggtggtgttcgatacttcactgcaggtaaagaaggcatttttcgctctggtgtcc
aatggggtgagagcagcaccactctgggactgtaagaagcagtgttttgtaggcatgctg
accatcacagacttcatcaacatcctccatcgctactacaagtctcctttggtgcagata
tatgagctggaggagcacaagatagagacgtggagagaagtctaccttcaagactccttc
aagcccctagtcagcatatcccccaatgaaagtctgtatgacgccgtgtcgtctctgctg
aagaataagatccacagactgcctgtgatcgaccctctgacagggaacaccctctacatc
ctcactcacaagaggatcctcaagtttctcaagctctttatatcggagatgccgaaacct
gctttcttaggccagactctagaggaactgggcatcggaacattccataagattgcagtg
gtgcgttctgacacacctctttacacagcactgggcatcttcgtggagcagagagtgtct
gccctgcctgtcgtcgatgacaatggacgagtggtggacatttactccaaatttgatgtc
attaacctagctgcagagaagacgtacaacaacctggatgtgactgtgaccaaagccctg
cagcaccgctctcagtattttgagggagtgctcacctgcaacacacacgacacactggag
tccatcataaacagactggtagaggcagaggtgcacaggctggtggtggttgatgagcag
gaggtggtgaagggtatagtctctctctcagacatcctccaggcactggtgctcactaat
ggagacggagacaagagtaaacacaaacctgcgctatgcactgaccttgatgaatcaaat
gaaaacaatgaactgcttgagggagtgatgaagggaagcctcctccaaaaagatgaggat
aaatag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112219380
Entry
112219380         CDS       T05605                                 

Definition
(RefSeq) 5'-AMP-activated protein kinase subunit beta-1-like isoform X1
  KO
K07199  5'-AMP-activated protein kinase, regulatory beta subunit
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04371  Apelin signaling pathway
otw04530  Tight junction
otw04910  Insulin signaling pathway
otw04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    112219380
   04068 FoxO signaling pathway
    112219380
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    112219380
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112219380
   04920 Adipocytokine signaling pathway
    112219380
SSDB
Motif
Pfam: AMPK1_CBM AMPKBI CBM_48 CBM53
Other DBs
NCBI-GeneID: 112219380
NCBI-ProteinID: XP_024236340
LinkDB
Position
20
AA seq 265 aa
MGNTNTGMGTGHRRDSRAKEGDRPKILMDSPEDADMFHGEDIKAPLEKEEYLAWRQDLEA
DKGPTLDRPTVFRWTGSGKEVFLSGSFNNWANKIPLTRSQNNFVAIVDLPEGEHQYKFYV
DGTWTHDPAEPVVTNQLGTVNNVIQVKKTDFEVFDALMVDSQKCSDMSGQCQDLSSSPPG
PYHQDPYIPKQEEKFKSPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLYALSIK
DGVMVLSATHRYKKKYVTTLLYKPI
NT seq 798 nt   +upstreamnt  +downstreamnt
atggggaacactaacaccggtatgggtacaggacacaggcgggacagccgtgccaaggag
ggcgacaggcctaaaatcctcatggacagtccagaggatgctgatatgttccatggagag
gacatcaaggctccactagagaaggaggagtaccttgcatggcggcaggacctggaggct
gataaagggcccacactggaccgccccactgtgttccgctggactggaagcggaaaggag
gtctttctgtccggttccttcaacaactgggccaacaagattcccctaaccaggagtcag
aacaactttgtggccattgtggatctgcctgaaggggagcatcagtataagttctatgtg
gacggcacgtggacccatgacccagctgagcctgttgtaaccaaccagctaggcacagtc
aacaacgtcatccaagtgaagaagactgactttgaggtgtttgatgcacttatggtggac
tcacagaaatgctctgatatgtcaggtcagtgtcaagacctgtctagctctcctcccgga
ccgtaccatcaggacccttacatacccaagcaggaagaaaagttcaagtctccgcccatt
ctcccacctcacttgctacaggtcatcctaaacaaggacacaggaatctcttgtgaccct
gcattgctcccagaacccaatcatgtcatgctcaatcacctctacgccttgtccatcaag
gatggtgtgatggtgcttagtgcgactcatcgctacaagaagaagtatgtcaccaccctg
ctgtataagccgatctga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112220217
Entry
112220217         CDS       T05605                                 

Definition
(RefSeq) 5'-AMP-activated protein kinase catalytic subunit alpha-1-like
  KO
K07198  5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04140  Autophagy - animal
otw04150  mTOR signaling pathway
otw04371  Apelin signaling pathway
otw04530  Tight junction
otw04910  Insulin signaling pathway
otw04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    112220217
   04068 FoxO signaling pathway
    112220217
   04150 mTOR signaling pathway
    112220217
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112220217
  09144 Cellular community - eukaryotes
   04530 Tight junction
    112220217
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112220217
   04920 Adipocytokine signaling pathway
    112220217
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112220217
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112220217
   03029 Mitochondrial biogenesis [BR:otw03029]
    112220217
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     112220217
Protein kinases [BR:otw01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   112220217
Membrane trafficking [BR:otw04131]
 Autophagy
  Other autophagy associated proteins
   Others
    112220217
Mitochondrial biogenesis [BR:otw03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    112220217
  Mitophagy factors
   Other mitophagy factors
    112220217
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr AdenylateSensor Kinase-like Kdo RIO1 APH YukC
Other DBs
NCBI-GeneID: 112220217
NCBI-ProteinID: XP_024237711
LinkDB
Position
20
AA seq 588 aa
MATDKQKHEGRVKIGHYILGDTLGVGTFGKVKVGQHELTKHQVAVKILNRQKIRSLDVVG
KIRREIQNLKLFRHPHIIKLYQVISTPTDIFMVMEYVSGGELFDYICKNGKLDEKESRRL
FQQIISAVDYCHRHMVVHRDLKPENVLLDAQMNAKIADFGLSNMMSDGEFLRTSCGSPNY
AAPEVISGRLYAGPEVDIWSSGVILYALLCGTLPFDDDHVPTLFKKICDGIFFTPQYLNP
SVAALLKHMLQVDPMKRATIKEIREDEWFKVELPKYLFPEDPSYSNNMIDDEALKEVCEK
FECTEEEILTCLYSRNHHDPLAVAYHLIIDNRRIMSEAKDFYLASSPPDSFLDDQHLTAS
AAAAAGLKPHPERMQPFLAVETLPRPRHTLDELNPQKSKHQGVRRAKWHLGIRSQSRPND
IMSEVCRAMKQLDYEWKVVNPYYLRVKRKNPVTGMQTKMSLQLYQVDSRTYLLDFRSIDN
DMLEAKSGTATPHRSGSVGNYRTALKNDTAEEGGSQTEEAKDDATLTPATSIPPTPTKAS
ESSLASSLTSSVDSTGGDLAPTTVYPRPGSHTIEFFEMCANLIKLLAR
NT seq 1767 nt   +upstreamnt  +downstreamnt
atggcgacggataaacagaaacatgaaggcagagtaaaaattggacactatattctcgga
gacacacttggggtggggacgttcgggaaagttaaagtggggcagcacgagctgaccaaa
caccaggtggctgtgaagatcctgaacagacagaagatccgcagtttggatgtggtgggg
aagatccgtagagagatccagaacctcaagctcttcaggcatccacacatcatcaagctg
taccaggtgatcagcaccccaacagacatctttatggtgatggagtatgtgtctggagga
gagctctttgactacatctgcaaaaatggaaagttggatgagaaggagagccgtcgtctg
ttccagcagatcatctccgcagtagactactgccacagacacatggtggtgcaccgagac
ctgaagcctgagaacgtcctgctggacgcacagatgaacgccaagatcgctgactttggt
ttgtcaaacatgatgtccgatggagagtttctgaggacaagttgcggttctccgaactac
gctgcccctgaagtcatctctggaaggttatatgcaggtcctgaggtggacatctggagc
agtggggtgatcctgtatgccctgctgtgtgggacgctgcccttcgatgacgaccatgtg
ccaacgctcttcaagaagatctgtgacgggatcttcttcactcctcagtacttgaacccc
tctgtcgccgccctgctcaaacacatgctgcaggtggatcccatgaagagagccaccatc
aaagaaatccgagaggatgaatggttcaaagtggagctccccaagtacttgttcccagag
gacccgtcctacagcaacaacatgattgatgacgaggccctgaaggaggtgtgtgagaag
tttgagtgcactgaggaagaaatcctgacttgcttgtacagccgcaaccaccatgacccc
ctggctgtggcctaccacctcatcatcgacaaccgccgtatcatgtccgaggccaaagac
ttctatctggcctccagtcccccagactccttcttggacgaccagcacctgaccgcctct
gccgcggctgccgcaggccttaagccccaccccgagcgcatgcagccattcctggcagtg
gagacccttcccaggccgaggcacacgctggatgagctgaacccacagaaatcgaagcac
cagggggtgaggcgggctaagtggcacctggggatcaggagccagagcaggccaaatgat
attatgtctgaggtgtgccgggccatgaagcagctggactatgagtggaaggtggtgaat
ccgtactacctgcgtgtaaagaggaagaacccagtgacgggcatgcagaccaagatgagc
cttcagctctaccaggtggacagcaggacctacctcctggacttccgtagcatagacaat
gacatgttggaggctaaatctgggactgccactcctcaccggtctgggtcagtgggaaac
taccgcacggcccttaagaacgacactgctgaagagggggggtcccaaacggaggaggct
aaggacgacgctaccctgacccctgccacctccatccctcccacccccaccaaggcctcg
gagagctccctggcctcctcgctcacctcctctgttgactcaacaggaggtgacctcgct
ccgacgacagtctacccgcggcccggcagccacaccattgagttttttgagatgtgcgcc
aatctcatcaagctacttgcacgatag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112226519
Entry
112226519         CDS       T05605                                 

Definition
(RefSeq) 5'-AMP-activated protein kinase subunit beta-2-like
  KO
K07199  5'-AMP-activated protein kinase, regulatory beta subunit
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04371  Apelin signaling pathway
otw04530  Tight junction
otw04910  Insulin signaling pathway
otw04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    112226519
   04068 FoxO signaling pathway
    112226519
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    112226519
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112226519
   04920 Adipocytokine signaling pathway
    112226519
SSDB
Motif
Pfam: AMPK1_CBM AMPKBI CBM_48
Other DBs
NCBI-GeneID: 112226519
NCBI-ProteinID: XP_024246645
LinkDB
Position
28
AA seq 266 aa
MGNTGDRMSGDRHGAKAHRSDSRGSDKDHEPSKMVDSTDDPNIFNTHGLGSSKASDKEEP
DLDDLVKTGPQSRPTVIRWAGGGKEVYIAGSFNNWGNKIPLNKSHNDFVAILDLPEGEHQ
YKFFVDGQWVHDPSEPVVTSQLGTINNLIEVKQSDFEVFDALQVDSLESTDTSDLSSSPP
GPYGQEQYMFRPEERFKAPPILPPHLLQVILNKDTNISCDPALLPEPNHVMLNHLYALSI
KDGVMVLSATHRYKKKYVTSLLYKPI
NT seq 801 nt   +upstreamnt  +downstreamnt
atgggtaacacaggtgaccggatgtccggtgatcgccatggcgctaaggcccatcgatca
gacagcagaggcagcgacaaagaccatgagcccagcaagatggtggacagcacagacgat
cctaacatcttcaacacacacggactggggtcctccaaggcgtcggacaaggaggagcct
gacctggatgacttggtgaagacggggcctcagtccagacctacagtcatccgctgggcc
ggaggagggaaggaggtttacatcgcgggctccttcaacaactggggcaacaagatcccc
ctcaataagagccacaatgactttgtagcgatcctggacttgccagagggagagcaccag
tacaagttctttgtggacggacagtgggtccatgacccctcagagccagtggtgaccagc
cagttgggcaccatcaacaacctgatcgaggtgaagcagtcagactttgaggtgttcgat
gctctgcaggtggactctctggagtctaccgacacctcagatctgtccagctcccctcca
gggccctatggacaggagcagtacatgtttaggcctgaggaacgcttcaaagccccgccc
atcctccccccacacctcctccaagtcatcctcaacaaggacaccaacatctcttgcgac
ccagccttgctgcctgaacccaaccatgtgatgctcaaccacctttatgctctctcaata
aaggatggcgttatggtgctcagtgcgactcacagatataagaagaagtacgtcacatct
ctgctctacaagcccatctaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112226860
Entry
112226860         CDS       T05605                                 

Definition
(RefSeq) 5'-AMP-activated protein kinase subunit gamma-1-like isoform X1
  KO
K07200  5'-AMP-activated protein kinase, regulatory gamma subunit
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04371  Apelin signaling pathway
otw04530  Tight junction
otw04910  Insulin signaling pathway
otw04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    112226860
   04068 FoxO signaling pathway
    112226860
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    112226860
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112226860
   04920 Adipocytokine signaling pathway
    112226860
SSDB
Motif
Pfam: CBS UvsY
Other DBs
NCBI-GeneID: 112226860
NCBI-ProteinID: XP_024247251
LinkDB
Position
28
AA seq 556 aa
MGSTVMESNKKDNSKKKGILRINMPDLRAFTSPILDAESGGSEKDGSPKGEVCFHSASLT
KGLFVRGCAAGVSQPSSPMFAPAHSQSQTSPGSSRTIFPYPSTHQDRSPPKSPCRLNFSG
IFRSSSNSSSNSSIKLFSRTRKVSGLSSSPTPPSTPTQAPSQSMLFPQEVHQSVPERLGR
SLSSPPPDTGQRLSLPTSAKPSSSPIPYTFPLPQATSQPNFYGLFEGMLEKLELDDDGVA
AEPDSDIYMRFMKSHSCYDIVPTSSKLVVFDTGLQVKKAFFALVANGVRAAPLWDSERQC
FVGMLTITDFIIILHRYYKSPLVQIYELEDHKLETWREVYLQETFKPLVNISPESSIFDA
VYSLIKNKIHRLPVIDPVTGNPLYILTHKRILKFLQLFVREMPKPAFMKQTLGELGIGTY
KNIAFIHPDTPIIKALQIFVERRVSALPVVDVSGKVVDIYSKFDVINLAAEKTYNNLDIT
VTQALRHRWQYFEGVMQCHKLDTLETIVDRIVKAEVHRLVVVDDRSAIEGIVSLSDILQA
LVLSPADSCREEGLLE
NT seq 1671 nt   +upstreamnt  +downstreamnt
atggggagcacggtgatggagtctaacaagaaggataactcgaagaaaaagggaatccta
cgcataaatatgccagaccttagggcttttacctcccccatactggatgcagagtctggt
ggctcggaaaaggatggctctcctaagggagaggtctgctttcactctgccagcctaact
aaaggactctttgtgaggggttgtgctgctggtgtcagccaaccatctagtcccatgttt
gcccctgcccactcccagtctcagaccagtccgggctcttctagaaccatcttcccctac
ccctccacccaccaggaccgctcaccacccaagtcgccctgccgcctcaacttcagcggt
atcttccgctcttcatccaactcatcgtccaactctagcatcaagctcttctctaggacc
aggaaagtctccggcctctcgtcttcccccaccccacccagcacccccacccaggcccct
agccagtccatgctgttcccccaggaggtccaccagagtgtccctgaacgtctgggccgc
tccctctcatcacccccaccagacaccggacagcgcctcagcctgcccacctctgccaag
ccctcctcctctccgataccctacaccttcccactgccccaagctacctcacagccaaat
ttctacggtttattcgaaggcatgttggagaaacttgaactagacgatgatggtgttgct
gctgaaccagacagtgacatttacatgcgctttatgaagtcccatagctgctatgacatc
gtccccaccagctccaagctggttgtgtttgacactggactgcaagtgaagaaggctttc
tttgccttagtggccaatggggtgcgagctgctccactgtgggactcggagaggcagtgt
tttgtgggaatgttgacaatcaccgacttcatcatcatactacacagatactacaagtca
ccgctggtgcaaatatatgagttggaagatcataagcttgagacatggagagaagtatat
ttgcaagagacattcaaacctttagtgaacatatcacccgaatcaagcatatttgatgca
gtgtattccctcatcaaaaacaagatccaccgtctgcctgtcatcgaccctgttacggga
aacccactttacatcctcacacacaagaggatcctcaagttcctacagctctttgtgcgc
gagatgcccaagccagcctttatgaagcagaccctgggggagctgggcatcggtacctac
aagaacatagctttcatccaccctgacacacccatcatcaaggccctgcagatcttcgta
gagaggagggtgtctgccctgcctgtggtggacgtctctggaaaagtggtggatatttac
tccaaatttgatgtcataaacctggcagcagagaagacttataataacctggacatcacc
gtgacccaggctctgaggcatcgctggcagtactttgagggggtcatgcagtgccacaag
ctggacacactggagaccatcgtggacaggattgtcaaagcagaggtccatcggttggtg
gtggtggatgatcgctcggccatcgagggcatcgtctccctgtctgacattctgcaggcc
ctggtgctcagcccagcagattcctgccgagaggagggcctgctggagtga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112227751
Entry
112227751         CDS       T05605                                 

Definition
(RefSeq) 5'-AMP-activated protein kinase subunit gamma-2-like isoform X1
  KO
K07200  5'-AMP-activated protein kinase, regulatory gamma subunit
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04371  Apelin signaling pathway
otw04530  Tight junction
otw04910  Insulin signaling pathway
otw04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    112227751
   04068 FoxO signaling pathway
    112227751
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    112227751
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112227751
   04920 Adipocytokine signaling pathway
    112227751
SSDB
Motif
Pfam: CBS UvsY
Other DBs
NCBI-GeneID: 112227751
NCBI-ProteinID: XP_024248364
LinkDB
Position
29
AA seq 838 aa
MGSTANDSKKRDAKTPRKKRTLRLNMPDLGSFAMPFLEGDADHVDKADTQKDDGSCHSAS
PTKGFFTRGPFSRPSSPKSAPARTKNSPGSPKTIFPYPSSHQDSPPKSPRRLSFSGIFRS
SSRDSNSTSPISIKLFSRARKASGISSPPSTPPTQAAKQPPAFPLEAYRSEPERLEARMR
SYSSPPDTGQRFSLRCSKPPMTPSAPIANSRSRPVHGLAEGMLEKLDLEDEAFEESESDI
YMRFMKSHKCYDIVPTSSKLVVFDTTLQVKKAFFALVANGVRAAPLWETKKQSFVGMLTI
TDFINILHRYYKSPMVQIYELEEHQIETWRELYLQETFKPLVNISPDASIFDAVYSLIKN
KIHRLPVIDPVSGNALYILTHKRILKFLQLFVCEMPKPAFMKQTLEELTIGTYHNIAFIH
PNTPIIKALNIFVDRRVSALPVVDESGKVVDIYSKFDVINLAAEKTYNNLDITVTQALRH
RSQYFEGVMKCNRLETLETIVDRIVKAEVHRLVVVDENARIVGIVSLSDILQALVLAPAG
ICRKNSQPQPEIEAEAPPATLVEAEPEVEVAAEPEVEVAADTELQEEATAEAPPEMLVEA
EPEVEVAADTELQEEATAEAPPEMLVEAELEVAADTELQEEAEAEAPPEMLVEAEPETEE
PPETLVETEVVVAEPATEVEALVEAEVVVEDEAEVEGKTEVVVEVEIKTEVVEVKGETEA
EMEAEVEVKAETKAEEVEVKSEAGVVMVELVGVKAEVGMTEDEVVVEIKAETEVEAEVEV
MAETEAVVGMAEDEAEVVVEIKAETETEADVGNAEAVAESDAVETEAGPKDAEEGEAE
NT seq 2517 nt   +upstreamnt  +downstreamnt
atgggaagcacagcaaatgactccaagaagagagacgcgaagacacctagaaagaagagg
acgcttcgattgaacatgcccgacctcggctcgtttgccatgcccttcttggagggagat
gccgaccatgtggataaggccgacacacagaaggatgatgggagttgccactcagccagc
ccgaccaaaggcttcttcacgcgggggcccttcagtcggccctccagtcccaagtcggcc
cctgctaggaccaagaacagcccaggctcccccaaaaccatctttccctacccttcgtcc
caccaggactccccacccaagtcgcctcgtcgcctgagcttcagcggcatcttccgctcc
tcctccagagactctaactccacctctcccatcagcatcaagctcttctccagggccagg
aaagcctccgggatctcctcgcccccctcaactcctccgactcaggccgccaagcagccg
ccggcgttcccgctcgaggcctatcggagcgagccggagaggctggaggcacggatgcgc
tcctactcatccccgccagacaccgggcagcgcttcagtctacgctgctccaaaccaccc
atgactccctccgcccccatcgctaactcacgatcacgaccagtccacggtttagctgaa
ggcatgctggagaaacttgatctagaagatgaagcttttgaagaatccgaaagtgatatc
tacatgcgctttatgaagtcacacaagtgctatgacattgttcctaccagctctaagctc
gtggtttttgacactactctgcaggtaaaaaaggccttcttcgccttggttgccaacggg
gtgcgggcagccccactatgggagacaaagaagcagagctttgtcggaatgttaaccatc
acagacttcatcaacatcctccacagatactacaagtctcccatggtacaaatctacgag
ctggaggaacatcagattgaaacatggagagagctctatctacaagaaacctttaagcca
ttagtgaacatatcacctgatgcaagcatattcgacgcggtgtactcgctcatcaagaac
aagatccaccggctgcccgtcatagacccagtcagcggcaacgcgctttatatcctcacg
cacaagaggatcctcaagttcctccagctcttcgtgtgcgagatgcccaagcctgccttt
atgaagcagactttggaggaactaaccatcgggacctaccacaacatcgccttcatccac
cccaacacacccatcatcaaggccctcaacatctttgtggaccggagggtgtccgcactg
ccagtggtggacgagtcaggaaaagtagtggatatctattccaagtttgatgtcattaac
cttgctgctgagaagacctacaacaacctggacatcacggtgacccaggctctgaggcat
cgctcacagtactttgagggcgtcatgaagtgcaaccggctcgagacactggagaccatc
gtggacaggatagtcaaagcagaggtccacaggctggttgtggtggatgagaatgcccgg
atcgtgggcattgtgtccctgtcggacatcctgcaggccctggtgctcgcccctgcaggt
atctgcaggaagaacagccaaccacaaccagaaatagaagcagaggcaccaccagcaaca
ttagtagaggcagaaccagaggtagaggtagcagcagaaccagaggtagaggtagcagca
gatacagaactacaggaagaggccacagcagaggcaccaccagagatgttagtagaggca
gaaccagaggtagaggtagcagcagatacagaactacaggaagaggccacagcagaggca
ccaccagagatgttagtagaggcagaactagaggtagcagcagatacagaactacaggaa
gaggccgaagcagaggcaccaccagagatgttagtagaggcagaaccagagactgaggaa
ccaccagaaacattggtagagaccgaggtagtggtggctgaaccagcaactgaggtagaa
gctctagtggaagctgaggtggtagtggaagatgaagcagaggtggaaggtaagactgag
gtggtggtggaagtagaaatcaagactgaggtagtggaggttaagggtgaaactgaggca
gagatggaggctgaggtggaggttaaggctgaaaccaaggcagaggaagtagaggttaag
tctgaagctggggtggtgatggtagagttggtgggggttaaggctgaggtggggatgaca
gaggatgaagtggtggtggagattaaggctgaaactgaggtagaggctgaggtggaggtt
atggctgaaaccgaggctgtggtggggatggcagaggatgaagcagaggtggtggtggag
attaaggctgaaaccgagacagaggctgatgtgggaaatgctgaggctgtggcagagtct
gacgcagtagagactgaagctggacccaaggatgctgaggaaggagaggcagagtga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112230882
Entry
112230882         CDS       T05605                                 

Definition
(RefSeq) 5'-AMP-activated protein kinase catalytic subunit alpha-1-like
  KO
K07198  5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04140  Autophagy - animal
otw04150  mTOR signaling pathway
otw04371  Apelin signaling pathway
otw04530  Tight junction
otw04910  Insulin signaling pathway
otw04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    112230882
   04068 FoxO signaling pathway
    112230882
   04150 mTOR signaling pathway
    112230882
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112230882
  09144 Cellular community - eukaryotes
   04530 Tight junction
    112230882
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112230882
   04920 Adipocytokine signaling pathway
    112230882
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112230882
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112230882
   03029 Mitochondrial biogenesis [BR:otw03029]
    112230882
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     112230882
Protein kinases [BR:otw01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   112230882
Membrane trafficking [BR:otw04131]
 Autophagy
  Other autophagy associated proteins
   Others
    112230882
Mitochondrial biogenesis [BR:otw03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    112230882
  Mitophagy factors
   Other mitophagy factors
    112230882
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr AdenylateSensor Kinase-like Kdo RIO1 APH YukC
Other DBs
NCBI-GeneID: 112230882
NCBI-ProteinID: XP_024252996
LinkDB
Position
33
AA seq 583 aa
MATTDKQKHEGRVKIGHYILGDTLGVGTFGKVKVGQHELTKHQVAVKILNRQKIRSLDVV
GKIRREIQNLKLFRHPHIIKLYQVISTPTDIFMVMEYVSGGELFDYICKNGKLDEKESRR
LFQQIISAVDYCHRHMVVHRDLKPENVLLDAQMNAKIADFGLSNMMSDGEFLRTSCGSPN
YAAPEVISGRLYAGPEVDIWSSGVILYALLCGTLPFDDDHVPTLFKKICDGIFFTPQYLN
PSVAALLKHMLQVDPMKRATIKEIREDEWFKDELPKYLFPEDPCYSNNMIDDEALKEVCE
KFECTEEEILTCLYSRNHHDPLAVAYHLIIDNRRIMSEAKDFYLASSPPDSFLDDQHLTA
AAGLKPHPERMQPFLAGETPPRPRHTLDELNPLKSKHQGVRRAKWHLGIRSQSRPNDIMS
EVCRAMKQLDYEWKVVNPYYLRVKRKNPVTGMQTKMSLQLYQVDGRTYLLDFRSIDNDML
EAKSGTATPHQSDSVGNYRTALKNEAAAAAEGGSQTEGAKEYATPATSLPPTKASESSLA
SSLTTSVDSTGGDLAPMTAVPRPGSHTIEFFEMCANLIKLLAR
NT seq 1752 nt   +upstreamnt  +downstreamnt
atggcgacgacggataaacagaaacatgaaggaagagtgaaaatcggacattatattctt
ggagacacacttggagtggggacgttcgggaaagttaaagtggggcagcatgagctgacc
aaacaccaggtggctgtgaagatccttaacagacagaagatccgcagtctagatgtggtg
gggaagatacgtagagagatccaaaacctcaagctcttcaggcatcctcacataattaag
ctgtaccaggtgatcagcaccccaacagacatcttcatggtgatggagtacgtgtccgga
ggagagctctttgactacatctgcaaaaacggaaagctggatgagaaggagagccgtcgt
ctgttccagcagatcatctcagcagtagactactgccacagacacatggtggtgcacagg
gacctgaaacctgagaacgtcctgctggacgcacagatgaacgccaagattgctgacttt
ggtttgtcaaacatgatgtcggacggagagtttctgaggacaagctgtggttctccgaac
tatgctgcccctgaagtcatctctggaaggttatatgcaggtcctgaggtggacatctgg
agcagtggggtgatcctatatgccctgctgtgtgggacattgcccttcgacgatgaccac
gtgccaacgctcttcaagaaaatctgtgacgggatcttcttcacgccccagtacctgaac
ccctccgtcgccgccctgctcaaacatatgctgcaggtggatcccatgaagagggccacc
atcaaagagatccgagaggatgaatggttcaaagatgagctccccaagtacctgtttcca
gaagacccatgctacagcaacaacatgatcgacgacgaggccctgaaggaggtgtgtgag
aagtttgagtgcaccgaggaggagatcctgacttgcctgtacagccgcaaccaccacgac
cccctggctgtggcctaccatctcatcatcgacaaccgccgcattatgtccgaggccaag
gacttctacctggcctcaagtcccccagactcattcctggacgaccagcatctgaccgcc
gcggccggccttaagccccacccggagcgtatgcagcccttcctggcgggggagacccct
ccccggccgagacacacgctggacgagctgaaccccctgaagtcgaagcaccagggggtg
aggcgggccaagtggcacctggggatcaggagccagagcaggccaaatgatattatgtct
gaggtgtgccgtgccatgaagcagctcgactacgagtggaaggtggtgaacccgtactac
ctgcgtgtgaagaggaagaacccagttacgggcatgcagaccaagatgagccttcagctc
taccaggtggacggcaggacctacctcctggacttccgtagcatagacaatgacatgttg
gaggctaaatctgggactgccactcctcaccagtctgattcagtggggaactaccgcacg
gcccttaagaacgaagctgcagctgctgcagagggtgggtcccaaactgagggggctaag
gagtacgctacccctgccacatctctccctcccactaaggcctcagagagctccctggcc
tcctcgctcaccacctccgttgactcgacaggaggtgacctcgcacccatgactgcggtt
ccgcggcccggcagccacaccatagagttctttgagatgtgcgccaatctcatcaaacta
cttgcacgatag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112232700
Entry
112232700         CDS       T05605                                 

Definition
(RefSeq) 5'-AMP-activated protein kinase subunit gamma-1-like isoform X1
  KO
K07200  5'-AMP-activated protein kinase, regulatory gamma subunit
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04371  Apelin signaling pathway
otw04530  Tight junction
otw04910  Insulin signaling pathway
otw04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    112232700
   04068 FoxO signaling pathway
    112232700
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    112232700
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112232700
   04920 Adipocytokine signaling pathway
    112232700
SSDB
Motif
Pfam: CBS
Other DBs
NCBI-GeneID: 112232700
NCBI-ProteinID: XP_024255655
LinkDB
Position
Unknown
AA seq 564 aa
MPFLVRDADHMDTDGIRKGGGGCHSVSPTKGFFTRGPFSRPSSPKSAPARTKNSPGSPKT
IFPYPSSQQDSPPKSSRRLSFNGIFRSSSRDSTSNSTSPVSVKVFSRARKASGISSPPST
PPTQSVKQPPAFLLEAYRSEPERPEARMRSYSSPPDTGQRFSLPCTKPPMTPSAPIATSQ
SQPVDSLVENMLKKLELEDEAVEESERDIYMRFMKSHKCYDIVPTSSKLVVFDTTLQVKK
AFFALVANGVRAAPLWETKKQSFVGMLTITDFINILHRYYKSPMVQIYELEEHKIETWRE
LYLQETFKPLVNISPDASIFDAVYSLIKNKIHRLPVIDPVSGNALYILTHKRILKFLQLF
VCEMPKPAFMKQTLEELTIGTYHNIAFIHPDTPIIKALNIFVVRRVSALPVVDESGKVVD
IYSKFDVINLAAEKTYNNLDITVTQALRHRSQYFEGVMKCNRLETLETIVDRIVKAEVHR
LVVVGDNAHIVGIVSLSDILQALVLTPAGIGRKSSQARSKAEVEAEAPPETLVEAEAPPE
TLVEAEAPPETLVEAEAQVVGAGN
NT seq 1695 nt   +upstreamnt  +downstreamnt
atgcccttcttggtgagagatgccgaccatatggatacggacggcatacggaagggtgga
gggggttgccactcagtcagcccgacgaaaggtttcttcacccggggacccttcagtcgg
ccctccagtcccaagtcagcccctgccaggactaagaacagcccaggctcccccaaaacc
atcttcccctacccttcgtcccaacaggactccccacccaagtcatctcgtcgcctgagc
ttcaacggcatcttccgctcctcctccagggactctacctccaactccacctctcccgtc
agcgtcaaggtcttctccagggccaggaaagcctctgggatctcctcgcccccctcaact
cctccaacgcagtccgtcaagcagccgccggcgttcctgctggaggcctatcggagtgag
ccggagaggccggaggcacggatgcgctcctactcttccccgccagacaccgggcaacgc
ttcagtctaccctgcaccaaaccacccatgactccctccgcccccatcgctacctcacaa
tcacaaccagtcgacagtttagttgaaaacatgctgaagaaacttgagctagaagatgaa
gctgttgaagaatccgaaagggatatctacatgcgctttatgaagtcacacaagtgctac
gacattgttcctaccagctccaagctcgttgtttttgacactactctgcaagtaaagaag
gctttctttgccttggttgccaacggggtgcgggcagccccgctatgggagacgaagaag
cagagctttgtcggaatgttaaccatcacagacttcatcaacatcctccacagatactac
aagtctcccatggtacaaatatatgagctggaggagcataaaattgaaacgtggagagag
ctctacctacaagaaacctttaagccgttagtgaacatatcacctgatgcaagtatattt
gacgcagtatactcgctcatcaagaacaagatccaccggctgcccgtcatcgacccagtc
agcggaaacgcactttatatcctcacacacaagagaatcctcaagttcctccagctcttt
gtgtgtgagatgccaaagcctgcctttatgaagcagaccctggaggagctgaccatcggc
acctaccacaacatcgccttcatccaccccgacacacccatcatcaaggccctgaacatc
ttcgtggtccggagggtgtccgcactgccagtggtggacgagtcagggaaagtcgtggat
atttattccaagtttgatgtcattaaccttgctgctgagaagacctacaacaacctggac
atcacggtgacccaggctctgaggcatcgctcgcagtactttgagggcgtgatgaagtgc
aaccggctcgagacactggagaccatcgtggacagaatagtcaaagcagaggtccacagg
ctggtggtggtgggcgacaacgcccacatcgtgggcatcgtttccctgtcggacatcctg
caggccctggtgctcacccctgcaggcatcggcaggaagagcagccaagcacgatcaaaa
gcagaggtagaggcagaggcaccaccagaaacattggtagaggcagaggcaccaccagaa
acattggtagaggcagaggcaccaccagaaacattggtagaggcagaggcacaggtagta
ggggctggaaactga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112233576
Entry
112233576         CDS       T05605                                 

Definition
(RefSeq) 5'-AMP-activated protein kinase subunit gamma-2-like isoform X1
  KO
K07200  5'-AMP-activated protein kinase, regulatory gamma subunit
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04371  Apelin signaling pathway
otw04530  Tight junction
otw04910  Insulin signaling pathway
otw04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    112233576
   04068 FoxO signaling pathway
    112233576
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    112233576
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112233576
   04920 Adipocytokine signaling pathway
    112233576
SSDB
Motif
Pfam: CBS UvsY
Other DBs
NCBI-GeneID: 112233576
NCBI-ProteinID: XP_024257081
LinkDB
Position
Unknown
AA seq 838 aa
MGSTANDSKKRDAKTPRKKRTLRLNMPDLGSFAMPFLEGDADHVDKADTQKDDGSCHSAS
PTKGFFTRGPFSRPSSPKSAPARTKNSPGSPKTIFPYPSSHQDSPPKSPRRLSFSGIFRS
SSRDSNSTSPISIKLFSRARKASGISSPPSTPPTQAAKQPPAFPLEAYRSEPERLEARMR
SYSSPPDTGQRFSLRCSKPPMTPSAPIANSRSRPVHGLAEGMLEKLDLEDEAFEESESDI
YMRFMKSHKCYDIVPTSSKLVVFDTTLQVKKAFFALVANGVRAAPLWETKKQSFVGMLTI
TDFINILHRYYKSPMVQIYELEEHQIETWRELYLQETFKPLVNISPDASIFDAVYSLIKN
KIHRLPVIDPVSGNALYILTHKRILKFLQLFVCEMPKPAFMKQTLEELTIGTYHNIAFIH
PNTPIIKALNIFVDRRVSALPVVDESGKVVDIYSKFDVINLAAEKTYNNLDITVTQALRH
RSQYFEGVMKCNRLETLETIVDRIVKAEVHRLVVVDENARIVGIVSLSDILQALVLAPAG
ICRKNSQPQPEIEAEAPPATLVEAEPEVEVAAEPEVEVAADTELQEEATAEAPPEMLVEA
EPEVEVAADTELQEEATAEAPPEMLVEAELEVAADTELQEEAEAEAPPEMLVEAEPETEE
PPETLVETEVVVAEPATEVEALVEAEVVVEDEAEVEGKTEVVVEVEIKTEVVEVKGETEA
EMEAEVEVKAETKAEEVEVKSEAGVVMVELVGVKAEVGMTEDEVVVEIKAETEVEAEVEV
MAETEAVVGMAEDEAEVVVEIKAETETEADVGNAEAVAESDAVETEAGPKDAEEGEAE
NT seq 2517 nt   +upstreamnt  +downstreamnt
atgggaagcacagcaaatgactccaagaagagagacgcgaagacacctagaaagaagagg
acgcttcgattgaacatgcccgacctcggctcgtttgccatgcccttcttggagggagat
gccgaccatgtggataaggccgacacacagaaggatgatgggagttgccactcagccagc
ccgaccaaaggcttcttcacgcgggggcccttcagtcggccctccagtcccaagtcggcc
cctgctaggaccaagaacagcccaggctcccccaaaaccatctttccctacccttcgtcc
caccaggactccccacccaagtcgcctcgtcgcctgagcttcagcggcatcttccgctcc
tcctccagagactctaactccacctctcccatcagcatcaagctcttctccagggccagg
aaagcctccgggatctcctcgcccccctcaactcctccgactcaggccgccaagcagccg
ccggcgttcccgctcgaggcctatcggagcgagccggagaggctggaggcacggatgcgc
tcctactcatccccgccagacaccgggcagcgcttcagtctacgctgctccaaaccaccc
atgactccctccgcccccatcgctaactcacgatcacgaccagtccacggtttagctgaa
ggcatgctggagaaacttgatctagaagatgaagcttttgaagaatccgaaagtgatatc
tacatgcgctttatgaagtcacacaagtgctatgacattgttcctaccagctctaagctc
gtggtttttgacactactctgcaggtaaaaaaggccttcttcgccttggttgccaacggg
gtgcgggcagccccactatgggagacaaagaagcagagctttgtcggaatgttaaccatc
acagacttcatcaacatcctccacagatactacaagtctcccatggtacaaatctacgag
ctggaggaacatcagattgaaacatggagagagctctatctacaagaaacctttaagcca
ttagtgaacatatcacctgatgcaagcatattcgacgcggtgtactcgctcatcaagaac
aagatccaccggctgcccgtcatagacccagtcagcggcaacgcgctttatatcctcacg
cacaagaggatcctcaagttcctccagctcttcgtgtgcgagatgcccaagcctgccttt
atgaagcagactttggaggaactaaccatcgggacctaccacaacatcgccttcatccac
cccaacacacccatcatcaaggccctcaacatctttgtggaccggagggtgtccgcactg
ccagtggtggacgagtcaggaaaagtagtggatatctattccaagtttgatgtcattaac
cttgctgctgagaagacctacaacaacctggacatcacggtgacccaggctctgaggcat
cgctcacagtactttgagggcgtcatgaagtgcaaccggctcgagacactggagaccatc
gtggacaggatagtcaaagcagaggtccacaggctggttgtggtggatgagaatgcccgg
atcgtgggcattgtgtccctgtcggacatcctgcaggccctggtgctcgcccctgcaggt
atctgcaggaagaacagccaaccacaaccagaaatagaagcagaggcaccaccagcaaca
ttagtagaggcagaaccagaggtagaggtagcagcagaaccagaggtagaggtagcagca
gatacagaactacaggaagaggccacagcagaggcaccaccagagatgttagtagaggca
gaaccagaggtagaggtagcagcagatacagaactacaggaagaggccacagcagaggca
ccaccagagatgttagtagaggcagaactagaggtagcagcagatacagaactacaggaa
gaggccgaagcagaggcaccaccagagatgttagtagaggcagaaccagagactgaggaa
ccaccagaaacattggtagagaccgaggtagtggtggctgaaccagcaactgaggtagaa
gctctagtggaagctgaggtggtagtggaagatgaagcagaggtggaaggtaagactgag
gtggtggtggaagtagaaatcaagactgaggtagtggaggttaagggtgaaactgaggca
gagatggaggctgaggtggaggttaaggctgaaaccaaggcagaggaagtagaggttaag
tctgaagctggggtggtgatggtagagttggtgggggttaaggctgaggtggggatgaca
gaggatgaagtggtggtggagattaaggctgaaactgaggtagaggctgaggtggaggtt
atggctgaaaccgaggctgtggtggggatggcagaggatgaagcagaggtggtggtggag
attaaggctgaaaccgagacagaggctgatgtgggaaatgctgaggctgtggcagagtct
gacgcagtagagactgaagctggacccaaggatgctgaggaaggagaggcagagtga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112240217
Entry
112240217         CDS       T05605                                 

Definition
(RefSeq) 5'-AMP-activated protein kinase subunit gamma-1-like
  KO
K07200  5'-AMP-activated protein kinase, regulatory gamma subunit
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04371  Apelin signaling pathway
otw04530  Tight junction
otw04910  Insulin signaling pathway
otw04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    112240217
   04068 FoxO signaling pathway
    112240217
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    112240217
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112240217
   04920 Adipocytokine signaling pathway
    112240217
SSDB
Motif
Pfam: CBS
Other DBs
NCBI-GeneID: 112240217
NCBI-ProteinID: XP_024264318
LinkDB
Position
Unknown
AA seq 279 aa
MDVSIPEPVKKAFFALVANGVRAAPLWDNKLQCFVGKSCLNSLSVCLILLHDPEELLKYS
NHTLISITPDSSLFDAIYSLLKYKIHRLPVIDPESGNVLHILTHKRILKFLHIFGTMIPK
PRYLQKRIEEVDIGTFKQIATVRETDTVYDALAIFVQRRVSALPVVNEEGKIKALYSRFD
VINLAAQKNYNNLNMTMQEAISSRACCVDGVLKCYPHETLETIIDRIAKAEVHRLVLVDK
DDVVGGIVSLSDLLQALVLTPAEISQRAQTLTTEDKLGH
NT seq 840 nt   +upstreamnt  +downstreamnt
atggatgtgtccattccagagccagtaaaaaaagctttctttgctctggtggcgaacggt
gttcgggcggcgccgctgtgggataacaagctgcagtgttttgtaggtaagtcttgttta
aattctctctctgtgtgtctcatcctgcttcatgatccagaggaattgctgaagtactcc
aaccatactctgatcagtatcacacctgactccagcctttttgatgccatctattctctg
ctgaagtataagatccatcggctgcctgtgatcgacccagagtctggcaacgtcctgcac
atcctcacccacaaacgcatcctcaagttcctgcatatctttggcaccatgataccaaag
cctcggtacctccagaagagaattgaggaggtggacattggaacatttaaacagattgct
actgtccgggagacagacacggtgtacgacgccctggccatcttcgtacagcggagggtc
tccgctctgccagtggtcaatgaggaggggaaaatcaaggccctgtactccaggtttgat
gtgattaatctggccgctcagaagaattacaataacctgaacatgaccatgcaggaggcg
atcagtagcagggcctgctgtgtggacggggtgctgaagtgttaccctcacgagactctg
gagactatcatcgatcgtattgctaaggcagaggtccaccgtctcgtgctggtggataaa
gatgacgtggtgggggggatcgtctcgctctctgacctcctccaggccctggtcttgacc
ccggcagagatttcacaaagagctcaaactctgaccactgaagacaaattgggacactaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112248390
Entry
112248390         CDS       T05605                                 

Definition
(RefSeq) 5'-AMP-activated protein kinase subunit beta-1-like
  KO
K07199  5'-AMP-activated protein kinase, regulatory beta subunit
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04371  Apelin signaling pathway
otw04530  Tight junction
otw04910  Insulin signaling pathway
otw04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    112248390
   04068 FoxO signaling pathway
    112248390
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    112248390
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112248390
   04920 Adipocytokine signaling pathway
    112248390
SSDB
Motif
Pfam: AMPK1_CBM AMPKBI CBM_48 CBM53
Other DBs
NCBI-GeneID: 112248390
NCBI-ProteinID: XP_024273132
LinkDB
Position
4
AA seq 273 aa
MGNNSSSGERASAGQGERPYQRDDGQGAKDGARPKIIMDSTDDADLFNTREAKNAPQEIQ
EFLAWQRDLESDSKCPSQAKPTVFRWTGAGKEIFVSGSFNNWATKIPLNKSQNNFAAVVD
LPEGEHQYKFCVDGQWTLDPTGAVLTTKTGTVNNVIQVKRTDFEVFDALMIDSQECADMS
DLSSSPPGPYQQDPYITKTSDKLKNPPILPPHLLQVLLNKDTGVSCDPALLPEPNHVMLN
HLYALSIKDGVMVLSATHRYKKKYVTTLLYKPI
NT seq 822 nt   +upstreamnt  +downstreamnt
atgggaaacaacagcagcagtggtgagcgggccagtgcaggtcagggtgagaggccctat
cagcgtgacgatggacaaggtgccaaggatggagcacggcccaagattatcatggacagc
acagatgatgctgacctgtttaacacccgagaggctaaaaatgctcctcaggagatccag
gagtttctagcctggcagcgggaccttgagagtgacagtaaatgtcccagtcaggccaag
cccactgtgttccgttggacaggcgctggcaaagagatctttgtgtctggatcattcaac
aactgggccaccaagattcccctgaacaaaagccagaacaactttgcagcggttgtggac
ttgcctgagggagagcaccagtataaattctgtgtagatggacagtggaccctcgacccg
acaggggctgtgttgacgaccaaaactggcacggtcaataatgtcattcaggtgaagagg
actgactttgaggtgtttgatgccctcatgattgattctcaggaatgtgcagacatgtca
gacctctcgagttcccctccgggaccctaccagcaggacccatacataaccaagacgagc
gacaagctcaagaacccccccatcctgccaccacacttgctgcaagtcctactcaataag
gacactggcgtgtcttgtgacccagcccttcttccagagcccaaccatgtgatgctcaac
cacctctatgccctctccatcaaggatggggtgatggttcttagcgcaacccaccgctac
aaaaagaagtatgtgaccacacttttgtacaagccgatctaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112251091
Entry
112251091         CDS       T05605                                 

Definition
(RefSeq) 5'-AMP-activated protein kinase catalytic subunit alpha-2-like
  KO
K07198  5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04140  Autophagy - animal
otw04150  mTOR signaling pathway
otw04371  Apelin signaling pathway
otw04530  Tight junction
otw04910  Insulin signaling pathway
otw04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    112251091
   04068 FoxO signaling pathway
    112251091
   04150 mTOR signaling pathway
    112251091
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112251091
  09144 Cellular community - eukaryotes
   04530 Tight junction
    112251091
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112251091
   04920 Adipocytokine signaling pathway
    112251091
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112251091
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112251091
   03029 Mitochondrial biogenesis [BR:otw03029]
    112251091
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     112251091
Protein kinases [BR:otw01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   112251091
Membrane trafficking [BR:otw04131]
 Autophagy
  Other autophagy associated proteins
   Others
    112251091
Mitochondrial biogenesis [BR:otw03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    112251091
  Mitophagy factors
   Other mitophagy factors
    112251091
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr AdenylateSensor Kinase-like RIO1 Kdo APH
Other DBs
NCBI-GeneID: 112251091
NCBI-ProteinID: XP_024277553
LinkDB
Position
5
AA seq 597 aa
MRVVGLSSVPRTHLPLPHVALGSQRTAQRAQAYRSRLKMAERQQKHEGGRVKIGHYLLGD
TLGVGTFGKVKIGEHQLTGHKVAVKILNRQKIRSLDVVGKIKREIQNLKLFRHPHIIKLY
QVISTPTDFFMVMEYVSGGELFDYICKHGRVEDKEARRLFQQIISGVDYCHRHMVVHRDL
KPENVLLDHSKNAKIADFGLSNMMSDGEFLRTSCGSPNYAAPEVISGRLYAGPEVDIWSC
GVILYALLCGTLPFDDEHVPTLFKKIRGGVFYMPEYLTRPVASLLLLMLQVDPLKRATIK
DIREHEWFKQDLPGYLFPEDLSYDSTVLDEEAVREVCDKFESTESEVMSSLYSGDPQDQL
AVAYHLIIDNRRIMTQASEFYLASSPPQGSFMEDGIPLPPRVKPHPERMPPLLIDSPKAR
CPLDALNTTRAKPLAVKKAKWHLGIRSQSRPYDIMAEVYRAMRQLQYDWKVVNPYHLRVR
SKNPVTDNLVKMSLQLYQVDNRSYLLDFKSIDDDIMEAVGFKSGSSIPQRSGSTAGLHRP
RLSVDSALPAVDLPQLSSSLPGSLCSSAALITSTPRQGSHTMDFFEMCASLITTLAR
NT seq 1794 nt   +upstreamnt  +downstreamnt
atgagagtagttggcttgtccagtgtcccgcggacacacctccccctcccgcacgtcgcg
ctcggcagccagcggacagcgcagagagctcaagcctaccggagccgtttaaagatggca
gaacgacagcagaaacacgaaggcggccgagtgaagatcggacattatcttctcggagac
actctgggcgtcggcaccttcggcaaagtaaagattggagagcaccagttgacaggtcat
aaggtggcagtgaagatcctgaacagacagaaaatcaggagtctggatgtggtgggcaag
atcaaacgagaaatacagaacctcaaactattcagacaccctcatatcatcaaactgtac
caggtgatcagtactcctacagatttcttcatggtaatggagtatgtctcaggaggagag
ctgtttgactacatctgcaaacacggacgggtagaagacaaagaggctcgtcggttgttc
caacagatcatctcaggggtagactactgccacagacacatggtggtgcacagagacctc
aaacctgagaatgttctgctggaccattccaagaacgccaagatagctgactttgggttg
tcaaacatgatgtcagatggggagttcctgaggaccagctgtggatctcccaactacgct
gctcctgaagtcatctctggaaggttatatgctggccctgaagtggatatatggagctgt
ggtgtgatcctgtatgcgttgctgtgtgggactctaccctttgatgacgaacatgttccc
acgctgtttaagaagatcagagggggcgtgttctatatgccagaatacctcactcgccct
gtcgcctccctgctgctgctcatgctgcaggtcgacccattgaagagagccaccattaaa
gacattagggaacatgagtggtttaagcaggacctgccaggctacctgtttccagaggac
ctgtcttatgactccacggttctggacgaggaggccgtcagggaggtgtgcgacaagttt
gagagcaccgagtctgaggtgatgtccagcctgtacagcggagacccccaggaccagctg
gcggtagcataccatctgattatagataaccgtcgtatcatgacccaggccagtgagttc
tacctggcctccagccctccccagggctccttcatggaggatggcattcccctgcctccc
agggtcaaaccacacccagagaggatgccccccctgctgatagacagccctaaggcgcgc
tgcccgctggatgccctcaacaccaccagagccaaacccctggcagtgaagaaagccaag
tggcacctgggcatcaggagtcagagcagaccttatgacatcatggctgaggtctacagg
gctatgagacagctacagtatgactggaaggtggtgaacccgtaccacctgcgtgttcgg
agtaagaacccagtaacagacaacctggtgaagatgagtctccagctgtaccaggtggac
aacagatcctacctgctggacttcaagagcatcgatgatgacatcatggaggcagtaggg
tttaagtcaggttcttccatccctcagaggtcaggctccactgcagggctccatagaccc
agactcagtgtggactcagccttacctgccgtggatctcccccagctcagctcctccctg
cctgggtcgctgtgctccagtgctgccctcattacctccaccccgcgccagggcagccac
accatggacttctttgagatgtgtgccagtctcatcaccacactggcccgctag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112253920
Entry
112253920         CDS       T05605                                 

Definition
(RefSeq) 5'-AMP-activated protein kinase subunit gamma-1-like isoform X1
  KO
K07200  5'-AMP-activated protein kinase, regulatory gamma subunit
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04371  Apelin signaling pathway
otw04530  Tight junction
otw04910  Insulin signaling pathway
otw04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    112253920
   04068 FoxO signaling pathway
    112253920
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    112253920
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112253920
   04920 Adipocytokine signaling pathway
    112253920
SSDB
Motif
Pfam: CBS DUF3562 DHC_N1 Cbl_N3
Other DBs
NCBI-GeneID: 112253920
NCBI-ProteinID: XP_024281793
LinkDB
Position
7
AA seq 407 aa
MYPPLFCLRLTPDPTPIPLALCIPLETPAPNIDPTGLWDRQGERSLHVAGSSVYCWIMFQ
EMREELKNSEADAEMYMKFMKSHCCYEAIPTSCKLVIFDTTLQNILFLLNSAQIFSLHFP
RERSWSLLVKKAFFALVANGLRAAPLWDSKTQRFVGMLTITDFINILHRYYRSPLVQMNE
LERHQIGTWRDVYLQYSNHCLHSIAPDASLFDAIYSLLRYKIHRLPVIDPVSGNVLHILT
HKRILKFLHIFKKTVPKPCFMQKTIQDVGIGTFRNIATVQQTASVYDALSVFVERRVSAL
PVVNEQGKVVALYSRFDVINLAAQKTYNNLNMSMQEAIRRRCCFIEGVIKCLPDETLETI
IDRIIKAEVHRLVLVDKEDVCRGIISLSDLLQAMVLSPAGIDALLAS
NT seq 1224 nt   +upstreamnt  +downstreamnt
atgtacccaccccttttctgcctgcgcctcaccccagaccccacccccatccccttggcc
ctctgcataccacttgagactcctgctcctaatatagacccaactggtttgtgggacagg
cagggggagaggagcctgcatgtagcaggatctagcgtttattgttggatcatgtttcaa
gagatgcgtgaagaattgaagaattcagaggctgatgctgagatgtacatgaagttcatg
aaaagtcattgctgctatgaggccattccaaccagctgtaaactggtcatatttgacaca
acactacaaaacatactcttcctgctgaactcagcccagatattctccctccacttccca
agggaaaggtcatggtcccttttggtgaagaaagcctttttcgctcttgtagcaaacggc
ttgagagctgcacctctctgggatagcaagacacagaggtttgtgggtatgctgactata
acagatttcatcaacattctccatcgttactacaggtccccattggttcaaatgaacgag
ctggagaggcatcaaattggaacatggcgagatgtgtacctgcaatactccaaccactgt
cttcacagtatcgctccagacgccagcctcttcgacgccatctattccctactgaggtat
aagatccacagattgccggttatcgatcccgtgtccggaaatgtcttacacattctcacg
cacaagcgaatcctcaagtttctccatatatttaaaaagacagtcccaaaaccctgcttc
atgcagaagacgatccaggacgttgggatcgggacattccggaacattgccacggtccag
cagacggcctcagtctacgatgccctgtctgtgtttgtagagaggagggtctccgcactg
cctgtagtaaacgagcaaggcaaggtggtggctctctactccagatttgatgtgattaat
ctggctgcccagaagacgtacaacaacctgaacatgtccatgcaggaggccatccgacgg
cgctgctgtttcattgagggcgtcatcaagtgcctccccgacgagaccctggagaccatc
attgatcgcataattaaggctgaggtccatcggctggtcctggtggacaaagaggacgtg
tgcagggggatcatctctctctctgacctgctccaggccatggtgttaagcccggcaggt
attgacgcccttttagcctcttag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112254606
Entry
112254606         CDS       T05605                                 

Gene name
prkag1
Definition
(RefSeq) 5'-AMP-activated protein kinase subunit gamma-1
  KO
K07200  5'-AMP-activated protein kinase, regulatory gamma subunit
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04371  Apelin signaling pathway
otw04530  Tight junction
otw04910  Insulin signaling pathway
otw04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    112254606 (prkag1)
   04068 FoxO signaling pathway
    112254606 (prkag1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    112254606 (prkag1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112254606 (prkag1)
   04920 Adipocytokine signaling pathway
    112254606 (prkag1)
SSDB
Motif
Pfam: CBS Cbl_N3
Other DBs
NCBI-GeneID: 112254606
NCBI-ProteinID: XP_024283087
LinkDB
Position
7
AA seq 328 aa
MECIPLAVDDVDCKKEPLLGDPDYNVYTRFMKSHRCYDLVPTSSKLVVFDTSLQVKKAFF
ALVSNGVRAAPLWDSKKQCFVGMLTITDFINILHRYYKSPLVQIYELEEHKIETWREVYL
QDSFKPLVSISPNASLYDAVSSLLKNKIHRLPVVDPLTGNTLYILTHKRILKFLKLFISE
MAKPAFLGQTLEELGIGTFHKIAVVRSDTPLYTALGIFVDQRVSALPVVDDNGRVVDIYS
KFDVINLAAEKMYNNLDVTVTKALQHRSQYFEGVLTCNTHDTLESIINRLVEAEVHRLVV
VDEQEVVKGIVSLSDILQALVLTNEEAD
NT seq 987 nt   +upstreamnt  +downstreamnt
atggagtgtattccacttgctgttgatgatgtggattgtaaaaaggagccacttctagga
gacccagattataatgtctacacccggtttatgaagtctcatcggtgctatgacttggtc
cctaccagctccaagttggtggtgttcgatacttcactgcaggtaaagaaggcgtttttc
gctctggtgtccaatggggtgagagcagcgccactctgggacagtaagaagcagtgtttt
gtaggcatgctgaccatcacagactttatcaacatcctccatcgctactacaagtctcct
ttggtgcagatatatgagctggaggagcacaagatagagacatggagagaagtctacctt
caagactccttcaagcccctcgtcagcatatcccctaacgcaagtctgtatgatgctgta
tcgtctctgctgaagaataagatccacagactgcctgtggtcgaccctctgacagggaac
accctatacatcctcacgcacaagaggatcctgaagttcctcaagctctttatatcggag
atggcaaaacctgccttcttaggacagactctagaagagcttggcatcggaacattccat
aagattgcagtggtgcgttctgacacacccctctacacagcactgggaatctttgtggac
cagcgagtgtctgccttgcctgtcgtcgatgacaacggacgagtggtggacatttactcc
aaatttgatgtcattaacctagcagcagagaagatgtacaacaacctggatgtgactgtg
accaaagctttacagcaccgctctcagtattttgagggagtgctcacctgcaacacacac
gacacactggagtccatcatcaacagactggtggaggcagaggtgcacaggctggtggtg
gttgatgagcaggaggtggtgaagggcatcgtctctctctcagacatcctccaggcactg
gttctcactaatgaagaagcagactaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112260362
Entry
112260362         CDS       T05605                                 

Gene name
prkaa2
Definition
(RefSeq) LOW QUALITY PROTEIN: 5'-AMP-activated protein kinase catalytic subunit alpha-2
  KO
K07198  5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04140  Autophagy - animal
otw04150  mTOR signaling pathway
otw04371  Apelin signaling pathway
otw04530  Tight junction
otw04910  Insulin signaling pathway
otw04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    112260362 (prkaa2)
   04068 FoxO signaling pathway
    112260362 (prkaa2)
   04150 mTOR signaling pathway
    112260362 (prkaa2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112260362 (prkaa2)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    112260362 (prkaa2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112260362 (prkaa2)
   04920 Adipocytokine signaling pathway
    112260362 (prkaa2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112260362 (prkaa2)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112260362 (prkaa2)
   03029 Mitochondrial biogenesis [BR:otw03029]
    112260362 (prkaa2)
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     112260362 (prkaa2)
Protein kinases [BR:otw01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   112260362 (prkaa2)
Membrane trafficking [BR:otw04131]
 Autophagy
  Other autophagy associated proteins
   Others
    112260362 (prkaa2)
Mitochondrial biogenesis [BR:otw03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    112260362 (prkaa2)
  Mitophagy factors
   Other mitophagy factors
    112260362 (prkaa2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr AdenylateSensor Kinase-like RIO1 Kdo APH
Other DBs
NCBI-GeneID: 112260362
NCBI-ProteinID: XP_024291177
LinkDB
Position
1
AA seq 569 aa
MAERQQKHEGGRVKIGHYLLGDTLGVGTFGKVKIGEHQLTGHKVAVKILNRQKIRSLDVV
GKIKREIQNLKLFRHPHIIKLYQVISTPTDFFMVMEYVSGGELFDYICKHGRVEDKEARR
LFQQIISGVDYCHRHMVVHRDLKPENVLLDHSKNAKIADFGTLHTHVVKHDVSGEFLRTS
CGSPNYAAPEVSPEGVLYAGPEVDIWSVGVILYALLCGTLPFDDEHVPTLFKKIRGGVFY
MPEYLTRPVASLLLXLLQVDPLKRATIKDIREHEWFKQDLPGYLFPEDPSYDSTILDEEA
VREVCDKFESTESEVMSSLYSGDPQDQLAVAYHLIIDNRRIMTQASEFYLASSPPQGSFM
EDGMSLPPGVKPHPERMPPLLVDSPKARCPLDALNTTRAKPLAVKKAKWHLGIRSQSRPY
DIMAEVYRAMRQLQYDWKVVNPYHLRVRRKNPVTGNLVKMCLQLYQVDNRSYLLDFKSID
DDIMDAVGFKSGSSTPQRSGSTAGLHRPRLSVDSACPAVDLPKLSSSLPGSLCSSAALLT
STSTPTPRQGSHTMDFFEMCASLITTLAR
NT seq 1710 nt   +upstreamnt  +downstreamnt
atggcagaacgacagcagaaacatgaaggcggccgagtgaagatcggacattacctctta
ggagacactctgggcgtcggcacattcggcaaagtaaagattggagaacaccagttgaca
ggtcataaggtggcagtgaagatcctgaacagacagaagatcaggagtctggacgtggtg
ggcaagatcaaacgagagatacagaacctcaaactcttcagacaccctcacatcatcaaa
ctgtaccaggtgatcagtactcctacagatttcttcatggtgatggagtatgtctcagga
ggagagctgtttgactacatctgcaaacatggacgggtagaggacaaagaggctcgtcgg
ttgttccagcagattatctccggtgtagactactgccacagacacatggtggtgcacaga
gacctcaaacctgagaatgtactgctggaccattccaagaacgccaaaatagctgacttt
ggtacactacacacacatgttgtcaaacatgatgtcagtggggagttcctgaggaccagc
tgtggatctcccaactacgcagctcctgaagtatctccggaaggtgtgttatacgctggt
cctgaggtggacatatggagcgttggtgtgatcctgtatgcgttgctgtgtgggactctg
ccctttgatgacgaacacgttcccacactgtttaagaagattagagggggcgtgttctat
atgccagaatacctcactcggcccgttgcttccctgctgctgnctctgctgcaggtcgac
ccgctcaagagggctaccattaaagacattagggaacatgagtggtttaagcaggacctg
ccaggctacctgtttcctgaggacccttcctatgactccaccattctggatgaggaggca
gtccgagaggtgtgtgacaagtttgagagcaccgagtctgaggtgatgtccagcctgtac
agcggagaccctcaggaccagctagcggtagcgtaccatctgatcatagacaaccggcgc
atcatgacccaggccagtgagttctacctggcctctagccctccccagggctccttcatg
gaggatggcatgtcactgccccccggggtcaaaccacacccagagaggatgccccccctg
ctggtagacagtcccaaggcgcgctgcccgctggatgccctgaacaccaccagagccaaa
cccctggcagtgaagaaagccaagtggcacctgggcatcaggagtcagagcagaccctat
gacatcatggctgaggtctacagggctatgagacagctacagtatgactggaaggtggtg
aacccgtaccacctgcgtgttcggaggaagaacccagtaacaggcaacctggtgaagatg
tgtctccagctgtaccaagtagacaacagatcctacctgctggacttcaaaagcatcgat
gatgacatcatggacgcagtagggtttaagtcaggctcttccaccccccaacggtcaggc
tccactgcagggctccacagacccagactcagtgtggactcagcctgtcctgctgtggat
ctccccaagctcagctcctctctgcctgggtcactgtgctccagcgctgccctcctcacc
tccacctccacccccaccccgcgccagggcagccacactatggacttctttgagatgtgt
gccagtctcatcaccacgctggcccgctag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112260549
Entry
112260549         CDS       T05605                                 

Definition
(RefSeq) 5'-AMP-activated protein kinase subunit gamma-1-like isoform X1
  KO
K07200  5'-AMP-activated protein kinase, regulatory gamma subunit
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04371  Apelin signaling pathway
otw04530  Tight junction
otw04910  Insulin signaling pathway
otw04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    112260549
   04068 FoxO signaling pathway
    112260549
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    112260549
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112260549
   04920 Adipocytokine signaling pathway
    112260549
SSDB
Motif
Pfam: CBS
Other DBs
NCBI-GeneID: 112260549
NCBI-ProteinID: XP_024291514
LinkDB
Position
10
AA seq 555 aa
MGSTVMESNKKDMKTSKKKRTLRLNMPDVSAFAFPILDGKSGGSGKDGYPNGEVCSHSVS
PTKGLFVRGGPAGVSQPSSPMAAHSQSRNSPGSSRTISPYLSTHQVPSPPKSPLCLSFSG
IFRSSPNSSSNSSIKLFSRTRKVSGISSSPTPPSTPSLHMLFPQEVHQSAPERLERSLSS
PPPDTGQRLSLPSSAKPPMSSSFPIPYAFPLPQATSQPNFYGLFEGMLEKLDLNDDGVAA
EPDRDIYMRFMKSHCCYDIVPTSSKLVVFDTGLQVKKAFFALVANGVRAAPLWDSERQCF
VGMLTITDFIIILHRYYKSPLVQIYELEDHKLETWREVYLQETFKPLVNISPESSIFDAV
YSLIKNKIHRLPVIDPVTGNPLYILTHKRILKFLQLFVREMPKPAFMKQTLGELGIGTYK
NIAFIHPDTPIIKALQIFVERRVSALPVVDVSGKVVDIYSKFDVINLAAEKTYNNLDITV
TQALRHRCQYFEGVMQCHKLDTLETIVDKIVKAEVHRLVVVDDRSAIEGIISLSDILQAL
VLSPADACREEGLLE
NT seq 1668 nt   +upstreamnt  +downstreamnt
atgggaagcaccgtgatggagtccaacaagaaggatatgaaaacctcgaagaaaaagaga
acactacgcctaaatatgccagatgtaagtgctttcgccttccccatactggacggcaag
tctggaggctcgggcaaggatggctatccaaatggagaggtctgcagccactctgtcagc
ccaactaaaggactctttgtgaggggtggtcctgctggtgtcagccaaccctccagtccc
atggctgcccactctcagtcccggaacagccctggctcatccagaaccatttccccctac
ctctccacccaccaggtcccctcaccacccaaatcccccctttgcctcagcttcagtggt
atattccgctcttcgcccaactcatcatccaactctagcatcaagctcttttctaggacc
aggaaagtctccggcatctcgtcttcccccaccccacccagcacccccagcctgcacatg
ctgttcccccaggaggttcaccagagtgccccagagcgcctggaacgctccctctcatca
cccccaccagacaccggacagcgcctcagcctgccgtcctctgccaagccccccatgtcc
tcctcctttccgataccctacgctttcccactgccccaagctacctcacagccaaatttc
tacggtttattcgaaggcatgctggagaaacttgacctaaacgatgatggtgttgctgct
gaaccagacagagatatttacatgcgctttatgaagtcccactgctgctatgacatcgtt
cccaccagctccaagctggtcgtgttcgacacgggcctacaggtgaagaaggcgttcttt
gccttagtggccaatggggtgcgtgctgccccactatgggattcagagaggcagtgtttt
gtgggaatgttgaccatcacagacttcatcatcatactacacagatactacaagtcaccg
ttggtgcaaatatatgagttggaagatcataagcttgagacatggagagaagtatatttg
caagagacattcaagcctttagtgaacatatcacccgaatcaagcatatttgatgcagtg
tattccctcattaaaaacaagatccaccggctgcctgtcatcgaccctgtgacggggaac
ccactttacatcctcacacacaagaggatcctcaagttcctacagctctttgtgcgtgag
atgcccaagccggcttttatgaagcagactctcggagagctgggcatcggcacctacaag
aacatagccttcatccaccctgacacacccatcatcaaggccctgcagatcttcgtagag
aggagggtgtctgccctgcctgttgtggacgtatctgggaaagtggtggatatttactcc
aaatttgatgtcataaacctggcagcagagaagacttataataacctggacatcacagtg
acccaggctctgaggcatcgctgccagtactttgagggggtcatgcaatgccacaagctg
gatacactggagaccatcgtggacaagattgtcaaagcagaggtccaccggctggtagtg
gtggatgatcgctcggccattgagggcatcatctccctgtctgacatcctgcaggccctg
gtgctcagcccagcagatgcctgcagagaggagggcctcctggagtga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112260862
Entry
112260862         CDS       T05605                                 

Definition
(RefSeq) 5'-AMP-activated protein kinase subunit beta-2-like
  KO
K07199  5'-AMP-activated protein kinase, regulatory beta subunit
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04371  Apelin signaling pathway
otw04530  Tight junction
otw04910  Insulin signaling pathway
otw04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    112260862
   04068 FoxO signaling pathway
    112260862
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    112260862
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112260862
   04920 Adipocytokine signaling pathway
    112260862
SSDB
Motif
Pfam: AMPK1_CBM AMPKBI CBM_48
Other DBs
NCBI-GeneID: 112260862
NCBI-ProteinID: XP_024291992
LinkDB
Position
10
AA seq 264 aa
MGNTGDRMSGDRHGAKAHRSDSRDKDHEPSKMVDSTDDPNIFNTHGLGSSKVSDKEEPDL
DDLVKTGPQSRPTVIRWAGGGKEVYIAGSFNNWGNKIHLNKSHNDFVAILDLPEGEHQYK
FFVDGQWVHDPSEPVVTSQLGTINNLIEVKQSDFEVFDALQVDSLESTDTSDLSSSPPGP
YGQEQYMFRPEERSKAPPILPPHLLQVILNKDTNISCDPALLPEPNHVMLNHLYALSIKD
GVMVLSATHRYKKKYVTSLLYKPI
NT seq 795 nt   +upstreamnt  +downstreamnt
atgggtaacacaggcgaccggatgtccggagaccgccatggcgccaaggcccatcgctct
gacagcagagacaaagaccacgagcccagcaagatggtggacagcactgatgaccctaac
atcttcaacacacacggtctggggtcctccaaggtgtcggacaaggaggagcccgacctg
gatgacctggtgaagaccgggcctcagtccaggcccacggtcatccgctgggccggagga
gggaaggaggtttacatcgctggatcctttaacaactggggcaacaagatccacctcaat
aagagccacaatgactttgtagcgatcctggacttgccagagggagagcaccagtacaag
ttctttgtggacggacagtgggttcatgacccctcagagcctgtggtgaccagccagttg
ggcaccatcaacaacctgatcgaggtgaagcagtcagactttgaggtgtttgatgctctg
caggtggactctctggagtctaccgacacctcagacctgtccagctcccctccaggtccc
tatggacaggagcagtacatgttcaggcctgaggaacgctccaaagccccgcccatcctc
cccccacacctcctccaggtcatcctcaacaaggacactaacatctcttgcgacccagcc
ttgctgcctgaacccaaccatgtgatgctcaaccatctgtatgcgctctcaataaaggat
ggagtgatggtactcagtgcgactcacagatataagaagaagtatgtcacatctctgctc
tacaagcccatctaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112266595
Entry
112266595         CDS       T05605                                 

Definition
(RefSeq) 5'-AMP-activated protein kinase subunit gamma-1-like isoform X1
  KO
K07200  5'-AMP-activated protein kinase, regulatory gamma subunit
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04371  Apelin signaling pathway
otw04530  Tight junction
otw04910  Insulin signaling pathway
otw04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    112266595
   04068 FoxO signaling pathway
    112266595
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    112266595
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112266595
   04920 Adipocytokine signaling pathway
    112266595
SSDB
Motif
Pfam: CBS DUF3562 DHC_N1 Cbl_N3
Other DBs
NCBI-GeneID: 112266595
NCBI-ProteinID: XP_024299969
LinkDB
Position
14
AA seq 407 aa
MYPPLFCLRLTPDPTPIPLALCIPLETPAPNIDPTGLWDRQGERSLHVAGSSVYCWIMFQ
EMREELKNSEADAEMYMKFMKSHCCYEAIPTSCKLVIFDTTLQNILFLLNSAQIFSLHFP
RERSWSLLVKKAFFALVANGLRAAPLWDSKTQRFVGMLTITDFINILHRYYRSPLVQMNE
LERHQIGTWRDVYLQYSNHCLHSIAPDASLFDAIYSLLRYKIHRLPVIDPVSGNVLHILT
HKRILKFLHIFKKTVPKPCFMQKTIQDVGIGTFRNIATVQQTASVYDALSVFVERRVSAL
PVVNEQGKVVALYSRFDVINLAAQKTYNNLNMSMQEAIRRRCCFIEGVIKCLPDETLETI
IDRIIKAEVHRLVLVDKEDVCRGIISLSDLLQAMVLSPAGIDALLAS
NT seq 1224 nt   +upstreamnt  +downstreamnt
atgtacccaccccttttctgcctgcgcctcaccccagaccccacccccatccccttggcc
ctctgcataccacttgagactcctgctcctaatatagacccaactggtttgtgggacagg
cagggggagaggagcctgcatgtagcaggatctagcgtttattgttggatcatgtttcaa
gagatgcgtgaagaattgaagaattcagaggctgatgctgagatgtacatgaagttcatg
aaaagtcattgctgctatgaggccattccaaccagctgtaaactggtcatatttgacaca
acactacaaaacatactcttcctgctgaactcagcccagatattctccctccacttccca
agggaaaggtcatggtcccttttggtgaagaaagcctttttcgctcttgtagcaaacggc
ttgagagctgcacctctctgggatagcaagacacagaggtttgtgggtatgctgactata
acagatttcatcaacattctccatcgttactacaggtccccattggttcaaatgaacgag
ctggagaggcatcaaattggaacatggcgagatgtgtacctgcaatactccaaccactgt
cttcacagtatcgctccagacgccagcctcttcgacgccatctattccctactgaggtat
aagatccacagattgccggttatcgatcccgtgtccggaaatgtcttacacattctcacg
cacaagcgaatcctcaagtttctccatatatttaaaaagacagtcccaaaaccctgcttc
atgcagaagacgatccaggacgttgggatcgggacattccggaacattgccacggtccag
cagacggcctcagtctacgatgccctgtctgtgtttgtagagaggagggtctccgcactg
cctgtagtaaacgagcaaggcaaggtggtggctctctactccagatttgatgtgattaat
ctggctgcccagaagacgtacaacaacctgaacatgtccatgcaggaggccatccgacgg
cgctgctgtttcattgagggcgtcatcaagtgcctccccgacgagaccctggagaccatc
attgatcgcataattaaggctgaggtccatcggctggtcctggtggacaaagaggacgtg
tgcagggggatcatctctctctctgacctgctccaggccatggtgttaagcccggcaggt
attgacgcccttttagcctcttag

DBGET integrated database retrieval system