KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112215378
Entry
112215378         CDS       T05605                                 

Definition
(RefSeq) serine/threonine-protein kinase Sgk3-like isoform X1
  KO
K13304  serum/glucocorticoid-regulated kinase 3 [EC:2.7.11.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112215378
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112215378
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112215378
Protein kinases [BR:otw01001]
 Serine/threonine kinases: AGC group
  SGK family [OT]
   112215378
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PX Pkinase_C Kinase-like FTA2 Kdo
Other DBs
NCBI-GeneID: 112215378
NCBI-ProteinID: XP_024230143
LinkDB
Position
16
AA seq 493 aa
MEEQSSCPNVSIPCCPNVSIPCYNEQRDKKKRYTVYKVMVNVGRHEWFVFRRYAEFDKLY
NTLRKQFPSLNLKIPPKRIFGDNFDPEFIKQRRTGLHEFIQRLVSHPQLRNQPDVRAFLQ
MDKSQNFSDPSEDEDDKNGSTSRNINLGPSGNPHAKPTDFDFLKVIGKGSFGKVLLAKRK
LDGKYYAIKVLQKRVILNRREQKHIMAERNVLLKNMKHPFLVGLHYSFQTTDKLYFVLDF
VNGGELFFHLQKEQTFPEPRAKFYIAEMASALGYLHSLNIVYRDLKPENILLDSEGHIVL
TDFGLCKEGISQAETTSTFCGTPEYLAPEVLRKQPYDNTVDWWCLGSVLYEMLFGLPPFY
SRDTHEMYDNILHKPLRMRPGASNTAWSLLQALLEKDGTHRLGSRDDFNEIKAHYFFSEI
NWDDLEQRKVPPPFTPNVNSPHDITNFDPEFTGETVTNSVCYTEDSIVNAIVMEADDAFL
GFSYAPPSDDSFL
NT seq 1482 nt   +upstreamnt  +downstreamnt
atggaggagcagtccagctgccccaatgtcagcattccctgctgccccaatgtcagcatt
ccctgctacaacgagcagagggacaagaagaagcgctacactgtttacaaagtgatggtc
aatgtaggaagacatgagtggtttgtcttcaggcgatacgcagagtttgacaagctctac
aacacattgaggaaacagtttccatctttgaacttgaaaatcccacccaagagaatattt
ggggacaactttgacccagagtttatcaagcaaagaagaacaggtttacatgagttcatt
cagagactggtctcacatcctcagctcagaaaccagcctgatgtcagagcattcctgcag
atggacaaatctcaaaacttctcagacccatcagaagacgaagatgacaagaacggctct
acctccagaaatattaacctgggaccgtctggaaatccacatgcaaagcccacagacttt
gactttctcaaagtcattggaaaagggagctttggaaaggttctccttgctaagcggaaa
ctggacggaaagtattacgcaatcaaggtcctgcagaaaagggtcatcctcaacaggaga
gagcaaaaacacatcatggcggagcgcaatgtgctactgaagaacatgaaacaccctttc
ctggttggcttgcattattccttccagacgactgacaagttgtacttcgtcttggatttt
gtcaacgggggagaactcttcttccatcttcaaaaagaacagacttttccggaacccaga
gccaagttctacatcgcagaaatggcaagcgcactgggctatctgcattctcttaatata
gtttacagggatttgaagccagaaaatatccttctcgactctgaaggacatatagttttg
actgacttcgggttgtgcaaggaaggcatttcccaagccgagacgacaagcacattttgt
gggacacccgagtacctagctccagaggtcctgaggaaacaaccgtatgacaacacagtg
gactggtggtgtctgggatcagtgctctatgaaatgctctttggcctgcctccgttctac
agcagagacacccatgagatgtatgacaacatccttcacaagcccctgaggatgcgtccc
ggagcgtcaaacacggcctggtccctcctgcaggctctactggagaaggacggcacacac
agactgggctccagagatgattttaatgagatcaaagcgcactacttcttctcagagatc
aactgggatgacctggaacagaggaaggttccacctccattcactcccaatgtgaattct
cctcatgacatcacaaactttgatccagaattcacaggcgagactgttacgaactctgtg
tgctatactgaagattccatagtcaacgccatcgtgatggaggctgacgatgccttccta
ggtttctcctatgcaccaccctcagatgactcctttctatga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112215824
Entry
112215824         CDS       T05605                                 

Definition
(RefSeq) serine/threonine-protein kinase Sgk2-like
  KO
K13303  serum/glucocorticoid-regulated kinase 2 [EC:2.7.11.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112215824
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112215824
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112215824
Protein kinases [BR:otw01001]
 Serine/threonine kinases: AGC group
  SGK family [OT]
   112215824
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_C Kdo FTA2 APH
Other DBs
NCBI-GeneID: 112215824
NCBI-ProteinID: XP_024231010
LinkDB
Position
16
AA seq 362 aa
MANCNPLRSPSSALSEVNLGPSANPHAKPTDFDFLAVIGKGTYGKVLLAKLKADNKFYAV
KVLQKKVILKKKEQKNIMAERNVLLKSLKHPFLVGLHYSFQTPEKLYFVLDYVNGGEIFF
HLQRERCFLEPRARFYAAEVASAIGYLHSLNIVYRDLKPENILLDSQGHVVLTDFGLCKE
GVEPETTTSTFCGTPEYLAPEILRKEPYDRTVDWWCLGAVLYEMIYSLPPFYSRDMSELY
DGILHKPLPLPPGKSDAVCSLLQGLLQKDQHCRLGAIDDFLEIKNHVFFSPINWDDLYHK
RITPPYYPNVKGPADTQHIDPEFTREMVPNSVGRTPELNASTSSNSAFNGFSYVCGEEDS
FL
NT seq 1089 nt   +upstreamnt  +downstreamnt
atggcgaattgtaatccacttagatcaccgtcctccgccctcagtgaggtcaacctggga
ccctcggcaaacccacatgccaagcccactgactttgacttcttggctgttattggaaaa
gggacctatgggaaggtcctgctcgccaagctcaaagctgacaacaaattctatgcggtc
aaagttttacagaagaaagtcatcctgaagaaaaaggagcaaaagaacatcatggcagag
aggaacgtgctgctgaagagcctgaagcaccctttcctggtgggcctccactactccttc
cagaccccagagaagctctactttgtcctggactatgtcaacgggggagagattttcttc
cacctgcagagggagcggtgcttcttggagccgagggctcggttctatgctgccgaggtt
gccagtgccatcggctaccttcactccctcaacatcgtttacagagatttaaagccagag
aatattctcttagactctcagggccacgtggtgcttacggactttgggctgtgtaaagag
ggtgtggagccggagaccaccacgtccactttctgtggaacccccgagtatttggcccct
gagattctgcgtaaggagccctatgaccgcactgtggactggtggtgtctgggagctgtg
ctctatgagatgatctatagtcttcctcctttttacagccgggacatgtctgagctgtat
gatggtatcctgcacaagcctctgcctctgcccccagggaagtcagacgctgtctgtagt
ctgctccagggcctcctgcagaaagaccagcactgcaggctgggagccatcgacgacttt
ttagaaatcaagaaccatgtgttcttctccccgattaactgggatgacctgtaccacaag
cggatcactcctccatactaccccaatgtgaaagggccagcagacacgcagcacatagac
ccagagttcaccagggagatggtgcctaactcggtgggtcgcacccctgagctgaacgcc
agcaccagcagcaacagcgccttcaatggcttctcctacgtctgtggtgaagaagacagc
ttcctctaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112222127
Entry
112222127         CDS       T05605                                 

Definition
(RefSeq) serine/threonine-protein kinase Sgk2-like
  KO
K13303  serum/glucocorticoid-regulated kinase 2 [EC:2.7.11.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112222127
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112222127
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112222127
Protein kinases [BR:otw01001]
 Serine/threonine kinases: AGC group
  SGK family [OT]
   112222127
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_C Kdo FTA2 APH
Other DBs
NCBI-GeneID: 112222127
NCBI-ProteinID: XP_024240521
LinkDB
Position
22
AA seq 361 aa
MANSNPLRSPSSTLSEVNLGPSANPHAKPTDFDFLAVIGKGTFGKVLLAKLKADNKFYAV
KVLQKKVILKKKEQKNIMAERNVLLKSLKHPFLVGLHYSFQTPEKLYFVLDYVNGGELFF
HLQRERCFLEPRARFYAAEVASAIGYLHSLNIVYRDLKPENILLDSQGHVVLTDFGLCKE
GVEPETTTSTFCGTPEYLAPEVLRKEPYDRTVDWWCLGAVLYEMIYSLPPFYSRDVSEMY
DGILHKPLPLPPGKSGALCSLLQGLLQKDQHRRLGAIADFLQIKNHVFFSPINWDDLYHK
RITPPYNPNVKGPADTQHIDPEFTREMVPNSVGCTPELNAGTSSSNAFNGFSYVSGEDSF
L
NT seq 1086 nt   +upstreamnt  +downstreamnt
atggcaaattctaatccacttagatcaccatcctccaccctcagtgaggtcaacctggga
ccttcagcaaacccacatgccaagcccactgactttgactttttggctgttattggaaaa
gggacctttgggaaggtcctgctcgccaagctcaaagctgacaataaattctatgctgtg
aaagttctacagaagaaagtaatcctgaagaaaaaggagcaaaagaacatcatggcagag
aggaacgtgctgctgaagagcctgaagcatcctttcctggtgggcctccactactccttc
cagaccccagagaagctctactttgtcctcgactatgtcaacgggggagagctcttcttc
cacctgcagagggagcggtgcttcttggagccgagggctcggttctatgctgctgaggtt
gccagtgccatcggctaccttcactccctcaacatcgtttacagagatctgaagccagag
aacattcttttagactctcagggccatgtggtacttacagactttgggctgtgtaaagag
ggagtggagccagagaccaccacgtccactttctgtggaacccctgagtatttggcccct
gaggttctgcgtaaggagccctatgaccgcacagtggactggtggtgtctgggagctgtg
ctctatgagatgatctatagtcttcccccgttctacagccgggacgtgtctgagatgtac
gatggcatcctacacaagcctctgccgctgcccccagggaagtcaggcgctctctgtagt
ctgctccagggcctcctgcagaaagaccaacaccgcaggttgggagccattgctgacttt
ctacaaataaagaaccatgtgttcttctccccgattaactgggatgatctgtaccacaag
agaatcactcctccatacaaccccaatgtgaaagggccagcggacacacagcacatagac
ccagagttcaccagagagatggtgcctaactcagtgggctgcacccctgagctcaacgcc
ggcaccagcagctctaacgcattcaatggcttctcctacgtttctggtgaagacagcttc
ctttga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112227721
Entry
112227721         CDS       T05605                                 

Definition
(RefSeq) serine/threonine-protein kinase Sgk3-like
  KO
K13304  serum/glucocorticoid-regulated kinase 3 [EC:2.7.11.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112227721
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112227721
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112227721
Protein kinases [BR:otw01001]
 Serine/threonine kinases: AGC group
  SGK family [OT]
   112227721
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PX Pkinase_C Kinase-like FTA2 Kdo
Other DBs
NCBI-GeneID: 112227721
NCBI-ProteinID: XP_024248322
LinkDB
Position
29
AA seq 485 aa
MEEQSSFPNVSIPCYNEQRDKKKRYTVYKVMVNVGRHEWFVFRRYAEFDKLYNTLRKQFP
SLNLKIPAKRIFGDNFDPEFIKQRRTGLHEFIQRLVSHPQLSIQPDVRAFLQMDKSQNFS
DASEDEDDKNSSTSGNINLGPSGNPHAKPTDFDFLKVIGKGSFGKVLLAKRKLDGKYYAI
KVLQKRVILNRREQKHIMAERNVLLKNVKHPFLVGLHYSFQTTDKLYFVLDFVNGGELFF
HLQKERTFPEPRAKFYIAEMASALGYLHSLNIVYRDLKPENILLDFEGHIVLTDFGLCKE
GISQAETTSTFCGTPEYLAPEVLRKQPYDNTVDWWCLGSVLYEMLFGLPPFYSRDTHEMY
ENILHKPLMMRPGASNTAWSLLQALLEKDGTHRLGSRDDFNEIKAHNFFSAIKWDDLEQR
KVPPPFTPNVNSPYDITNFDPEFTDETVPNSVCYTEHAIVNASVMEADDAFLGFSYAPPS
DDSFL
NT seq 1458 nt   +upstreamnt  +downstreamnt
atggaggagcagtccagcttccccaatgtcagcatcccctgctacaacgagcagagggac
aagaagaagcgctacactgtttacaaagtgatggtcaacgtaggaagacatgagtggttt
gtcttcaggcgatacgcagagtttgacaagctctacaacacattgaggaaacaatttcca
tctttgaacttgaaaatcccagctaagagaatatttggggacaactttgacccagagttt
atcaagcaaagaagaacgggtttacatgagttcattcagagactggtctcacatcctcag
cttagtatccagcctgatgtcagagcattcttgcagatggacaaatctcaaaacttctca
gacgcatccgaggacgaagatgacaagaacagctctacctccggaaatattaacctggga
ccgtctggaaatccacatgcaaagcccacagactttgactttctcaaagtcatcggaaag
gggagctttggaaaggttctccttgcaaaacggaaactggacgggaagtattacgcaatc
aaggtcctgcagaaaagggtcattctcaacaggagagagcaaaaacacatcatggcggag
cgcaacgtgctactgaagaatgtaaaacacccattcctggtcggcttgcattattccttc
cagacgacagacaagttgtacttcgtcttagatttcgtcaacgggggagaacttttcttc
catcttcaaaaagaacggacctttccggaacccagagccaagttctacatcgcagaaatg
gcaagcgcactgggctatctgcattctctcaacatagtttacagggacttgaagccagaa
aatatccttctcgactttgaaggacatatagttttgacggacttcggattgtgcaaggaa
ggtatttcccaagccgagacgacaagtacattttgtgggacacctgagtacctagctcca
gaggtcctgaggaaacaaccgtatgacaacacagtggactggtggtgtctaggatcagtg
ctctatgaaatgctctttggcctgcctccgttctacagcagagacacccatgagatgtat
gaaaacatcctccacaaacccctgatgatgcgtcccggagcgtccaacacggcctggtcc
ctcctgcaggctctactggagaaggacggcacacacagactgggctccagagacgacttt
aatgagatcaaagcacataacttcttctctgcgatcaagtgggatgacctggaacagaga
aaggttccacctccattcactcccaatgtgaattctccttacgacatcacaaactttgat
ccagaattcacagatgagaccgttccaaactctgtgtgctatactgaacatgccatagtc
aacgccagtgtaatggaggctgatgatgcgttcctagggttttcctacgcacccccctca
gatgactccttcctatga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112229574
Entry
112229574         CDS       T05605                                 

Definition
(RefSeq) serine/threonine-protein kinase Sgk1-like isoform X1
  KO
K13302  serum/glucocorticoid-regulated kinase 1 [EC:2.7.11.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112229574
   04150 mTOR signaling pathway
    112229574
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112229574
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112229574
Protein kinases [BR:otw01001]
 Serine/threonine kinases: AGC group
  SGK family [OT]
   112229574
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_C Kdo APH PX Baseplate
Other DBs
NCBI-GeneID: 112229574
NCBI-ProteinID: XP_024251264
LinkDB
Position
31
AA seq 425 aa
MAVTKAPCDLSYCKMRGIVSVLTAFIKERKIGLNDFISRLVSNPHMCQHSEVDFLKIDEN
QNEKLDNAELLNPMLLTSPRSSLAEELAIKPCDFDYLKIIGKGSFGKVLLARHRESNEYY
AVKVLQKKIILKKKEQKHIMAERSVLMKNIKHPFLVGLHYSFQTTDKLYFVLDYVNGGEL
FYHLQRERVFLEPRARFYAAEIASALGYLHSLHIVYRDLKPENILLDSAGHIVLTDFGLC
KEGLAPTGTTSTFCGTPEYLAPEVLQKQAYDRTVDWWCLGSVLYEMLYGLPPFYSRNTAE
MYNNILNKPLVLKPNVSNAGRELLEGLLQKDRTKRLGVKDDFMELKFHTFFSPINWDDLM
ARNITPPYIPSVSGPTDLRHFDPEFTHLPVTSSLCNTDGLLVTSSIKEAAGAFPGFSYGP
ADSFM
NT seq 1278 nt   +upstreamnt  +downstreamnt
atggctgttaccaaggctccatgtgacttgtcttattgcaaaatgagaggaattgtgtca
gtcctcactgctttcatcaaggagaggaaaattggacttaacgacttcatatcgaggctg
gtgtcaaacccacatatgtgtcaacactctgaagttgacttcctcaagatcgatgagaac
cagaatgagaagctggacaatgctgagctcttaaatccgatgctactgacctcccccaga
agctcactagctgaagagctggcgatcaaaccatgtgatttcgactacctgaaaatcatc
ggcaaagggagctttgggaaggtgctgctggctcgacacagggagagcaacgagtattac
gccgtcaaggttctacagaagaaaatcatcctgaagaagaaagaacaaaagcatataatg
gcggaacgaagtgtcctgatgaagaatatcaaacatcctttcctggtggggctgcactat
tccttccagactactgacaagctgtactttgtgcttgactatgtgaatggaggagagctg
ttctatcatctacagagagagagggtgttcctagaacccagagccaggttctacgctgca
gagatcgccagtgctctgggatacctccattccctgcatattgtttacagagatctgaag
cctgagaatatcctgctagactctgcgggccacatcgtcctgacagactttggcctttgc
aaagagggccttgcacccactgggaccaccagcaccttctgtggaaccccagagtacctg
gcccccgaggtgctgcagaagcaggcatacgaccgaaccgtggattggtggtgcctggga
tccgtgctttacgagatgctctatggactgccccccttctacagccgcaacacagctgag
atgtacaacaatatcctgaacaagcctctcgtactgaagcccaacgtgtccaacgcaggc
agagaactgttggaggggctcctgcaaaaggaccgcactaagaggctgggagtgaaagat
gattttatggaactgaagttccacaccttcttttcacccatcaactgggatgacctgatg
gcaaggaacatcacaccaccctacattccctcagtgagcgggcctacggacctcaggcac
tttgacccagagttcacccacctccctgtgacctcatctctgtgcaacacggacggcctg
ctggtgactagcagcatcaaggaggcagctggggccttcccaggcttctcctatggaccc
gctgacagcttcatgtga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112233608
Entry
112233608         CDS       T05605                                 

Definition
(RefSeq) serine/threonine-protein kinase Sgk3-like
  KO
K13304  serum/glucocorticoid-regulated kinase 3 [EC:2.7.11.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112233608
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112233608
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112233608
Protein kinases [BR:otw01001]
 Serine/threonine kinases: AGC group
  SGK family [OT]
   112233608
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PX Pkinase_C Kinase-like FTA2 Kdo
Other DBs
NCBI-GeneID: 112233608
NCBI-ProteinID: XP_024257126
LinkDB
Position
Unknown
AA seq 485 aa
MEEQSSFPNVSIPCYNEQRDKKKRYTVYKVMVNVGRHEWFVFRRYAEFDKLYNTLRKQFP
SLNLKIPAKRIFGDNFDPEFIKQRRTGLHEFIQRLVSHPQLSIQPDVRAFLQMDKSQNFS
DASEDEDDKNSSTSGNINLGPSGNPHAKPTDFDFLKVIGKGSFGKVLLAKRKLDGKYYAI
KVLQKRVILNRREQKHIMAERNVLLKNVKHPFLVGLHYSFQTTDKLYFVLDFVNGGELFF
HLQKERTFPEPRAKFYIAEMASALGYLHSLNIVYRDLKPENILLDFEGHIVLTDFGLCKE
GISQAETTSTFCGTPEYLAPEVLRKQPYDNTVDWWCLGSVLYEMLFGLPPFYSRDTHEMY
ENILHKPLMMRPGASNTAWSLLQALLEKDGTHRLGSRDDFNEIKAHNFFSAIKWDDLEQR
KVPPPFTPNVNSPYDITNFDPEFTDETVPNSVCYTEHAIVNASVMEADDAFLGFSYAPPS
DDSFL
NT seq 1458 nt   +upstreamnt  +downstreamnt
atggaggagcagtccagcttccccaatgtcagcatcccctgctacaacgagcagagggac
aagaagaagcgctacactgtttacaaagtgatggtcaacgtaggaagacatgagtggttt
gtcttcaggcgatacgcagagtttgacaagctctacaacacattgaggaaacaatttcca
tctttgaacttgaaaatcccagctaagagaatatttggggacaactttgacccagagttt
atcaagcaaagaagaacgggtttacatgagttcattcagagactggtctcacatcctcag
cttagtatccagcctgatgtcagagcattcttgcagatggacaaatctcaaaacttctca
gacgcatccgaggacgaagatgacaagaacagctctacctccggaaatattaacctggga
ccgtctggaaatccacatgcaaagcccacagactttgactttctcaaagtcatcggaaag
gggagctttggaaaggttctccttgcaaaacggaaactggacgggaagtattacgcaatc
aaggtcctgcagaaaagggtcattctcaacaggagagagcaaaaacacatcatggcggag
cgcaacgtgctactgaagaatgtaaaacacccattcctggtcggcttgcattattccttc
cagacgacagacaagttgtacttcgtcttagatttcgtcaacgggggagaacttttcttc
catcttcaaaaagaacggacctttccggaacccagagccaagttctacatcgcagaaatg
gcaagcgcactgggctatctgcattctctcaacatagtttacagggacttgaagccagaa
aatatccttctcgactttgaaggacatatagttttgacggacttcggattgtgcaaggaa
ggtatttcccaagccgagacgacaagtacattttgtgggacacctgagtacctagctcca
gaggtcctgaggaaacaaccgtatgacaacacagtggactggtggtgtctaggatcagtg
ctctatgaaatgctctttggcctgcctccgttctacagcagagacacccatgagatgtat
gaaaacatcctccacaaacccctgatgatgcgtcccggagcgtccaacacggcctggtcc
ctcctgcaggctctactggagaaggacggcacacacagactgggctccagagacgacttt
aatgagatcaaagcacataacttcttctctgcgatcaagtgggatgacctggaacagaga
aaggttccacctccattcactcccaatgtgaattctccttacgacatcacaaactttgat
ccagaattcacagatgagaccgttccaaactctgtgtgctatactgaacatgccatagtc
aacgccagtgtaatggaggctgatgatgcgttcctagggttttcctacgcacccccctca
gatgactccttcctatga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112234075
Entry
112234075         CDS       T05605                                 

Definition
(RefSeq) serine/threonine-protein kinase Sgk3-like isoform X1
  KO
K13304  serum/glucocorticoid-regulated kinase 3 [EC:2.7.11.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112234075
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112234075
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112234075
Protein kinases [BR:otw01001]
 Serine/threonine kinases: AGC group
  SGK family [OT]
   112234075
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PX Pkinase_C Kinase-like FTA2 Kdo
Other DBs
NCBI-GeneID: 112234075
NCBI-ProteinID: XP_024257830
LinkDB
Position
Unknown
AA seq 493 aa
MEEQSSCPNVSIPCCPNVSIPCYNEQRDKKKRYTVYKVMVNVGRHEWFVFRRYAEFDKLY
NTLRKQFPSLNLKIPPKRIFGDNFDPEFIKQRRTGLHEFIQRLVSHPQLRNQPDVRAFLQ
MDKSQNFSDPSEDEDDKNGSTSRNINLGPSGNPHAKPTDFDFLKVIGKGSFGKVLLAKRK
LDGKYYAIKVLQKRVILNRREQKHIMAERNVLLKNMKHPFLVGLHYSFQTTDKLYFVLDF
VNGGELFFHLQKEQTFPEPRAKFYIAEMASALGYLHSLNIVYRDLKPENILLDSEGHIVL
TDFGLCKEGISQAETTSTFCGTPEYLAPEVLRKQPYDNTVDWWCLGSVLYEMLFGLPPFY
SRDTHEMYDNILHKPLRMRPGASNTAWSLLQALLEKDGTHRLGSRDDFNEIKAHYFFSEI
NWDDLEQRKVPPPFTPNVNSPHDITNFDPEFTGETVTNSVCYTEDSIVNAIVMEADDAFL
GFSYAPPSDDSFL
NT seq 1482 nt   +upstreamnt  +downstreamnt
atggaggagcagtccagctgccccaatgtcagcattccctgctgccccaatgtcagcatt
ccctgctacaacgagcagagggacaagaagaagcgctacactgtttacaaagtgatggtc
aatgtaggaagacatgagtggtttgtcttcaggcgatacgcagagtttgacaagctctac
aacacattgaggaaacagtttccatctttgaacttgaaaatcccacccaagagaatattt
ggggacaactttgacccagagtttatcaagcaaagaagaacaggtttacatgagttcatt
cagagactggtctcacatcctcagctcagaaaccagcctgatgtcagagcattcctgcag
atggacaaatctcaaaacttctcagacccatcagaagacgaagatgacaagaacggctct
acctccagaaatattaacctgggaccgtctggaaatccacatgcaaagcccacagacttt
gactttctcaaagtcattggaaaagggagctttggaaaggttctccttgctaagcggaaa
ctggacggaaagtattacgcaatcaaggtcctgcagaaaagggtcatcctcaacaggaga
gagcaaaaacacatcatggcggagcgcaatgtgctactgaagaacatgaaacaccctttc
ctggttggcttgcattattccttccagacgactgacaagttgtacttcgtcttggatttt
gtcaacgggggagaactcttcttccatcttcaaaaagaacagacttttccggaacccaga
gccaagttctacatcgcagaaatggcaagcgcactgggctatctgcattctcttaatata
gtttacagggatttgaagccagaaaatatccttctcgactctgaaggacatatagttttg
actgacttcgggttgtgcaaggaaggcatttcccaagccgagacgacaagcacattttgt
gggacacccgagtacctagctccagaggtcctgaggaaacaaccgtatgacaacacagtg
gactggtggtgtctgggatcagtgctctatgaaatgctctttggcctgcctccgttctac
agcagagacacccatgagatgtatgacaacatccttcacaagcccctgaggatgcgtccc
ggagcgtcaaacacggcctggtccctcctgcaggctctactggagaaggacggcacacac
agactgggctccagagatgattttaatgagatcaaagcgcactacttcttctcagagatc
aactgggatgacctggaacagaggaaggttccacctccattcactcccaatgtgaattct
cctcatgacatcacaaactttgatccagaattcacaggcgagactgttacgaactctgtg
tgctatactgaagattccatagtcaacgccatcgtgatggaggctgacgatgccttccta
ggtttctcctatgcaccaccctcagatgactcctttctatga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112237373
Entry
112237373         CDS       T05605                                 

Definition
(RefSeq) serine/threonine-protein kinase Sgk1 isoform X1
  KO
K13302  serum/glucocorticoid-regulated kinase 1 [EC:2.7.11.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112237373
   04150 mTOR signaling pathway
    112237373
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112237373
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112237373
Protein kinases [BR:otw01001]
 Serine/threonine kinases: AGC group
  SGK family [OT]
   112237373
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_C Kdo FTA2
Other DBs
NCBI-GeneID: 112237373
NCBI-ProteinID: XP_024261731
LinkDB
Position
Unknown
AA seq 434 aa
MTVIRERDWSLLMTYSKTGGLGALLTAFMKQRRMGLNDFIQRLATSNSFTCKHPEVQSIV
NLAPQQQEAELMNANPSPPPSPSQQMNLGPSSNPTAKPSDFHFLKVIGKGSFGKVLLARH
RTDDQFYAVKVLQKKAILKKKEEKHIMSERNVLLKNISHPFLVGLHYSFQTADKLYFVLD
YINGGELFYHLQRERRFLEPRARFYTAEIASALGYLHSLNIVYRDLKPENILLDSQGHII
LTDFGLCKENIEQNGTTSTFCGTPEYLAPEVLHKQPYDRTVDWWCLGAVLYEMLYGLPPF
YSRNTAEMYDNILNKPLQLKPNISNAAKHILEGLLQKDRTQRLGHSHDFEEIKNHMFFSP
INWDDLTTKKLTPPFNPNVTGPNDLRHFDTEFTDEPVPSSIGCSPDSSLITASIKEAAEA
FLGFSYAPSMDSYL
NT seq 1305 nt   +upstreamnt  +downstreamnt
atgacagtaataagagagagagactggtctttgttgatgacctattccaaaacaggagga
ctaggagctttactcactgctttcatgaaacagagaagaatggggctgaatgacttcatt
cagaggctggccacgagtaactcattcacctgcaaacatcctgaggttcagtccatcgtc
aacttggctccccaacaacaggaggctgagctaatgaatgcaaacccctctcctcctccc
agtccctcccagcagatgaacctgggcccgtcctccaaccccacagccaagcccagtgac
ttccacttcctgaaggtgatagggaagggtagcttcgggaaggtcctcctagccaggcac
cgaacagacgaccagttctatgctgttaaggtgctgcagaagaaggccatcctgaagaag
aaagaggagaagcacatcatgtcagagaggaatgtcctgttgaagaacatttcacacccc
ttcctagtgggactacactactccttccagaccgctgataaactctactttgtgctggac
tacattaacggaggagagttgttctaccatctccagagggagaggcgtttcttagagccc
cgggccaggttctacacagcggagatcgccagtgccctgggctacctgcactctctaaac
atcgtgtacagagacctgaagcctgagaatattctactggactctcaaggacacatcata
ctcacggacttcggcctctgcaaagagaacatagaacagaacggaaccacgtcgacgttc
tgtggaacaccagagtacctagctccagaggtgttacacaagcagccatatgacaggacg
gttgactggtggtgtttaggagctgtgctttatgagatgctatatggcctgcctccattc
tacagtcgtaacacagcagagatgtacgacaacatcctgaacaagcccctgcagctcaaa
cccaacatctctaacgctgccaagcacatactggagggactgctgcagaaagatcgtaca
caacgactgggacacagccacgacttcgaggagatcaagaaccacatgttcttctccccc
atcaactgggatgacctgaccactaagaagctcaccccccctttcaatccaaacgtgacg
ggccctaatgaccttcgccactttgacacggagttcacagacgaacccgtcccctcatcc
attggctgttcccctgactcctccctcatcactgctagcatcaaggaggcagccgaggcc
ttcctagggttcagctacgctccttccatggactcatacctgtag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112254332
Entry
112254332         CDS       T05605                                 

Definition
(RefSeq) serine/threonine-protein kinase Sgk2-like isoform X1
  KO
K13303  serum/glucocorticoid-regulated kinase 2 [EC:2.7.11.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112254332
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112254332
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112254332
Protein kinases [BR:otw01001]
 Serine/threonine kinases: AGC group
  SGK family [OT]
   112254332
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_C Kdo APH
Other DBs
NCBI-GeneID: 112254332
NCBI-ProteinID: XP_024282544
LinkDB
Position
7
AA seq 360 aa
MDNWSQLQSANSIDVNLGHSHNHHAKPSDFEILAIIGKGTFGKVLLAKLKSDNKFYAVKV
LQKKIILRKKEQKNIMAERNVLLKSMKHPFLVGLHYSFQTPEKLYFVMDYVNGGELFYHL
QREHCFSEPRARFYTAELASAIGYLHSHNIVYRDLKPENVLLDSEGHVVLTDFGLCKEGI
DPESTTSTFCGTPEYLAPEVLKQQPYDHTVDWWCLGTVLYEMIYGLPPFYSQDMSEMYDN
ILHRPLSVPGGASSVACDLLMGLLQKDQHRRLGAIADFLEVKNHTFFSPINWDDLYHRRI
KPPYNPNVKGPADMQHIDPEFTKEMVSGSVGVTPEFSNLSTSSPNTFIGFSYVSSDDNFL
NT seq 1083 nt   +upstreamnt  +downstreamnt
atggataattggagtcagcttcaatcagcaaactccattgatgtcaaccttggtcactca
cacaatcaccatgccaagccatcagactttgaaatcctggctataattgggaaaggaaca
tttgggaaggttcttcttgccaaactgaaatccgacaacaagttctatgcggtgaaagtg
ctgcagaaaaaaatcatactgaggaaaaaagagcaaaagaacatcatggcagagaggaat
gtgctgctcaagagtatgaaacatcccttcctggtggggctccactactcgttccagacc
ccagagaagctctactttgtcatggattacgtcaatggaggagagcttttctatcacctt
cagagagagcactgcttctcagagccaagggctcgcttctacacggctgagttggccagt
gccatcggctacttacactcgcacaacattgtttacagagacttgaagcctgaaaatgtg
ctgttagactcagagggccatgttgtgttgactgactttggcttgtgtaaagaggggata
gacccggagtccaccacctccactttctgtggaaccccagagtatttggctccggaggtg
ttgaaacagcagccctatgaccacacggtagactggtggtgtctgggaactgtactttat
gagatgatatatgggctgccccccttctatagccaggatatgtctgagatgtacgacaac
atcctccacaggcccttgagtgtgccagggggggccagctctgtggcgtgtgacctgctg
atgggcctcctacagaaagaccagcatcgcaggctgggtgctatcgcagactttctcgaa
gttaaaaaccatacttttttctcgccgataaactgggatgacctttaccatcggagaatc
aaacctccctacaaccccaacgtgaaaggcccagcagacatgcagcatattgatccagag
ttcaccaaagagatggtgtcaggctctgtgggggttacccctgaattctccaacttatca
accagcagcccaaatacattcattggcttctcctatgtatccagtgatgacaacttcctc
tag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112264320
Entry
112264320         CDS       T05605                                 

Definition
(RefSeq) serine/threonine-protein kinase Sgk1-like
  KO
K13302  serum/glucocorticoid-regulated kinase 1 [EC:2.7.11.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04068  FoxO signaling pathway
otw04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112264320
   04150 mTOR signaling pathway
    112264320
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112264320
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112264320
Protein kinases [BR:otw01001]
 Serine/threonine kinases: AGC group
  SGK family [OT]
   112264320
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_C Kdo
Other DBs
NCBI-GeneID: 112264320
NCBI-ProteinID: XP_024296609
LinkDB
Position
13
AA seq 425 aa
MAVTEAPCDLSYCKMRGIVSVLTAFIKERKMGLNDLISKLVSNPHICHHSEVDFLKIDEN
QNEELDDDELLNPMCLAFPRSSLAEELAIKPSDFDYLKIIGKGSFGKVLLARHRDSNEYY
AVKVLQKKIILKKKEQKHIMAERSVLMKNIKHPFLVGLHFSFQTTDKLYFVLDYVNGGEL
FYHLQRERVFLEPRARFYAAEIASALGYLHSLHIVYRDLKPENILLASTGHIVLTDFGLC
KEGLAPTGTTTTFCGTPEYLAPEVLQKQAYDRTVDWWCLGSVLYEMLYGLPPFYSRNTAE
MYNNILNKPLILKPNVSNSGRELLEGLLQKDRTKRLGVKDDFMELKCHTFFSPINWDDLM
ARKITPPYIPSVSGPTDLRHFDPEFTHLPVTSSLCNTDGLLVTSSIKEAAGAFPGFSYGP
ADGFM
NT seq 1278 nt   +upstreamnt  +downstreamnt
atggctgttaccgaggctccatgcgacttgtcttattgcaagatgaggggaatcgtgtca
gttctcactgcttttatcaaggagaggaaaatgggtctgaatgacttaatctcgaagctg
gtgtcaaacccacatatctgtcatcactctgaagttgacttcctcaagatcgatgagaac
cagaatgaagagctggacgatgatgaacttctgaatccgatgtgcctggcgttccccaga
agctctctagcggaagagttggcgatcaaaccaagtgattttgactacctgaaaatcatt
ggcaaagggagctttgggaaggtgctgctggctcgccaccgggacagcaacgagtattac
gctgtcaaggttctacagaagaaaatcatcttgaagaagaaagagcaaaagcatatcatg
gcggagcgaagtgtcctgatgaagaatatcaaacatcctttcctggtggggctgcacttt
tccttccagactactgacaaactctactttgtcctcgactatgtgaatggaggagagttg
ttctaccatctacagagagagagggtgttcctagaacccagagccaggttctacgctgca
gagatcgccagtgctctgggatacctccactccctgcatattgtttacagagatctgaag
cctgagaatatcctgctagcctcaacgggacacatcgtcctgacagactttggcctctgc
aaagagggccttgcacccactgggaccaccacaaccttctgtggaacgccagagtacctg
gcccccgaggtgctgcagaagcaggcgtacgaccgcacagtggactggtggtgcctggga
tcggtgctgtacgagatgctctacggactgccacccttctacagtcgtaacacagctgag
atgtacaacaatatcctgaacaagcctctgatactgaagcccaacgtgtccaactcaggc
agggaactgttggaggggctcctgcagaaggaccgcaccaagaggctaggagtgaaagat
gattttatggagctgaagtgccacaccttcttctcacccatcaactgggatgacctgatg
gccaggaagatcacaccaccctacattccctctgtgagcgggcccacggacctcaggcac
tttgacccagagttcacccacctccctgtgacctcgtcgctgtgcaacacggacggcctg
ctggtgaccagcagcatcaaggaggcagctggagccttcccaggcttctcctatggaccc
gctgacggcttcatgtga

DBGET integrated database retrieval system