KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112215524
Entry
112215524         CDS       T05605                                 

Gene name
vav3
Definition
(RefSeq) guanine nucleotide exchange factor VAV3
  KO
K05730  guanine nucleotide exchange factor VAV
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112215524 (vav3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112215524 (vav3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:otw04990]
    112215524 (vav3)
Domain-containing proteins not elsewhere classified [BR:otw04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   112215524 (vav3)
SSDB
Motif
Pfam: RhoGEF CAMSAP_CH CH SH3_2 SH3_1 SH3_9 SH2 C1_1 PH CDC24 Prok-RING_1 SRA1 PH_10 C1_2 Zn_ribbon_17 LZ3wCH
Other DBs
NCBI-GeneID: 112215524
NCBI-ProteinID: XP_024230380
LinkDB
Position
16
AA seq 841 aa
MMEYWRQCALWLINCKVLPPNHRVTWESAQVFDLAQTLRDGVLLCQLLNNLRPQSINLKE
INLRPQMSQFLCLKNIRTFLSACYEIFGMKKSELFEAFDLFDVRDFGKVMDTLSKLSHTT
ISEQTGIKAFPSEESLEEDEDIYNHLEDLIDEKGVEDEEDLYDCVYDDEDGGEIYEDLMK
AEAVRPPLKQVETDIRSCCLTEIKQTEEKYTETLDSIEKYFMAPLTTFLSSEEMKKVFVN
IPDLVKVHKSLMVEIQDSVRHKSAQNIYQIFIHYKERLLIYGKYCSHVETAIVALDDICK
HREDIRMKLEECAKRANYGKFTLRDLLVVPMQRVLKYHLLLQELVKHTHDAADKSNLRLA
LDAMKDLAQYVNEVKRDNETLRDIAQYQKSIENLNQSLSTYGRPKGDGEVRVTSIDKRAK
QDRHIFLFDAAVIXCKRRGDNYEMKEVIDLHHFKITNNPTSDKENRKWSYGFYLTHNQGQ
SGFELFFKTKELKKKWLEQFGMAISNIRPENGTSNFHEFKMHTFDRITSCSYCHMLLRGI
FNQGYLCSKCGVGAHKECLGRFGSCGKTDPGSFRTQEKSVQGQRSDPGLPKMLVTRNYFG
VPSPICGPPLNIQQGDIIELVCADLHSSWWQVRETSVCRVGFFPSDAVKLSPQVPKPVDY
STQPWFAGPMERLQAEAELINRGNSTYLVRHRSREFTEYAISIKYSNDVKHIKILTRDAC
FHIAENKKFRSILELIEYYKHHSLREGFRSLDTTLQFPYREQENAAMLHTNRPGGNMFTP
KVMGVAIARYDFSSRDTRELSLQEGDVVKIYTKSGANGWWRGEVSGRVGWFPSTYVEEGE
E
NT seq 2526 nt   +upstreamnt  +downstreamnt
atgatggagtattggaggcagtgcgcattatggctgatcaactgcaaggtgctaccaccc
aaccatcgggtaacatgggagtccgcccaggtattcgacttggctcagacactccgagat
ggagtgctcctgtgtcagcttctcaacaacctccgaccccagtccatcaacctcaaagag
attaatctcagaccgcagatgtcacagttcctgtgcttgaagaacatcaggacatttctc
tccgcctgctatgagatatttggcatgaagaagagtgaactctttgaggccttcgacttg
tttgatgtgcgggactttggaaaggttatggacacattgtccaaactgtcccacaccacg
atttcagaacaaaccggaataaaggcttttccttcagaggagagtctagaagaagatgag
gacatctataaccacctagaagacttgattgatgagaaaggtgtggaggacgaggaggat
ctttatgactgtgtctatgatgatgaagacggaggagagatctatgaagatctgatgaag
gctgaagccgtccgtcctcctctgaagcaggtagagacagacatcaggagctgctgtctg
acagagatcaagcagactgaggagaagtacacagagactctggactccatagagaagtat
tttatggcacctcttacgacattcctgtcctcagaggagatgaagaaagtgtttgtcaac
attccggacctggttaaggttcacaagagtctcatggtggagatccaagactctgtccgc
cataaaagtgctcagaacatctaccagatcttcatccactacaaagagagattgctaata
tatgggaaatactgtagccatgtagaaacggccatcgttgctttggatgacatctgcaaa
cacagagaggacatccggatgaagctggaggaatgtgcaaagagagccaactatggaaag
tttacactgagggatctgctagtggtccctatgcagcgggtactcaagtatcatcttctt
ctacaggaattagtgaaacacactcacgatgcggctgacaagagcaatttgcggctggct
ctggatgccatgaaggacctggctcagtacgtcaatgaagtgaagagagacaacgagact
ctgagagacatagcccagtatcagaaatccatcgaaaaccttaatcagtctcttagtacc
tatgggagaccaaaaggtgacggagaggtacgcgttacctcaatcgacaaacgtgccaaa
caggaccggcacatcttcctgttcgatgctgctgtgatcstctgtaagaggagaggagac
aactatgagatgaaggaggtgatcgacctgcaccacttcaagatcaccaacaaccccacg
tcagataaggagaacaggaagtggtcctatgggttctacctgacacacaaccaggggcag
agtggcttcgagttgttcttcaaaaccaaggagctgaagaagaaatggctggagcagttt
ggcatggccatatccaacatacgtccagagaatggcaccagtaacttccatgagttcaag
atgcacacctttgacagaattacatcctgtagctactgccacatgctgctaaggggtatc
tttaaccaggggtacctttgctccaagtgtggtgttggagcccataaggaatgtctgggg
aggtttggcagctgtggaaaaacagatccgggctccttcagaactcaggaaaaatcagtg
caaggacagcgctcagatccagggttacctaagatgttggtgaccaggaactattttggc
gtgccaagtcccatatgtggcccgcccctcaacatccagcaaggtgacatcatcgagctg
gtctgtgccgatctacacagctcctggtggcaggtgagagagacatcggtgtgtagagtg
ggcttctttccaagtgacgccgtgaagctgtccccccaggtccccaaacctgtcgactac
tccacacaaccttggtttgctggacccatggagagacttcaggctgaggcagagctgatc
aacagagggaacagcacctacctggtccgccaccggagccgcgagttcacagagtacgcc
atcagtatcaagtacagcaatgacgtgaagcacatcaagatcctgaccagagatgcctgc
ttccacatcgcagagaacaagaagttcaggagtatattagaactaattgagtactacaaa
caccattcattgagggaaggcttcagaagcctggacaccacactgcagttcccctacaga
gagcaggagaatgctgctatgctccacaccaacagacccggaggaaacatgttcacccct
aaggtgatgggtgtggcgatagcccgctatgacttcagctccagggacaccagagagctg
tctctacaggagggcgatgtagtcaagatctacaccaagtcaggagccaatggctggtgg
aggggagaggtcagcggcagggtgggctggtttccatctacctatgtggaagaaggagag
gagtga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112219368
Entry
112219368         CDS       T05605                                 

Definition
(RefSeq) guanine nucleotide exchange factor VAV2-like
  KO
K05730  guanine nucleotide exchange factor VAV
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112219368
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112219368
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:otw04990]
    112219368
Domain-containing proteins not elsewhere classified [BR:otw04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   112219368
SSDB
Motif
Pfam: RhoGEF SH3_2 CAMSAP_CH CH SH3_1 SH3_9 SH2 PH C1_1 C1_2 SH2_2 ADSL_C PH_10 CDC24 Nup88
Other DBs
NCBI-GeneID: 112219368
NCBI-ProteinID: XP_024236321
LinkDB
Position
20
AA seq 883 aa
MEEWRQCGRWLIDCKVLPPNHRVVWPSAAVFDLAQALRDGVLLCQMLHNLSPGSVDLKEI
NFRPQMSQFLCLKNIRTFLKVCHDKFGLRNSELFDPFDLFDVRDFGKVISALSRISHHSI
AQIKGIRPFPSEDTALNEDDVYRSLEELADEHDVGEDDIYDCVPCEDDGDDIYEDIIKVE
VRQPMIRYMQKMGMTEDDKRNCCLVEIQETEAKYYKTLEDIEKNYMIPLKQVLSPPDMES
IFVNLEDVIKVHFALLRAIDLNMVSGGNGLGKIFVDFKERLLIYGQYCSHMENAQKILDE
LIATREDVKMKVEECTMKVQEGKFKLQDLLVVPMQRVLKYHLLLKELVSHSTDRPERQQL
KEALEAMQDLAMYINEVKRDNETLKKISEFQNSIENLQQVKLEEYGRPKIDGELKVSSIV
NRTKQDRYIFLFDKVVIVCKRKGYCYELKEIIELQSYKMSDDPMNNRDMKKWSYGFYLIH
LQGKQGFQFFCKTEDTKRKWMEQFEMAMSNIKPEKATANQHNFQMHTFEKDTNCRACKML
LRGIFYQGYYCSHCGTGAHKECLECITICKINPLDTEPGLPPSGPKMVAVRNYHGTPVPP
GKPPLSFQTGDFIELLKGEPDTTWWEGKLIQTQKSGFFPNNCVKPCLDPKPLFQSFPSRQ
SSRETDYYAYPWFAGNMERTQADNLLKSHSSGTYLIRERTAEAERFAISIKFNDEVKHIK
VIEKDSWIHITEAKKFESLLELVEYYQSHSLKESFKLLDTTLRYPYKSRERGPASRASTR
SPGEPIPAIGASYNFSFLSPQGLNFSSSQSSAPFWSVFTPRVVSTAVARYNFAARDMREL
SLREGDIVKIYSKIGGDQGWWKGEANGRIGWFPSTYVDEEGVQ
NT seq 2652 nt   +upstreamnt  +downstreamnt
atggaagagtggcggcaatgcgggcgatggttgatagactgcaaggttttgcccccaaac
caccgggtcgtgtggccttctgcggccgtgttcgacttggcacaggcgctacgagacgga
gtgctcttgtgccaaatgttgcacaacctctcaccggggtctgtggacctaaaggagatc
aacttcagaccccaaatgtcacagtttctgtgtctgaagaacatccggacattcctcaag
gtgtgccacgacaagtttggcctgcggaacagtgaactctttgacccgttcgacctgttt
gatgtcagggacttcggcaaggtgatctcagccctatccaggatctcccaccacagcatc
gcacagatcaaggggatcaggccctttccttcagaggacactgctctaaatgaggatgac
gtgtaccggagtcttgaggagctagcagatgagcatgacgtgggggaggatgacatctac
gactgtgttccctgtgaggacgatggagatgacatctacgaggacatcatcaaggtggaa
gttcgacaacccatgatcagatacatgcagaaaatgggcatgacagaagacgacaagaga
aactgctgcttagtggagatccaggagactgaggccaagtactacaagacgctggaggac
attgagaagaattatatgatccctttgaagcaagttctcagtccaccggacatggaatcc
atctttgtaaatctcgaggatgtgattaaagtccactttgccctgctgagggccatcgac
ctcaacatggtgagcggaggcaacggtctggggaagatcttcgtagacttcaaggaaaga
ttgttgatctacggccagtactgcagccacatggagaatgcccagaagatactggatgag
ctcatcgccacgcgggaggacgttaagatgaaagtcgaggagtgcactatgaaggtgcaa
gagggcaagttcaagctccaggacctgctggtagtgcccatgcagcgggttctcaagtac
cacctcctacttaaggagctggtgagtcattcaactgaccgacctgagagacagcagctc
aaggaggcgttggaggccatgcaggacctggctatgtacatcaatgaagtgaagagagac
aatgaaaccttgaagaagattagtgaattccagaactccatcgaaaaccttcagcaggtc
aaactggaggagtatggcaggccaaagatagatggagagctcaaggtgtcctccatagtc
aaccgaacaaagcaggaccggtacatattcctgtttgataaagtggtcatagtgtgcaag
cggaaaggctactgctatgaactgaaggagatcattgagctgcagtcgtacaaaatgtct
gacgaccccatgaacaacagggacatgaagaagtggtcctatggcttctacctgatccac
ctgcaagggaagcagggtttccagttcttctgtaaaacagaggacaccaagaggaaatgg
atggagcagtttgagatggccatgtcaaacatcaagccggagaaagccacggccaatcag
cacaacttccagatgcacacgtttgagaaggacaccaactgccgagcctgcaagatgctg
ctgagggggatattctaccaggggtattactgttcccattgtgggactggagcgcacaaa
gagtgtctagagtgcatcaccatctgtaaaataaatccactcgacacagaacctggacta
ccgccatcgggtcctaaaatggtggcagtgaggaactatcatgggacgcctgttcctcca
gggaagcctccactctccttccagacaggcgacttcatcgagctgctgaagggggaacct
gacaccacctggtgggagggaaagcttatccaaacccagaagagtggcttctttcctaac
aactgtgtaaagccttgtttggaccccaagcctttgttccagtccttccccagccggcag
tcctcaagggaaacagactactatgcatacccatggtttgctggcaacatggagcggaca
caggctgacaacctgttgaagtcccacagcagtgggacatacctgatcagagagaggact
gctgaggcagagaggttcgccatcagcatcaagttcaatgatgaagtaaagcatattaaa
gtcattgagaaagacagctggatccacatcactgaggctaagaagtttgagagtctactg
gagttggtggagtactatcagtctcattcgctgaaggagagtttcaaactgctagacacg
acattacgatatccctacaaatctagagaacgggggccggcttcgcgggccagcactcgc
tctccaggtgagcccatccctgccattggtgcttcctacaacttctccttcctcagtcct
cagggtctcaacttctcctcctctcagagctcagcccccttctggtcagttttcacaccg
agggtggtcagcacagcggtggccaggtacaattttgcagcacgggacatgagggagctg
tcactcagagaaggagacattgtcaagatctacagcaagatcggaggagaccagggctgg
tggaagggagaggccaatggcaggattggctggtttccttcaacatatgttgacgaagaa
ggagttcagtga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112230527
Entry
112230527         CDS       T05605                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: guanine nucleotide exchange factor VAV2-like
  KO
K05730  guanine nucleotide exchange factor VAV
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112230527
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112230527
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:otw04990]
    112230527
Domain-containing proteins not elsewhere classified [BR:otw04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   112230527
SSDB
Motif
Pfam: RhoGEF CAMSAP_CH SH3_2 CH SH3_1 SH3_9 SH2 PH C1_1 SH2_2 PH_10 ADSL_C CDC24
Other DBs
NCBI-GeneID: 112230527
NCBI-ProteinID: XP_024252574
LinkDB
Position
33
AA seq 863 aa
MEEWRQCGRWLIDCKVLPPNHRVVWPSAAVFDLAQALRDGVLLCQMLHNLSPGSVDLKEI
NFRPQMSQFLCLKNIRTFLKVCHDKFGLRNSELFDPFDLFDVRDFGKVISALSRISHHSI
VQIKGVRPFPSEDTALNEDDVYRSLEELADEHDVGEDDIYDCVPCEDDGDDIYEDIIKVE
VRQPMIRYMQKMGMTEDDKRNCCLVEIQETEAKYYKTLEDIEKNYMIPLKQVLSPQDMGA
IFVNLEDVIKVHFALLRAIDLNMVSGGNGLGKIFIDFKERLLIYGQYCSHMETAQKTLDE
LITTREDVKMKVEECTMKVQEGKFKLQDLLVVPMQRVLKYHLLLKELVSHSTDRPDRQQL
KEALEAMQDLAMYINEVKRDNETLKKISEFQNSIENLQVKLEEYGRPKIDGELKVSSIVN
RTKQDRYIFLFDKVVIVCKRKGYCYELKEIIELQSYKMSDDPMNNRDVKKSSGKMWSYGF
YLIHLQGKQGFQFFCKTEDTKRKWMEQFEMAMSNIKPEKATANQHNFQMHTFEKNTNCRA
CKMLLRGIFYQGXYCSRCGTGAHKESTRHGPKMVAVRNYHGTPVPPGKTPLSFQTGDFIE
LLKGEPDTTWWEGKLIQTQKSGFFPNNCVKPCLDPKPLFQSFPSRQPSRETDYYGYPWFA
GNMERTQADNLLKSHSSGTYLIRERTAEAERFAISIKFNEEVKHIKVIEKDSWIHITEAK
KFESLLELVEYYQSHSLKESFKLLDTTLRYPYKSKERGPASRASTRSPAIGASYNFSFLS
PQGLNFSSQSSAPFWSVFTPRVVSTAVARYNFAARDMRELSLREGDIVKIYSKIGGDQGW
WKGEANDRIGWFPSTYVDEEGVQ
NT seq 2592 nt   +upstreamnt  +downstreamnt
atggaggagtggaggcaatgcgggcggtggttgatagactgcaaggttttgcccccaaac
caccgggtcgtgtggccttctgcagctgtgttcgacttggcacaggcgctacgagacgga
gtgctcttgtgccagatgttgcacaacctgtcaccggggtctgtggacctaaaggagatc
aacttcagaccccagatgtcccagtttctctgtctgaagaacatccggacgttcctcaag
gtgtgccacgacaagtttggcctgcgtaacagtgagctgtttgacccctttgacctgttc
gatgtcagggatttcgggaaggtgatctcagccctgtccaggatctcccaccacagcatt
gtgcagatcaaaggcgtgaggccttttccttcggaggacactgctctgaatgaggatgac
gtgtaccggagtcttgaggagctggcagatgagcatgacgtgggggaggatgacatctac
gactgtgttccctgtgaggatgatggagatgacatctacgaggacatcatcaaggtggaa
gtacgacaacccatgatcagatacatgcagaaaatgggcatgacagaagacgacaagaga
aactgctgcttagtggagatccaggagactgaggccaagtactacaagacgctggaggac
attgagaagaattatatgattcccctgaagcaagttctaagtccacaagacatgggggcc
atctttgtcaatctggaggatgtgattaaggtccactttgctctgctgagggccatcgac
ctcaacatggtgagcggaggcaatggtctggggaagatcttcatagacttcaaggaaagg
ttgctgatctacggccagtactgcagccacatggaaaccgctcagaagacactggatgag
ctcatcaccacgcgggaggacgtcaagatgaaagtagaggagtgcactatgaaggtgcag
gaggggaagttcaagctccaggacctgttggtcgtgcccatgcagagagtactaaagtac
cacctcctactcaaggagctggtgagtcattcaactgaccgacctgatagacagcagctg
aaggaggcgttggaggccatgcaggacttggctatgtacatcaatgaagtgaagagagac
aacgagaccttgaagaagattagtgaattccagaactccatcgagaaccttcaggtcaaa
ctggaggagtatggcagaccaaagatagatggagagctcaaggtgtcctccatagtcaac
cgaacaaagcaggaccggtacatattcctgtttgataaagtggtcattgtgtgcaagcgg
aaaggctactgctatgaactgaaagagatcattgagctgcagtcgtacaaaatgtctgac
gaccccatgaacaacagggacgtgaagaagtccagtggaaaaatgtggtcctatggcttc
tacctgatccacctgcaaggcaagcagggctttcagttcttctgtaaaacagaggacacc
aagaggaaatggatggagcagtttgagatggccatgtcaaacatcaagccggagaaagcc
acggccaatcagcacaacttccagatgcacacgtttgagaagaacaccaactgccgagct
tgcaagatgctgctgagggggatcttctaccaggggntctactgttcccgctgtgggact
ggagctcataaagaatccactcgacacggccctaagatggtggcagtaaggaactatcat
gggacgcctgttcctccggggaagactccactctccttccagacaggggacttcatcgag
ctgctgaagggggaacctgacactacctggtgggagggaaagcttatccaaacccagaag
agtggcttctttcctaacaactgtgtaaagccttgtttggaccccaagcctttgttccag
tccttccccagccggcagccctcaagggaaacagactactatggatacccctggtttgct
ggcaacatggagcggacacaggctgacaacctgttgaagtcccacagcagtggaacatac
ctgatcagagagaggactgctgaggcagagaggttcgccatcagcatcaagttcaatgag
gaagtgaagcacattaaagtcattgagaaagacagctggatccacatcactgaggctaag
aagtttgagagtctactggagttggtggagtactatcagtctcattcgctgaaggagagt
ttcaagctgctagacacgacattacgatatccctacaaatcgaaagaacgggggccggcg
tcgcgggccagcacccgctctccagccattggcgcttcctacaacttctccttcctcagt
cctcagggtctaaacttctcctctcagagctcagcccccttctggtcagtattcacgccg
agggtggtcagcacagcggtggccaggtacaactttgcagcacgggacatgagagagctg
tctctcagagaaggggacatcgtcaagatctacagcaagattggaggagaccaggggtgg
tggaagggagaggccaatgacaggattggctggtttccctcaacgtacgttgacgaagaa
ggagttcagtga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112239456
Entry
112239456         CDS       T05605                                 

Definition
(RefSeq) guanine nucleotide exchange factor VAV3-like
  KO
K05730  guanine nucleotide exchange factor VAV
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112239456
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112239456
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:otw04990]
    112239456
Domain-containing proteins not elsewhere classified [BR:otw04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   112239456
SSDB
Motif
Pfam: SH3_2 SH3_1 SH2 SH3_9 SH3_3
Other DBs
NCBI-GeneID: 112239456
NCBI-ProteinID: XP_024263683
LinkDB
Position
Unknown
AA seq 173 aa
MERLQAEAELISRGNSTYLVRHRSRELTEYAISIKYSNDVKHIKILNRDGCFHIAENNKF
GSILELIEYYQHYSLREGFRSLDTTLQFPYREQESPAAMLCTNKPGGKMFTPKVIGVAKA
RYDFSSRDTRELSLQEGDVVKIYTKSGANGWWRGEVNGRVGWFPSTYVEEGEE
NT seq 522 nt   +upstreamnt  +downstreamnt
atggagagactgcaggctgaggcagagctgattagcagaggcaacagcacttacctggtc
cgccaccggagccgcgagctcacagagtacgccatcagcatcaagtacagcaacgacgtg
aagcacatcaagatcctgaacagggacggctgctttcacatcgcagagaacaacaagttc
gggagtatattagaactgattgagtactatcaacattactccctgagggaaggcttccga
agcctggacaccacactgcagttcccctacagagagcaggagagccctgctgctatgctc
tgcaccaataaacctggaggaaagatgttcacccctaaggtgataggtgtggcgaaagcc
cgctatgacttcagctccagggacaccagagagctgtctctacaggagggagacgtggtt
aagatctacaccaagtcaggagccaatggctggtggaggggagaggtcaacggcagggtg
ggctggtttccatctacctacgtggaggaaggagaggaatga

DBGET integrated database retrieval system