KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112215587
Entry
112215587         CDS       T05605                                 

Definition
(RefSeq) integrin beta-1-like
  KO
K05719  integrin beta 1
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04145  Phagosome
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
otw04514  Cell adhesion molecules
otw04530  Tight junction
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112215587
   04514 Cell adhesion molecules
    112215587
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    112215587
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112215587
   04530 Tight junction
    112215587
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112215587
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112215587
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112215587
   04515 Cell adhesion molecules [BR:otw04515]
    112215587
   04090 CD molecules [BR:otw04090]
    112215587
Membrane trafficking [BR:otw04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    112215587
Exosome [BR:otw04147]
 Exosomal proteins
  Proteins found in most exosomes
   112215587
Cell adhesion molecules [BR:otw04515]
 Integrins
  Integrin beta subunits
   112215587
CD molecules [BR:otw04090]
 Proteins
  112215587
SSDB
Motif
Pfam: Integrin_beta PSI_integrin I-EGF_1 EGF_2
Other DBs
NCBI-GeneID: 112215587
NCBI-ProteinID: XP_024230498
LinkDB
Position
16
AA seq 645 aa
MYVVSEINHADKMDLKLLLISTLLGVICYSSAQQEGNECIKAIAKSCGECIQVGAKCGWC
MDPGFLKQGEATSTRCDELESLRKRGCSSTKVENPQGSQWILKNKAVTNRIKGAENLRAE
DITQIQPQKLTLSLRLGEPQSFNLKFKRAEDYPIDLYYLMDLSYSMKDDLENVKNLGTQL
MLEMSKITSDFRIGFGSFVEKKLLNPCTGDQNCTSPFSYKNLLTLTSNGQEFNTLVGQQQ
IDGNLDSPEGGFDAIMQVAVCGEHIGWRNVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGK
CHLENNMYTMSHYYDHPSIAHLVQKLSDNNIQTIFAVTEEFQPVYMELKNLIPKSAVGIL
SANSSNVINLIIDAYNSLSSEVILENSKLPEGVTIMYQSRCKNGVTGEGEMGRKCSDISI
GDDVSFTIRITAKQCPKMGKPETIKIKPLGFNEEVEITLNFICECDCHKDGIENSDICHN
GNGTYECGACRCNEGRIGRQCECSTNEVTIEDLDKSCRKDRGTDICSNNGDCVCGTCECK
KRENPEERYSGMFCECDNFNCDRSNNKLCGGHGHCECRWCICDANWTGSACDCSLDTTTC
LASNKQICNGRGTCECGTCKCTNPKFQGPSCEICPTCPGVCTEHK
NT seq 1938 nt   +upstreamnt  +downstreamnt
atgtatgttgtctcggaaataaatcacgccgataagatggacctgaaactacttctgatt
tcaacgttgttaggagtcatttgttacagcagtgctcagcaagaagggaacgagtgcatc
aaggctattgctaaatcttgtggggagtgtattcaagtgggagcgaaatgtggctggtgc
atggacccagggttcctgaagcagggtgaggccacatcaacccgctgtgacgagctggag
tccctgaggaagagaggttgtagctccaccaaggtagagaacccccaaggcagccagtgg
atcctgaagaacaaggctgtgaccaaccgcatcaagggagctgagaatctcagagcagag
gacatcacacagatccagccacagaaactcaccctcagcctcagattgggtgaaccccag
tcttttaacttgaagttcaaacgggccgaggattaccccattgacctctactacctgatg
gacctgtcctactccatgaaggacgatctggaaaacgtcaagaacctgggaacacagctc
atgctggagatgtcaaagatcacgtctgatttcagaatcggttttggttcctttgtagag
aagaagttgctgaacccctgtactggggaccagaactgcaccagtcccttcagctataag
aacctcctgacgctgaccagcaatggacaggagtttaacaccctggttggtcaacagcag
attgatggaaacctggactcaccagagggaggcttcgatgccatcatgcaagtggctgtg
tgtggtgagcacattggctggaggaacgtcacccgtctgctggtgttctccactgacgct
ggcttccactttgctggagacgggaaactgggagggatagttttgcccaacgatgggaaa
tgtcacctggagaacaacatgtacacaatgagccactactatgaccacccctccatcgct
cacctggttcagaaacttagcgacaacaacatccagacgatctttgccgtcacagaggag
ttccagcctgtttacatggagttaaagaatctcattcctaaatctgcagtggggatactc
tctgctaactccagcaacgttatcaacctcattattgatgcctacaattctctttcctca
gaggtgattctggagaacagcaagctaccagagggagtgaccataatgtatcagtcacgc
tgcaagaacggagtgactggtgagggagagatgggaagaaaatgctccgatatctccatc
ggtgacgatgtgtctttcaccatacgcatcacagctaagcagtgtcctaaaatgggcaaa
ccagagaccatcaagatcaaacccctagggttcaatgaggaggtggagatcactctgaac
ttcatctgcgagtgtgactgtcacaaagatggcattgagaacagtgacatctgccacaac
ggcaacgggacatatgaatgtggagcctgcaggtgcaatgagggccgtattggtagacag
tgtgagtgcagcaccaacgaggtgaccatcgaagacctggataagagctgccgtaaagac
agaggtacagacatctgcagcaacaacggagactgtgtgtgtggaacctgtgagtgcaag
aagagagagaacccagaggagcgctacagcgggatgttctgcgagtgtgacaacttcaac
tgtgaccgctccaacaacaaactctgtggaggacatggtcactgtgagtgcaggtggtgt
atatgtgatgccaactggacaggcagtgcctgtgactgttctctggacaccacgacctgc
ctggcttcaaacaagcagatctgtaacggacgaggcacctgtgagtgtggcacctgcaag
tgtactaacccaaagttccagggccccagctgtgagatctgtcctacctgtccaggggtc
tgcacagaacacaagtga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112215590
Entry
112215590         CDS       T05605                                 

Definition
(RefSeq) integrin beta-1-like
  KO
K05719  integrin beta 1
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04145  Phagosome
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
otw04514  Cell adhesion molecules
otw04530  Tight junction
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112215590
   04514 Cell adhesion molecules
    112215590
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    112215590
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112215590
   04530 Tight junction
    112215590
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112215590
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112215590
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112215590
   04515 Cell adhesion molecules [BR:otw04515]
    112215590
   04090 CD molecules [BR:otw04090]
    112215590
Membrane trafficking [BR:otw04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    112215590
Exosome [BR:otw04147]
 Exosomal proteins
  Proteins found in most exosomes
   112215590
Cell adhesion molecules [BR:otw04515]
 Integrins
  Integrin beta subunits
   112215590
CD molecules [BR:otw04090]
 Proteins
  112215590
SSDB
Motif
Pfam: Integrin_beta Integrin_b_cyt Integrin_B_tail I-EGF_1 EGF_2
Other DBs
NCBI-GeneID: 112215590
NCBI-ProteinID: XP_024230500
LinkDB
Position
16
AA seq 797 aa
MDLKLLLISTLLGVICYSSAQQEGNECIKANAKSCGECIQVGAKCGWCMDPGFLKQGEAT
STRCDELESLRKRGCSSTKVENPRGSQRALKNKAVTNRNKGEGKLRPEDITQVQPQKLTL
SLRSGEPQSFNLKFKRAEDYPIDLYYLMDLSYSMKDDLENVKNLGTHLMLEMSKITTDFK
IGFGSFVEKTVMPYISTTPAKLLNPCTGDQNCTSPFSYKNVLKLTSNGQEFNTLVGQQHI
SGNLDSPEGGFDAIMQVAVCGEHIGWRNVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGKC
HLENNMYTMSHYYDYPSIAHLVQKLSDNNIQTIFAITEEFQPVYKELKNLIPKSAVGILS
ANSSNVINLIIDAYNSLSSEVILENSKLPEGVTIMYQSRCKNGVTGEGEMGRKCSNISIG
DEVSFTIRITAKQCPKMGKPETIKIKPLGFNEEVEITLNFICECDCHKDGIENSDICHNG
NGTYECGACRCNEGRIGRQCECSTNEVTSEDLDKSCRKDNGTDICSNNGDCVCGTCECKK
RENPEERYSGMFCECDNFNCDRSNNKLCGGHGHCECRVCICDANWTGSACDCSLDTTTCL
ASNKQICNGRGTCECGTCKCTDPKFQGPSCEICPTCPGVCTEHKECVQCRAFGTGEKKDT
CERDCSYFNLIKVKDRDKLPQPGQAFPLMHCKERDANDCWFYYTYAVNKTEKEVHVVETL
DCPAGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDTGENP
IYKSAVTTVVNPKYEGK
NT seq 2394 nt   +upstreamnt  +downstreamnt
atggacctgaaactacttctgatttcaacgttgttaggagtcatttgttacagcagtgct
cagcaagaagggaacgagtgcatcaaggctaatgccaaatcctgtggggagtgtattcaa
gtgggagcgaaatgtggctggtgcatggacccagggttcctgaagcagggtgaggccaca
tcgacccgctgtgacgagctggagtccctgaggaagagaggttgtagctccaccaaggta
gagaacccccgaggcagccaacgggccctgaagaacaaggctgtgaccaaccgcaacaag
ggagaaggaaaactccgaccagaggacatcacacaggtccagccacagaaactcaccctc
agcctcagatctggtgaaccccagtcttttaacctgaagttcaaacgggccgaggattac
cccattgacctctactacctgatggacctgtcctactccatgaaggacgatctggaaaac
gtcaagaacctgggaacacatctgatgctggagatgtcaaagatcacgactgattttaaa
atcggttttggttcctttgtagaaaagacagtgatgccttacattagcaccacgccagcc
aagctgctgaacccctgtactggggaccagaactgcacaagtcccttcagctacaagaac
gtcctgaagctgaccagcaatggacaggagttcaataccctggtgggacaacagcatatc
tctggaaacctggactcaccagagggaggcttcgatgccatcatgcaagtggctgtgtgt
ggtgagcacattggctggaggaacgtcacccgtctgctggtgttctccactgacgctggc
ttccactttgctggagatgggaaactgggagggatagttttgcccaacgatgggaaatgt
cacctggagaacaacatgtacacaatgagccactactatgactacccctccatcgctcac
ctggttcagaaacttagcgacaacaacatccagacgatctttgccatcacagaggagttc
cagcctgtttacaaggagttaaagaatctcattcctaaatctgcagtggggatactctct
gctaactccagcaacgttatcaacctcattattgatgcctacaattctctttcctcagag
gtgattctggagaacagcaagctaccagagggagtgaccataatgtatcagtcacgctgc
aagaacggagtgactggtgagggagagatgggaagaaaatgctccaatatctcaatcggt
gacgaggtgtctttcaccatacgcatcacagctaagcagtgtcctaaaatgggcaaacca
gagaccatcaagatcaaacccctagggttcaatgaggaggtggagatcactctgaacttc
atctgcgagtgtgactgtcacaaagatggcattgagaacagtgacatctgccacaacggc
aacgggacatatgaatgtggagcctgcaggtgcaatgagggccgtattggtagacagtgt
gagtgcagcaccaacgaggtgaccagcgaagacctggataagagctgccgtaaagacaac
ggtacagacatctgcagcaacaacggagactgtgtgtgtggaacctgtgagtgcaagaag
agagagaacccagaggagcgctacagcgggatgttctgcgagtgtgacaacttcaactgt
gaccgctccaacaacaaactctgtggaggacatggtcactgtgagtgcagggtgtgtata
tgtgatgccaactggacaggcagtgcctgtgactgttctctggacaccacgacctgcctg
gcttcaaacaagcagatctgtaacggacgaggcacctgtgagtgtggcacctgcaagtgt
actgacccaaagttccaaggccccagctgtgagatctgtcctacctgtccaggggtctgc
acagaacacaaggagtgtgttcagtgcagggcctttgggacgggggagaagaaggacacg
tgtgagagagactgtagctacttcaacctgatcaaggtgaaggacagggacaagctgcct
cagccaggacaggccttccccctgatgcactgtaaggagagggatgccaacgactgctgg
ttctactacacctacgctgtcaacaagacagagaaggaggtccatgtggtggaaacacta
gactgccctgcgggccctgacatcatccccatcgtggctggcgtggtggcgggcatcgtc
ctgatcggcctggctttgcttctcatctggaagctgctcatgatcatccacgacaggaga
gagttcgccaagtttgagaaggagaagatgaatgctaaatgggacacgggcgaaaaccct
atctacaagagtgctgttacgacagtggtcaaccccaaatatgaaggcaaatga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112216380
Entry
112216380         CDS       T05605                                 

Definition
(RefSeq) integrin beta-7-like isoform X1
  KO
K06590  integrin beta 7
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
otw04514  Cell adhesion molecules
otw04672  Intestinal immune network for IgA production
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112216380
   04514 Cell adhesion molecules
    112216380
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112216380
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112216380
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    112216380
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112216380
   04515 Cell adhesion molecules [BR:otw04515]
    112216380
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112216380
Cell adhesion molecules [BR:otw04515]
 Integrins
  Integrin beta subunits
   112216380
SSDB
Motif
Pfam: Integrin_beta EGF_2 Integrin_b_cyt I-EGF_1
Other DBs
NCBI-GeneID: 112216380
NCBI-ProteinID: XP_024232106
LinkDB
Position
16
AA seq 808 aa
MFTSPGKSLMSPACLAEGDSRTGRQRSGCVGAIQTMRKVWLAVVVLLIHFTSLRGSMGLD
GRCLSKPTCTECLRSLGCAWCKQKDFLAQGEPDERRCDREEALRKRHCSDGQVLNPQPAI
RSRAEEPMGSGVQLEPQNLHLKLRVGMPQSFDVRFRRAEVYPIDLYYLMDLSFSMKDDLK
NIRNLGREVATAMKNITSAVRIGFGSFVDKVVEPYVSTVEAKLANPCNEGYKSPCQPAFS
FKHVLKLTEDVEEFERKVSKQSISSNLDNPESGFDAIMQVAVCQDDIGWGNATRILVYTS
DDTFHLAGDGKLAGIYQPNDGKCHLNSNGLYNKDTVYDYPSVGHLSQVISANNIRLIFAV
TDQHIQNYEALSEMIPQSVVGLLEDDSSNVVQLISEACNNLSSSILLEHRDVPPGLGVSY
SSHCGDDRLAQGQDRGECRDVRTNQQVNFTVTVTSSSCLSKTESFIIKVQGINEELRVTV
ETLCDCDCQDSEEQSSQCHGNGTFHCGICSCDSGHTGQRCECETQPDKDTSLALETLCSP
AQTNSTGTPQCSGHGSCVCGQCICWGQHRGQHCQCDDISCNRHNNMICGGNGRCDCGNCE
CFHNYTGPACECSTLTDQCQTSNDGICSHRGQCECNECHCHPGFFGSHCTKPLAPCDAYR
ACVACMLHESAINMCHHSCGSAKPIRINGTQSFTCQDDTVRFNVELIINTGDIFVYYTDT
PRGIDPWIINMGKAVVGIVLLGVIMIIIYRLMLEVSYQRECRRFLKNKENICWEDTQNPL
FQEAKTTFTHPMHVLEPDADCATSTFGK
NT seq 2427 nt   +upstreamnt  +downstreamnt
atgttcacttcacctgggaagtccctgatgtccccagcctgtcttgcagaaggagattcc
agaactgggagacagagaagtggatgtgttggtgccatccagacaatgagaaaggtgtgg
ctggctgtggtggttcttctgatacacttcacttcactgagaggatctatgggcctggat
ggaagatgcctgtctaagcccacctgcactgagtgtctgagaagccttggctgtgcctgg
tgtaaacagaaggatttcctggcgcaaggggagcccgacgagcgtcgctgtgacagggag
gaggcactgagaaagagacactgctctgacggacaggtcctgaacccccagcctgcaata
cggagcagggcagaggagccaatggggagcggggtccagctagagccacagaacctccac
cttaagctaagagtcggcatgccccagtcatttgatgtgaggttcaggcgtgcagaggtt
tatcccatagacctgtactacctgatggacctgtctttctccatgaaagatgacctgaag
aacattaggaatctgggacgggaggtggccactgccatgaagaacatcaccagtgctgtc
aggataggctttggttcctttgtggataaggtggtggaaccctacgtcagtacagtggag
gccaaactggccaacccatgcaacgaggggtacaagagcccctgccagcctgccttcagc
ttcaaacatgtactgaagctcactgaggacgttgaagagtttgagagaaaggtgagcaag
cagagcatctccagtaacctagacaacccagagtcaggctttgacgccatcatgcaggtg
gctgtctgtcaggatgacattggctggggtaatgcaactcgtatcctggtctacacctca
gacgataccttccacctggcaggtgatgggaagcttgctgggatctaccaacctaacgac
gggaaatgccacctgaatagcaatgggctctataataaggacaccgtttatgactatccc
tcagttggacacctatctcaggtcatatcagccaataacatcaggctgatctttgcagtg
acagaccagcatattcaaaactatgaggcactcagtgagatgatcccccagtcggtggtg
ggcctcctggaggatgactccagcaacgttgttcagctcatctctgaggcctgcaacaac
ctatcgtcctccatcctcctggagcaccgtgacgtcccaccaggcctgggggtctcctac
agctcccactgtggtgatgacaggctagctcaggggcaggacagaggggagtgcagagat
gtcagaaccaatcaacaggtcaatttcacagttactgtgaccagctcgagctgtctgtcc
aagacagagtctttcatcatcaaagtgcagggtatcaatgaagagctgagggttaccgtg
gagacgctgtgtgactgtgactgtcaggactccgaggaacagtcatcccagtgtcatggc
aatggaacattccactgtggtatctgtagctgtgattcaggacacacaggccagcgttgt
gagtgtgaaacacagccggacaaagacaccagtctggccttagagaccctgtgttcacct
gcacagacaaacagcacaggcacaccacagtgcagcggccatgggagctgtgtgtgtggc
caatgtatctgctggggccaacacaggggccaacactgccagtgtgacgacattagctgt
aaccgtcacaacaacatgatctgtggaggtaatgggaggtgtgattgtggtaactgtgag
tgtttccacaactacacaggccctgcatgtgaatgctctaccctcacagatcagtgccag
accagtaacgatggaatctgctctcaccgaggacagtgtgaatgtaatgaatgccattgt
caccctggtttctttggcagccactgcaccaagcccctggcaccatgtgatgcataccgg
gcctgtgttgcttgcatgttacatgaatcagccataaacatgtgtcaccattcctgtggc
tctgccaagcctatccgcatcaatgggactcaatcattcacctgtcaggatgatactgta
cgttttaatgtggaactcatcataaatactggtgacatctttgtctactacacagatact
ccaagagggattgacccatggattatcaacatggggaaggcagtggtaggaatcgtttta
ctgggtgtcatcatgataataatttaccggctgatgttagaagtgtcctaccagcgggag
tgtagaaggttcctgaagaataaggaaaatatctgctgggaagatactcaaaatccactg
ttccaagaggccaagacaacattcacccaccccatgcatgtgttggagccagatgcagat
tgtgctacatcaacctttggaaaataa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112217664
Entry
112217664         CDS       T05605                                 

Definition
(RefSeq) integrin beta-7-like isoform X1
  KO
K06590  integrin beta 7
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
otw04514  Cell adhesion molecules
otw04672  Intestinal immune network for IgA production
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112217664
   04514 Cell adhesion molecules
    112217664
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112217664
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112217664
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    112217664
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112217664
   04515 Cell adhesion molecules [BR:otw04515]
    112217664
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112217664
Cell adhesion molecules [BR:otw04515]
 Integrins
  Integrin beta subunits
   112217664
SSDB
Motif
Pfam: Integrin_beta Integrin_b_cyt EGF_2 I-EGF_1
Other DBs
NCBI-GeneID: 112217664
NCBI-ProteinID: XP_024233888
LinkDB
Position
2
AA seq 763 aa
MVGIFMLGTFLLYCVGQNQIQGVPQGCVSQPSCSACLRSPGCAWCKHKDFLKSGESSERR
CDTAESLRTRRCEQMDIINPRLDPVFLKNNDLSSNSDNVVQLKPQNLLFKLRVGVPQTFN
VSFKRAEGYPIDLYYLMDLSFSMKDDLDTIKNLGQDILSALKKVTQKVRIGFGSFVDKVA
LPYVSQVKAKKNNPCPNRLNICQPAFSFQNILRLTEDVDEFKTRVSDQIISGNLDSPEAG
FDAIMQAAVCQSVIGWNNVTRILVYTSDDTFHIAGDGRLAGIFEPHDGMCHLNGTGFYDG
TKYDYPSVGQLARVLAANNIQLIFAVTEDSVAAYKALSKLIPQSVVGVLKNDSSNVVLLI
SEAYSNLSSTILLEHHEAPSDLDVTYRSHCTPEKGDNTHWQRRGECMNVKLNQQVNFTVS
LNISTCLKEKQTFSLKLQGISETLKVSVETLCDCDCQDREEQSSHCNEIGTLTCGICSCD
EGHLGQRCECERPKDMTSAESMAATCRQDNSSQLCSGLGSCECGMCMCQGTHRGNFCQCD
DNICARHNNMLCGGNGQCECGTCKCNANYTGSACDCSTLTDQCRTVGKLCNGQGTCQCNQ
CQCNKDFFGINCSKIANACPKFLDCVTCELDNKKISGLKSNCSQLCGSVKLTWMKGPQEF
PCSKDTISYKVELLPDGNILIFYADLPRSIDKTYVIIGSSVSSIIFIGIAVILISRLMLE
LHYRREYDSFLKAKEAEVWQDMKNPLFQDATTVVVNPMHVQED
NT seq 2292 nt   +upstreamnt  +downstreamnt
atggttgggatctttatgttagggacctttctcttgtactgtgtgggacagaaccaaatt
caaggggtcccccaaggatgtgtgtcccagccctcatgttcagcttgcctgaggagccct
ggatgtgcctggtgcaaacacaaggacttcctgaagtctggagagtccagtgagcggagg
tgcgacactgctgagtctctgaggaccaggcgttgtgagcagatggacatcatcaacccc
cgattagatccagtctttctgaagaataatgatctcagcagcaactcagacaatgtggtc
cagcttaagccacaaaacctcctcttcaaactcagagtcggagtccctcagaccttcaat
gtctcattcaagagagccgagggctaccccatagacctgtattacctgatggacctgtcc
ttctccatgaaggacgacctggacaccatcaagaacctaggccaggacatcctctctgca
ctgaaaaaagtcacccagaaggtccgcattggcttcggctcatttgtagacaaggtggct
ctgccatacgtcagccaggtgaaggccaagaagaataacccctgtcccaaccgcctgaac
atctgtcaacctgccttcagcttccaaaatattctgagactcacagaagacgtggacgag
ttcaagaccagggtcagcgaccagatcatctctggaaacctggactcccccgaggcaggc
tttgacgcaatcatgcaggcagctgtctgccagagtgtgattggttggaacaatgtcacc
cggatcctggtctacacgtcagatgacaccttccatattgccggggatggcaggctggct
ggtatattcgagcctcatgacggcatgtgccatctgaatggcactggcttctacgatggc
actaaatatgactacccatcggttggccagcttgccagggtcctggcagccaataacatc
cagctcatctttgctgtcaccgaggacagtgttgctgcctacaaggcattgagtaaacta
atccctcagtcagtggtgggggtcctgaagaacgactccagcaacgtggtcctgctcatc
tcagaggcctacagtaacctgtcctccaccatcttactggagcaccatgaagctccctca
gatctggacgtgacctacagatcccactgcacccctgaaaaaggggacaacacccattgg
cagaggaggggcgagtgcatgaacgtcaagctcaaccagcaggtcaacttcacggtaagc
ctgaacatttcaacatgtctaaaggagaagcagacgttttccctaaaactgcagggcatc
agtgagaccctgaaggtctctgtggaaaccctgtgtgactgtgactgccaagacagagaa
gagcagtcctcacactgcaatgaaattggaacgctcacctgcggcatctgcagctgtgat
gagggtcacctgggtcagaggtgtgagtgtgagcggcctaaggacatgacctctgccgaa
tctatggccgcaacatgtcgccaagacaactcctcgcagctgtgcagcgggcttgggagc
tgtgagtgtggcatgtgtatgtgtcagggcacccaccgtggcaatttttgccaatgtgat
gacaacatctgtgcacgccacaacaacatgctctgcggtggtaatgggcagtgtgaatgt
ggaacatgtaagtgtaatgccaattacacaggctctgcatgtgactgttccaccctcacc
gaccagtgcaggactgttgggaagctgtgcaatggccagggaacatgccagtgtaaccag
tgccagtgcaacaaagacttctttggcataaactgctcaaagattgctaacgcatgccca
aaattcctggactgtgtgacatgtgaattggacaataaaaagattagcggcctaaagagt
aactgcagccaactctgtggctcagtcaagctcacttggatgaagggaccccaggagttc
ccctgcagtaaagacaccatctcctacaaagtggagctgttgcctgatggcaacatcctg
atcttctacgcagatctgcctcgctctattgacaagacttacgtgatcatcggcagctct
gtgtccagcatcatcttcatcggcatcgcagtgatcctcatcagcaggcttatgctagag
ctccactaccggagagagtatgacagcttcctcaaagcaaaggaggccgaagtctggcaa
gatatgaaaaatcccttgttccaggatgccacgaccgtggtcgtgaaccccatgcacgtt
caagaggactga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112223770
Entry
112223770         CDS       T05605                                 

Definition
(RefSeq) integrin beta-3-like isoform X1
  KO
K06493  integrin beta 3
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04145  Phagosome
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
otw04810  Regulation of actin cytoskeleton
otw05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112223770
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    112223770
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112223770
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112223770
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    112223770
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112223770
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112223770
   04515 Cell adhesion molecules [BR:otw04515]
    112223770
   04090 CD molecules [BR:otw04090]
    112223770
Membrane trafficking [BR:otw04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    112223770
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112223770
Cell adhesion molecules [BR:otw04515]
 Integrins
  Integrin beta subunits
   112223770
CD molecules [BR:otw04090]
 Proteins
  112223770
SSDB
Motif
Pfam: Integrin_beta Integrin_B_tail Integrin_b_cyt PSI_integrin I-EGF_1 EGF_2 BNR_6
Other DBs
NCBI-GeneID: 112223770
NCBI-ProteinID: XP_024242729
LinkDB
Position
24
AA seq 805 aa
MGRPTHITQRIQLWIGYFVLFAVTDVLGSNICTSRGASTCKQCLAVHPTCAWCSQEDFGQ
GVAGSSRCDLKRNLLVAGCAPPTALEFPTSKLQVKEDRPLSNKAAGDTADATQIQPQRLH
ITLRPDDSKRFTVKVRQVEDYPVDLYYLMDLSFSMNDDLFRLRTLGKGLAKEMGRTTSNL
RMGFGAFVDKPLSPYMYISPKEALLNPCHGINTTCLPQFGYKHVLSLTEEVGRFTEEVKK
QIVSRNRDAPEGGFDAIIQAAVCNEKIGWRQGASHLLIFTTDAKTHVALDGRLAGIVQPN
DGKCHLNSENMYSMSTIMDYPSLALITEKMSENNINLIFAVTSPVVPLYQNYSELIPGTT
VGTLSNDSGNVIQLILNAYAKIRSVIDMETQGVPEELSLSFNATCLNGEVIPGIKSCSGL
KIGDTVSFSVEARARGCPKDKRKTFVIKPVGFKDSLTVTVTFECECKCQARAEPLSPVCN
NGNGTYECGICLCHPGRLGPRCECAEGDYSTTEQDRCSVPSTVGIGGAGGPGAAVCTGRG
DCVCGQCVCHSSDFGKVWGKLCECDDFNCLRYKGELCSGHGTCDCGFCQCDSDWQGENCN
CSRRTDTCMSSLGLLCSGRGQCVCGACECTQPGAYGATCDKCPTCPDACTMKKECVECKH
FKRGKLFDDNTCTRICRDEIQLVDDLEFHDKNAVNCTYKDEDDCVERFQYYEDASGKSIL
FVVKEPDCPKGPDILVVLLSVAGAILVLGLAGLLIWKLLVTIHDRREFAKFEEERARAKW
DTVHNPLYKGATSTFTNITYRGNKE
NT seq 2418 nt   +upstreamnt  +downstreamnt
atgggtaggcctactcacataacgcaaaggattcaactttggataggttatttcgtttta
tttgcagttactgatgttttgggttccaacatctgtacatcccgaggggccagcacatgt
aagcagtgtctggctgtacatcctacctgtgcgtggtgttcccaagaggactttgggcag
ggtgtggcaggctcgtctcgttgtgacctgaagcgtaacctattggtggcgggctgtgct
cctccgaccgcccttgagttccccaccagcaagctgcaggtgaaggaggaccggcccctc
agcaacaaggcagccggagacacagccgacgccacgcagatccaacctcagagactccac
atcaccctcagaccagatgactccaagcggttcacagtgaaggtgcgccaggtggaggac
tacccggtggacctgtattacctcatggacctgtccttctccatgaacgatgacctgttc
cgcctccgcaccctggggaaaggcctggccaaggaaatgggacgcaccaccagcaacctg
cgtatgggcttcggagccttcgtggacaagccactgtcaccttacatgtacatctccccc
aaggaggccctgctcaacccctgtcacgggatcaacaccacctgcctgccccagtttggc
tacaagcatgtgctgtctctgactgaggaggtgggccgcttcactgaggaggtgaagaaa
caaattgtgtccaggaacagagatgcccccgagggaggcttcgacgccattatacaggct
gccgtgtgtaatgagaagatcggttggcgtcagggtgcctctcacctcctgatcttcacc
accgatgccaagacccacgtggcgcttgatgggcgcctggcgggtatcgtgcagcccaat
gacgggaagtgccacctcaactcagagaacatgtacagcatgtctactatcatggactac
ccgtcactggctctgatcacagagaagatgtcagagaacaacatcaacctcatctttgcc
gtcaccagtcctgtggtgcccctctaccagaactacagtgagctgattcctgggaccact
gtgggcaccctgtccaatgactcaggcaatgtcatccagctcatattaaatgcctatgcg
aaaatccgctcagtgattgacatggagacacagggggttcctgaggagctgtctctctcc
ttcaacgccacctgtctcaatggagaggtcatccctggcataaaatcctgctctggactc
aaaataggagacacggtctccttcagcgtggaggcgcgggcgcgtggctgccccaaggac
aagcgcaagacgttcgtcatcaagcctgtgggcttcaaggactctctgaccgtcactgtc
accttcgagtgcgagtgcaagtgccaggcccgcgccgagccactcagccctgtctgtaac
aatggcaacggcacctacgagtgtggcatctgcctgtgtcacccggggcgactggggccg
cggtgcgagtgtgccgagggtgactacagcaccacggaacaggaccggtgtagtgtcccc
tccaccgtgggcattgggggtgcagggggtcctggggcagcagtgtgcactgggaggggc
gactgcgtgtgcgggcaatgcgtgtgccacagcagcgactttggcaaggtgtggggcaag
ttgtgcgagtgcgatgacttcaactgcctgcgctacaagggcgagctgtgctcaggccac
ggcacctgtgactgtgggttctgccagtgtgactcggactggcagggggagaactgtaac
tgctcccgccgtactgacacctgtatgtccagccttggcctgctgtgtagtggccggggc
cagtgtgtgtgcggggcctgcgagtgcacccagccgggggcctatggggccacctgcgac
aagtgccccacctgccccgatgcctgcaccatgaagaaagagtgtgtggaatgtaagcat
ttcaagcgagggaagctgtttgatgacaacacctgcacccgcatctgcagagacgagatt
cagctggtggacgaccttgagttccatgataaaaatgctgtgaactgcacctataaggat
gaggatgactgtgtggagcgcttccagtattatgaggacgccagtggcaagtccatccta
tttgtggtcaaagagcccgactgccctaagggtccagacatcctggtggtgctgctgtcc
gtagccggggccatcttggttctgggtctggccggcctgctcatctggaagctgctggtc
accattcatgaccgccgcgagttcgccaagtttgaggaggagcgtgctcgcgccaagtgg
gatacggtccataaccccctgtacaaaggagccacctcaaccttcacaaacatcacatac
agaggcaacaaggagtga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112224778
Entry
112224778         CDS       T05605                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: integrin beta-4-like
  KO
K06525  integrin beta 4
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112224778
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112224778
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112224778
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112224778
   04515 Cell adhesion molecules [BR:otw04515]
    112224778
   04090 CD molecules [BR:otw04090]
    112224778
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   112224778
  Exosomal proteins of bladder cancer cells
   112224778
Cell adhesion molecules [BR:otw04515]
 Integrins
  Integrin beta subunits
   112224778
CD molecules [BR:otw04090]
 Proteins
  112224778
SSDB
Motif
Pfam: Integrin_beta fn3 Integrin_B_tail Calx-beta PSI_integrin Pur_ac_phosph_N SEA EGF_2
Other DBs
NCBI-GeneID: 112224778
NCBI-ProteinID: XP_024244220
LinkDB
Position
25
AA seq 1998 aa
MREMGRWTLNLLVGVVLLAVLTASCYAEKVNHCLATRASTCSECIQSGKGCAYCPDEIFD
GPRCDLHDNIISRGCNSAVTAKSSMSMERNEQIDMLLKQSQVAPQEMSMTLLPGEEREIE
MEVFEPAKGPLDLYILMDFSNSMEDDLDNLKRMGAELAALVGKLSDDYTIGFGKFVDKVV
EPQTDMRPSKLAKPWPNSDPPFSFRHVITLTPDLRFFTEKLQKERISGNLDAPEGGFDAI
LQAAVCGEKIGWRSHATHLLVFSTESAFHYEADGANVLAGIMPRNDEQCHLDPEGKYTED
TRQDYPSVPTLVRLLGKHNIIPIFAITNHSFTYYQKLYEYFPIAELGLLQEDSANILNIL
EKAFENIRSKISIRAEDRPKAIEAQVLSYSGSVAQAGTFKVKPGQIMEARWLQKQHPLAL
YSHGDLVCGKCRSTXGWLGPFCNCSTSASPVAGSSCLGPDVGEPCSGRGDCLCGTCVCYN
TDQYEGPLCQFDKSQCQRYGGFLCNDRGRCFMGQCACAEGWEGPACECPMSNQTCLDTKG
GVCNGRGVCKCGRCECQDSGLAMTPTCEANFQAQLGMCEDKRSCVQCQAWKTGEKKDSDQ
CDQCQFKVVMVDELKENKEVIEACSFRDEDDDCTYHYTVDYPEEQTDKELEVQVLKKKDC
PPAGFLWLIPLIMFLMLLLGLLLLCCWKYCACCKACLALLPCCGRGRMVGFKEDQYMLRQ
SLLTSDHLDTPLVRTGPPKSTDVVRWKITDNVHRSPNHPLAQVQPNPKETIQFPLSLRLN
RLFTESLSHPDARDTEMLRREVDDNLNEVYKHVPGAQRVQNTKFRLQRNAGKRKDHTIVD
TVVSAPRSSYPDIVKLTEKNVQSGNFQDLKVVPGYYTVATDREAAGAVEFQEGVETVDVR
VPLFIKEDDDDKKQLQVEAVDVPLGIAEIGKRFVNITIIKEHAKSIMSFLQPSYTYSRQD
RVANIPISREIIEDGHTQVTYRTRDLTAKDKKDYVTVDGELSYGPGETQQTVPVRLLELG
EGDGLLKDTQVKQFVMDLSNPRQGAKLGRYPRTTVTITDQPEPSVMMFMKSTQNFSTADP
TYSIPVVRTRNQEGPATVHWKTRNAKRFELSGPLKFSPGETEKNIVIDPRPHPGPVKPEI
FQLELFDPSTNAAVGERKTTMVTITDGALPEIAQKQQQGKDFINRTAMSPGGRLFSPTNV
KANATGPRNIRLNWDPLGSPLGYKVKYWIYGDPETDGQVIDVKTTHAELTNLYPFCDYEM
KVCGYNALGNGNYSDMVPCQTLEDVPSEPGRLAFNVISPTVTQVSWAEPAETNGVITNYE
VLYTPINDNTKPMGVAKKVKIDNPKKRMLLIENLQSAQTYCYKVRAKNSVGWGPFREATI
NLASQPVRPMSSEFLQGYCVAVLWKINPQMNQCFIKLVGSKLDLRSVSWKRHVDVIPYRL
STDTDTSTDETPRPSRAQTPSLKDQMNGRWEQNFLFPGGNNSMSRSANMSSSSYSQLSPM
STLSSNHRGGAGGSMTTESSTTYLSGQGGNSLSRTQVIGGGTRTENVVMRKRSENRGYYE
YDDNIRDSIVIGDLSSGLSGYTDGKSTYGFSPTQTQYSYSMSRVLRGRTQSEDVNDALLN
LDRVLQDSRLASGVPDTPTRLVFSALGPTALKVSWQEPHCDRDVLGYCVLYQLLNGGDMK
RIDVSSPAENSVVVQDLLPNHSYLFKVKAQSLEGWGPEREGVITIESAVNPNSPLSPMPG
SPFTLSTPSAPGPLVFTALSPEALQLSWDKPRKPNGDILGYVVTCEQLHGGGDMRSFQVS
GDSAETSLTVPDLSENMPYKFKVQARTTQGFGPEREGIITIESQDGGSTSQIGGIGGMSQ
LGGLGGMSQIQGLGGMSQLGGLGGMSQIEGLGGMSQLGGLGGMSQIEGLGGMSQYSSQSL
TKRDVFQLPTEVSTHSNVTHTMINDPYFSGDGMMMTSQHTETSGMVTRHVTKEVVQRSMQ
VAGSSSVTKKVERSFYEA
NT seq 5997 nt   +upstreamnt  +downstreamnt
atgagggagatggggagatggacattaaatctcttggtgggggttgtacttcttgctgtc
ctcacagccagttgctacgctgaaaaagtgaatcactgtctggctacgagggctagcacc
tgttcagaatgtattcagtcagggaagggctgtgcctactgtccagatgagatctttgat
ggtccccgctgcgaccttcatgacaacatcataagccgcggctgtaatagcgcggtgaca
gccaaaagcagcatgtcgatggaaagaaatgagcagatcgacatgctgttgaagcagtcc
caggtagctcctcaggagatgtctatgactctgctgccaggggaggagagggagatcgag
atggaggtgtttgaaccagctaaaggacctctggacctctacattcttatggacttctcc
aactccatggaggacgacctggacaacctcaagagaatgggtgctgagctggctgcgttg
gtagggaagctgtctgatgattacaccatcggtttcggcaagtttgtggacaaagtggtg
gagccccagacagatatgagaccatccaaacttgccaagccttggcccaacagtgaccct
cccttctcgttccgtcatgtgatcactctgacccctgacctgcggttcttcaccgagaag
ctgcagaaggagaggatctcagggaacctggacgctccagaggggggcttcgacgccata
ctgcaggctgcagtctgcggggaaaagatcggctggcgtagccatgccacccacctcctg
gtcttctccaccgagtcggccttccactacgaggcggatggtgccaacgtgctggcgggc
atcatgccacgcaacgacgagcagtgccacctggaccccgaggggaaatacacagaggac
accaggcaggactacccctctgtgcccaccctggtccgcctgctgggcaaacacaacatt
atccccatcttcgccatcacaaaccactcctttacctattatcagaagctttatgagtat
ttccccatcgctgagttgggtctgctacaggaagactctgctaacatcctcaatatcctg
gagaaagcctttgagaatatccgctctaagatcagcatccgtgctgaggacaggcctaaa
gctatagaagctcaggtcctatcgtacagtggcagtgttgcacaggctggaaccttcaaa
gtcaagcctggacaaataatggaggcgcggtggcttcaaaaacagcacccccttgctttg
tacagccacggggacctggtctgtgggaagtgccggtctacgngtggctggctgggtccg
ttctgtaactgctcaaccagtgcgtcgccggtcgcgggtagttcctgtctgggtcctgac
gtgggggagccgtgttctggccgaggagattgcctgtgtggaacgtgtgtgtgttacaac
accgaccagtacgagggacccctctgtcagtttgacaagtcccagtgtcaacgatacgga
ggcttcctctgcaacgaccgtggtcgttgcttcatgggtcagtgtgcgtgtgcagagggc
tgggagggaccggcctgtgagtgtcccatgagcaaccagacctgtctggacactaaaggg
ggtgtctgtaacgggcgtggtgtgtgtaagtgcggtcgctgtgagtgccaggactctggc
ctggccatgacccccacctgcgaggctaacttccaggcccagctggggatgtgtgaggac
aagaggagctgtgtccagtgtcaggcctggaagaccggagagaagaaggacagcgaccag
tgtgaccagtgccagttcaaagtggtcatggtggacgagctcaaggaaaataaagaggtg
attgaggcgtgtagtttccgcgacgaggatgacgactgtacgtaccactacaccgtggac
taccctgaggagcagactgacaaggaactggaagtccaggtgcttaaaaagaaagactgt
ccccctgctggcttcctgtggctgatccccctcatcatgttcctcatgctactgctgggt
ctactgctgctctgctgctggaagtactgcgcctgctgcaaggcatgtcttgctctgctg
ccatgctgtggaagaggccgtatggttggctttaaggaggaccagtacatgctccgccaa
tccctgctcacctctgaccacctggacacgcccctagtgaggaccggcccgcccaagagc
accgacgtggttcgctggaagatcaccgacaatgtgcaccgatcacccaatcacccgctg
gcgcaggtccagcccaaccccaaagagaccatccagttccctctgtccctgcgtctgaac
aggttgttcacagaaagtctgtctcaccccgacgccagagacacggagatgctgcgcagg
gaggttgatgacaacctgaatgaagtgtacaagcatgttcctggagcccagagggttcag
aataccaaatttagattacagaggaatgctggtaaaagaaaagaccacacaattgtagac
acagtcgtgtccgctcctcgctccagctaccccgacatcgtcaaattgactgagaaaaac
gtccagtctggaaacttccaagatctcaaagtggtgccgggctactacacagtggccaca
gacagagaggcggctggtgccgtggagttccaggagggggtggagacggtggatgtgcgc
gtgccgctcttcatcaaggaagatgacgatgataagaagcagctgcaggtggaggcggtg
gacgttcctctgggcatcgctgagatagggaaacgcttcgtcaacatcaccatcatcaaa
gaacacgccaagagtattatgtcgttcctgcagccttcctacacctacagccgacaggac
agagtggctaacatccccattagcagagagatcatagaggacggacacacacaggtcacc
taccgcacccgagacctcaccgccaaggacaagaaggactatgtgacagtggatggggaa
ctgtcctacgggccaggggagacccagcagactgtcccggtgcgtctattggagctggga
gagggagacggtctgctgaaggacacacaggtcaaacaatttgtcatggacctcagtaac
ccaagacagggagccaagctgggacgctaccccagaaccaccgtcaccatcactgaccaa
ccagagcccagtgtgatgatgtttatgaagagcacccagaacttctccacagctgaccca
acctactccatccccgtggtccgcacacgcaaccaggaggggcccgccaccgtccactgg
aagacccgcaatgccaagcgcttcgaactgtctggtcccctcaagttttctcccggggag
actgagaagaacatcgtgatcgacccacgccctcaccctggaccggtcaaaccagaaatc
ttccagctggagttgtttgaccccagtacgaacgccgcggtcggggagaggaagacgaca
atggtcacgattactgatggagcattaccagagattgcccagaagcagcagcagggtaag
gacttcatcaaccggacagccatgtcccctggtggtcgtctcttctctcccaccaacgtc
aaggctaatgccactggcccacgaaacatccgtctcaactgggaccccttaggaagcccc
ctgggctacaaggtgaagtattggatctatggggaccctgagactgatggccaggtgata
gatgtgaagaccacccacgctgagctgaccaacctgtaccccttctgtgactacgagatg
aaggtgtgtggctacaacgccctgggaaacggaaactacagcgacatggtgccctgtcag
accctggaggacgtccccagtgagcccggtcgtcttgcgttcaacgtcatcagtccaacc
gtcactcaggtcagctgggcggagcctgccgagaccaacggtgtcatcaccaactacgag
gtcctctacacacccatcaatgacaacacaaagccgatgggtgtagctaagaaggttaag
atagacaaccctaagaagaggatgttgctaattgagaacctgcagtcggcccagacctac
tgctataaggtccgggctaagaacagtgttggctggggtccattcagagaggcaaccatc
aacctggcctcacagcccgtcagacccatgtccagtgagttcctccaagggtactgcgtt
gctgttttgtggaaaataaatcctcaaatgaaccaatgctttatcaagttggtgggttcc
aagctggacctgcgttcggtgtcctggaagaggcatgtggatgtgatcccctaccgcctc
agcacagacacagacaccagcactgacgagactccccggcccagtcgagcacagacccca
tccctgaaagaccaaatgaacggcaggtgggaacaaaacttcctgttccccgggggaaat
aattccatgtcgcgcagtgccaatatgtcgtcttccagctacagccagctgtctcccatg
tccaccctcagctccaaccacagaggaggggccggaggttccatgactacggagtcctcc
acaacatacctctctggacaaggagggaactcgctctcccgcactcaggtgatcgggggc
gggacgcgcacagagaatgttgtcatgaggaagcggtcagagaaccgaggttactatgag
tacgacgacaacatccgagattccatcgtcataggagacctgtccagtggattgtcggga
tacacagacggcaaaagtacttatggcttcagccccactcagacacagtacagctacagt
atgtctcgggtcttgcggggcaggacccagtctgaggatgtcaacgatgcgctactgaat
ctggacagggtgctccaggactctcgtttggcctctggggtccctgacacccccaccagg
ttggtgttctctgccctgggccccacggccctgaaggtcagctggcaggagccccactgt
gacagggatgtgctggggtactgtgttctctaccagctactcaatggaggtgatatgaag
cgtatagacgtgtccagcccagcagagaactctgtggtggtgcaggacctgctgcctaac
cactcctacctgttcaaggtgaaggctcagagtctggagggctggggaccagagagagag
ggagtcatcaccatagagtcagccgtcaaccccaacagcccactcagtccaatgccaggt
tctcccttcactctcagcacccccagtgctccaggccccctggtattcacagctctgtcc
cccgaggcactgcagctgagctgggacaaaccccgcaaacccaacggagatatcctgggc
tacgtggtcacctgtgaacagctgcacggaggaggtgacatgcgttccttccaggtgagc
ggtgacagcgctgagaccagtctgacggttccggacctgagtgagaacatgccatacaag
ttcaaagttcaggccaggacgacgcagggcttcgggcccgagagggagggtatcatcacc
atcgagtctcaggatgggggtagcacgtctcaaataggtggaataggtggtatgtctcaa
ctaggaggcctaggtggtatgtcccaaatacaaggcctaggaggtatgtctcaactagga
ggcctaggtggtatgtcccaaatagaaggcctaggaggtatgtctcaactaggaggccta
ggtggtatgtcccaaatagaaggcctaggaggtatgtctcagtacagcagtcagtccttg
accaagagagatgtgttccaactgccgacagaggtcagcacccacagcaacgtcacacac
accatgatcaacgacccctacttctcaggggacggtatgatgatgacttcccagcacaca
gagaccagcggcatggtaacccgtcatgtgactaaggaggtggtccagaggagcatgcag
gtggccggctccagcagcgtcaccaagaaggttgagaggtcgttctatgaggcttga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112225600
Entry
112225600         CDS       T05605                                 

Definition
(RefSeq) integrin beta-5-like isoform X1
  KO
K06588  integrin beta 5
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04145  Phagosome
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112225600
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    112225600
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112225600
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112225600
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112225600
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:otw04515]
    112225600
Membrane trafficking [BR:otw04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    112225600
Cell adhesion molecules [BR:otw04515]
 Integrins
  Integrin beta subunits
   112225600
SSDB
Motif
Pfam: Integrin_beta Integrin_B_tail Integrin_b_cyt PSI_integrin I-EGF_1 EGF_2
Other DBs
NCBI-GeneID: 112225600
NCBI-ProteinID: XP_024245460
LinkDB
Position
26
AA seq 804 aa
MWNPWQLLYRTALGCMILEIFIHNVAQGLNVCMSGSALSCEECLIIHPSCAWCAQEKFGS
ARTLMSRCDLRQNLQKRGCEAHHMESPRSSTKVVKSEPLSSKGSGPTQYDVIQIMPQKIS
LSLRPGDQTSFKVQVRQVEDYPVDLYYLMDLSLSMKDDLDTIRNLGTKLADEMRKLTSNF
RLGFGSFVDKNMSPFSYTARKYQDNPCNGYKLFPSCVPSFGFRHLLSLTDKVDRFNEEVQ
KQMVSRNRDAPEGGFDAILQAAVCKERIGWRKEAFHLLVFATDDVPHLALDGKLGGLVQP
HDGECHMNEKNEYSGSTNMDYPSLALLGEKLAANNIYLIFAVTKRLYVIYKNFTALIPGT
TVEILDQDSKNIIQLIVNAYNSIRSKVELTVWDQPEDLSLSFTATCQDGQPLPGLRKCAD
LKIGDTVSFDVSIDARGCPAPGTQQSFTIKPVGFKDRLEVSVDYRCACGCTDQTQANSTH
CSSIGQYTCGICHCDPGYLGARCECQEGEAGSMYLSACRQAEGMQICGGRGECSCNQCLC
YESEFGKIYGTFCECDDFSCARHKGILCSGHGECHCGECKCHAGYIGDNCNCSTDTSSCV
SDDGQICSGRGSCACGRCQCTEPGAFGDTCEKCPTCPDACGTKRECIECRLFSSGRLSDN
QTCQRLCKDEIITVETLKTDDPNAVLCLYKTENECVMKFTYSEHANGMSVLTALKEPECG
AAPDAMTVLLAVVGSILLVGIVLLAIWKLVITVHDRREFARFQSARSRARYEMASNPLYK
QPISNDYVETDFSMYSKSYNGAAH
NT seq 2415 nt   +upstreamnt  +downstreamnt
atgtggaacccgtggcagttgttgtaccgtacagctcttggctgcatgattctggaaata
tttattcacaatgttgcacaaggtctgaatgtgtgtatgagtggcagcgctctgtcttgt
gaagaatgcctcatcatccatccaagctgtgcctggtgtgcacaagagaagtttggcagt
gcaaggaccctgatgtcgcggtgtgacctgcgtcagaacctgcagaagaggggctgtgaa
gcccatcatatggagagtccccgtagcagcaccaaggtagtgaagagcgaacccctcagc
tccaaaggctccgggcctacccagtatgatgtcatccagatcatgccccagaagatctcc
ctcagtctccgaccaggtgaccagacatcattcaaagtgcaggtgcgtcaagtggaggac
tacccagtggacctgtactacctgatggacctgtctctgtccatgaaggatgacctggac
accatcaggaacctggggaccaaactggccgatgagatgaggaaactcaccagcaacttc
agactgggcttcggatcctttgtcgacaagaacatgtcccccttctcctacacggcccgc
aagtaccaggacaacccctgcaatggatacaaactgttccccagctgtgtcccctccttc
gggttccgccacctcctctccttgactgacaaagtggatcgcttcaacgaggaagtacag
aaacagatggtgtctcgcaacagggacgctccggagggaggcttcgatgccatcctgcag
gctgccgtctgtaaggagaggataggctggaggaaggaggccttccacctgctggtgttt
gccacagacgatgtgcctcacctggccttggacggtaagctgggagggctggtccagccc
catgatggggagtgccacatgaatgagaagaatgagtacagtggctccaccaacatggac
tacccctctctggctcttctgggagagaagctggctgcaaacaacatctatctcatcttc
gctgtgacaaaaaggctgtatgtcatttacaagaatttcacagcactgatacctggaacc
acagtggagattctggatcaggactccaagaacatcatacaactcatcgttaacgcctac
aatagcatccggtccaaggtggagctgaccgtgtgggatcaacctgaagacctcagtctg
tccttcactgccacctgtcaggacggacaacctctcccaggcctcaggaagtgtgccgac
ctcaagattggagacacagtgtccttcgacgtgagtatagacgccagaggctgccccgcc
ccaggtacccagcagagtttcaccatcaagcctgtgggcttcaaggatcgtctggaggtg
tctgtggactaccgctgtgcctgtggctgcaccgaccagacccaggctaacagtacccac
tgcagctccattggacagtacacctgtggtatctgccactgtgacccgggctacctgggt
gcccgctgtgagtgccaggagggtgaggctggcagcatgtacctgagcgcctgcaggcag
gctgaggggatgcagatatgtggtgggagaggggagtgcagctgtaaccagtgcctctgc
tatgagtcagagttcgggaagatctacgggaccttctgcgagtgtgacgacttctcctgc
gctcgacacaagggcatcctctgctcgggtcacggagagtgccactgtggagagtgtaag
tgccatgcgggctatatcggggacaactgtaactgttccactgacacctcatcctgtgtg
tctgatgacgggcagatctgcagcgggcggggcagctgtgcctgtgggcgctgccagtgc
actgaaccaggggccttcggggacacctgcgaaaaatgccccacctgccctgatgcctgt
ggcaccaagagggaatgcatcgaatgccggcttttcagctctggaagactgtccgacaac
cagacctgccagcggctatgcaaggatgagatcatcactgtggaaacgcttaaaacagac
gaccccaacgctgtcctctgcctgtacaagacggagaacgaatgtgtgatgaagttcacg
tactctgaacacgccaacggcatgtcagtcctcacagctctcaaagagccagagtgtggc
gcagcgccggacgccatgacggtcctcctggcggtggtgggcagtatcctactggtgggc
atcgtgctgctagccatctggaagctggtcatcaccgtgcacgaccgcagagagttcgcc
cgcttccaaagcgcacgctcccgcgcacgatatgagatggcctccaaccccctgtacaag
cagcccatctccaacgactatgtagaaaccgatttcagtatgtacagcaagtcttacaac
ggagcagcccactga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112227000
Entry
112227000         CDS       T05605                                 

Definition
(RefSeq) integrin beta-1-like
  KO
K05719  integrin beta 1
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04145  Phagosome
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
otw04514  Cell adhesion molecules
otw04530  Tight junction
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112227000
   04514 Cell adhesion molecules
    112227000
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    112227000
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112227000
   04530 Tight junction
    112227000
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112227000
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112227000
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112227000
   04515 Cell adhesion molecules [BR:otw04515]
    112227000
   04090 CD molecules [BR:otw04090]
    112227000
Membrane trafficking [BR:otw04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    112227000
Exosome [BR:otw04147]
 Exosomal proteins
  Proteins found in most exosomes
   112227000
Cell adhesion molecules [BR:otw04515]
 Integrins
  Integrin beta subunits
   112227000
CD molecules [BR:otw04090]
 Proteins
  112227000
SSDB
Motif
Pfam: Integrin_beta Integrin_b_cyt Integrin_B_tail I-EGF_1 EGF_2
Other DBs
NCBI-GeneID: 112227000
NCBI-ProteinID: XP_024247534
LinkDB
Position
28
AA seq 802 aa
MDLRLLSIATLLGILCFCSAQQEGSDCIKANAQSCGECIQVAEKCGWCTDTDFLKQGESK
SARCDELQSLITKGCTKAKIENPRGSTSINKNKAVTNRKKDMVEKLKADQITQIQPQKLT
LNLRSGEAQTFKLKFKRAEDYPIDLYYLMDLSFSMKDDLENVKNLGTDLMREMKEVTSDF
KIGFGSFVEKTVMPYISTTPARLLNPCTSTNNDTCTSPFSYKNVLKLTENGEEFNSLVSK
QQISGNLDSPEGGFDAIMQVAVCGDAIGWRNVTRLLVFSTDAGFHFAGDGKLGGIVLPND
GKCHLENNMYTMSHYYDYPSIAHLVQKLSDNNIQTIFAVTEEFQPVYKELKNLIPKSAVG
TLSSNSSNVIKLIIDSYNSLSSEVILENGKLPEGVSITYKSICKNGWVGTGENGRKCSNI
SIGDEVSFEIAIKSEKCPPQGKSETITIKPLGFTENVEIVLNFICECECSKDGKPLSEMC
HNGNGTFECGACRCNEGRIGRLCECSTDEVRTDDLDANCRKDNGTGICSNNGDCVCGTCE
CKKRENPEERYSGKFCECDNFNCDRSSNKLCGGHGRCECRVCICDANYTGSACDCSLDTS
TCLAANKQICNGRGTCECGVCKCTNPKFQGPTCEICPTCPGVCAEHKDCVQCRAFDTGEK
KDTCERDCSYFNLIRVKDRDKLPQPADQSYPLSHCKERDANDCWFYYTYAVRNHTEREVY
VVDTLECPAGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWD
TGVNPIYKSAVTTVFNPKYEGK
NT seq 2409 nt   +upstreamnt  +downstreamnt
atggatctgaggctactttcaatagcaacattattaggaatcttatgtttctgcagtgca
cagcaagagggcagtgattgcatcaaggccaatgcacaatcatgtggggaatgcatccaa
gtggcagagaaatgtggatggtgtacagacactgacttcctgaagcagggagagtctaag
tcagcacgctgtgatgagctacagtccctgatcacgaagggctgcactaaggccaagatt
gagaacccccggggcagcacctccatcaacaagaacaaggctgtcaccaaccgcaagaag
gacatggtagagaagctgaaggctgaccagatcactcagatccagcctcagaaactcacc
ctcaacctccgatccggtgaggcccagacctttaagttgaagttcaagagggcagaggac
tacccaatcgacctctactacttgatggatctctccttctccatgaaagacgatttggag
aatgtcaagaatctggggactgacctgatgcgtgagatgaaggaggtcacctcagacttc
aagatcggtttcggctcctttgtggagaagacggtgatgccatacatcagcactacccca
gccagactgctgaacccctgcaccagcaccaacaacgacacctgcaccagccccttcagc
tataagaacgtgctgaagctgactgagaacggggaggagttcaacagcctggtcagtaag
cagcagatctctggaaacctggactcccctgagggaggattcgatgccatcatgcaggtg
gccgtctgtggggatgccattggctggaggaacgtcacacgtctgctggtgttctccact
gatgctggcttccactttgctggagacggcaagctgggcggcatcgttctgcccaacgat
gggaagtgtcatctggagaacaacatgtacaccatgagccattactacgactatccctcc
attgcccatttggtccagaaactgagcgacaacaacattcagaccatttttgctgttact
gaggaattccagcctgtttacaaggaactgaagaacctcatccccaagtcagcagtagga
actctgtcctccaactccagcaacgtcatcaagctcattatcgattcttacaactctctg
tcatctgaagtcattctggaaaacggcaagctgcctgaaggtgtatccataacatacaag
tccatctgcaagaacggttgggttggaacaggagagaatggaagaaaatgctcgaacatc
tccattggcgatgaggtgtcctttgagattgccatcaagtccgagaagtgtccgcctcaa
ggcaagtccgagaccattacaatcaagcccctgggttttactgagaatgtggagatcgtc
ctcaacttcatctgcgaatgtgaatgttccaaagatggaaaacctctcagcgagatgtgc
cacaatggcaacgggacctttgagtgtggagcctgcaggtgcaacgagggccgtattggc
agactgtgtgagtgcagtacagacgaggtgaggacggacgacctggacgctaactgtcgg
aaggacaacggtacaggcatctgcagcaacaacggagactgtgtgtgtggaacctgtgag
tgtaaaaagagagagaacccagaagaacgttacagtgggaagttctgcgagtgtgacaac
ttcaactgtgaccgctccagcaacaaactctgtggaggacatggacgttgtgagtgcagg
gtgtgtatctgtgatgccaactacacgggcagcgcctgcgactgttccctggacacctcc
acctgcctagcagccaacaagcagatatgtaatggccggggcacctgcgagtgtggcgtc
tgcaaatgcaccaaccccaagttccagggtcccacctgtgagatctgccccacctgcccc
ggagtctgcgctgagcacaaggactgtgttcagtgccgggcctttgacacaggagagaag
aaggacacgtgtgagagggactgcagctacttcaacctgatcagagtgaaggaccgggac
aagctgccccagccagccgaccagtcctaccccctatcccactgtaaggagagggatgcc
aacgactgctggttctactacacctacgccgtcaggaaccacacagagagggaggtctat
gtggtcgacactctggagtgcccagcgggtcctgatattatccccatcgtggctggcgtg
gtggcgggcattgtgctgatcggcctggccctccttctcatatggaagctgctcatgatc
atccacgaccgcagggaatttgccaagttcgagaaggagaaaatgaatgcgaagtgggac
acgggagtgaatcccatctacaagagtgccgtaacaactgttttcaatccaaaatacgag
ggcaaatga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112228042
Entry
112228042         CDS       T05605                                 

Definition
(RefSeq) integrin beta-1-like isoform X1
  KO
K05719  integrin beta 1
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04145  Phagosome
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
otw04514  Cell adhesion molecules
otw04530  Tight junction
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112228042
   04514 Cell adhesion molecules
    112228042
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    112228042
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112228042
   04530 Tight junction
    112228042
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112228042
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112228042
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112228042
   04515 Cell adhesion molecules [BR:otw04515]
    112228042
   04090 CD molecules [BR:otw04090]
    112228042
Membrane trafficking [BR:otw04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    112228042
Exosome [BR:otw04147]
 Exosomal proteins
  Proteins found in most exosomes
   112228042
Cell adhesion molecules [BR:otw04515]
 Integrins
  Integrin beta subunits
   112228042
CD molecules [BR:otw04090]
 Proteins
  112228042
SSDB
Motif
Pfam: Integrin_beta Integrin_b_cyt Integrin_B_tail I-EGF_1 EGF_2
Other DBs
NCBI-GeneID: 112228042
NCBI-ProteinID: XP_024248952
LinkDB
Position
29
AA seq 838 aa
MDLKLPLISTLLAVICYSSAQQEGNECIKANAKSCGECIQVGAKCGWCTDPEFLKQGEAT
STRCDELESLRKRGCSGAKVENPRGSQEALKNKTVTNRNKGAKKLRPEDITQIQPQKLTL
SLRSGEPQSFNLKFKRAEDYPIDLYYLMDLSYSMKDDLENVKNLGTQLMLEMSKITSDFR
IGFGSFVEKTVMPYISTTPAKLLNPCTGDQNCTSPFSYKNVLKLTSNGQEFNTLVGRQQI
SGNLDSPEGGFDAIMQVAVCGEHIGWRNVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGKC
HLENNMYTMSHYYDYPSIAHLVQKLSDNNIQTIFAITEEFQPVYKELKNLIPKSAVGTLS
ANSSNVINLIIDAYNSLSSEVILENSKLAEGVTIAYQSRCKNGVTGEGEMGRKCSNISIG
DEVSFTISITAKQCPKMGKPETIKIKPLGFTEELEIALNFICECDCHKNGTENSEICHKG
NGTYECGACRCNEGRIGRHCECSTNEVTSEDLDKNCRKDNGTDICSNNGDCVCGTCECKK
RENPEERYRGKFCDCDNFNCDRSNNKLCGGHGRCECRVCICDANWTGSACDCSLDTKTCL
ASNKQICNGRGTCECGTCKCTDPKFQGPTCEICPTCPGVCAEHKECVQCRAFGTGEKKET
CERDCSYFNLIKVKDRDKLPQPGQAFPLMHCKERDANDCWFYYTYAVNNNTEKEVHVVET
LDCPAGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDTQDN
PIYKSPINKFQNPIYGRKLRFYKEKIPSTRVLLRRWSTPNMKANDGVSGLPEQHCMQI
NT seq 2517 nt   +upstreamnt  +downstreamnt
atggacctgaaactacctctgatatcaacattgttagcagtcatttgttacagcagtgct
cagcaagaagggaacgagtgcatcaaggccaatgccaagtcctgtggggagtgtattcaa
gtgggagcgaaatgtggatggtgcacagacccagagtttcttaagcagggtgaggccacg
tcgacccgctgtgacgagctagagtccctgcggaagagaggttgcagtggcgccaaggta
gagaacccccgaggcagccaagaggccctgaagaacaagactgtgaccaaccgcaacaag
ggagcaaagaaactcagaccagaggatatcacacagatccagccccagaaactcaccctt
agcctcagatctggtgaaccccagtcttttaatctgaagttcaaacgagctgaggattac
cccatcgacctctactacctgatggacctctcctactcaatgaaggatgatctggaaaat
gtaaagaacctgggaacacagctgatgctggagatgtcaaagatcacatctgatttcaga
atcggttttggttccttcgttgagaagactgtgatgccttacataagcaccaccccagcc
aagctgctgaacccctgtactggggaccagaactgcaccagtccattcagctataagaac
gtcctgaagctgactagcaatggacaggagttcaacaccctggtgggacgacagcagatc
tctggaaacctggactcaccagagggaggctttgatgccatcatgcaagtggctgtctgt
ggtgagcacattggctggaggaacgtcacacgtctgctggtgttttccactgatgctggc
ttccactttgctggagatgggaaactgggagggattgttctgcccaacgatgggaaatgc
cacctggagaacaatatgtacaccatgagccactactatgactacccctccatcgcccat
ctggttcagaaactaagtgacaacaacatccagacaatctttgccatcacagaggagttc
cagcctgtttacaaggagttgaagaatctcattcctaagtctgcagttgggacactctct
gcaaactccagcaacgttatcaatctcattattgatgcctacaattctctttcctcagag
gtgattctggagaacagtaagctagcagagggagtgaccatcgcgtaccagtcacgctgc
aagaacggagtgactggtgagggagagatgggaagaaaatgctccaacatctccatcgga
gacgaggtgtctttcaccataagcatcacagctaagcagtgtcctaagatgggcaaacca
gagaccatcaagatcaaacccctagggttcacagaggagctggagatcgctctgaacttc
atctgtgaatgtgactgtcacaaaaacggcactgagaacagtgaaatctgccacaaaggc
aacgggacatatgaatgtggagcctgcaggtgcaacgagggccgtataggtagacattgt
gagtgcagcaccaacgaagtgaccagcgaagacctggataagaactgtcgtaaagacaat
ggtacagacatctgcagcaacaatggagactgtgtgtgtggaacctgcgagtgtaagaag
agggagaacccagaggaacgctacagaggaaagttctgcgattgtgacaactttaactgt
gaccgctccaacaacaaactctgtggaggacacggtcgttgtgagtgcagggtgtgtatc
tgtgatgccaactggacgggcagtgcctgtgactgttctctggacaccaaaacctgcctg
gcctctaacaagcagatctgtaatggccggggcacctgtgagtgtggaacctgtaagtgc
actgaccccaagttccaggggcctacctgtgagatctgccccacctgtccaggagtctgc
gcagaacacaaggagtgtgttcagtgcagggcctttgggacgggggagaagaaggagacg
tgtgagagggactgtagctacttcaacctgatcaaggtgaaggaccgagacaagctgccc
cagccaggacaggccttccccctgatgcactgtaaggagagggatgccaacgactgctgg
ttctactatacctacgctgtcaacaacaacacagagaaggaggtccatgtggtggaaaca
ctagactgccctgcgggcccggacatcatccccatcgtggctggcgttgtggcgggcatt
gtgctgatcggcctggctttgctgctcatttggaagctgctcatgatcatccacgacagg
agggagttcgccaagtttgaaaaggagaagatgaatgctaaatgggacacgcaagacaat
cctatatacaagagccctattaataagttccagaatcctatctatggacgtaaactgcgg
ttctataaggagaaaatcccatctacaagagtgctgttacgacggtggtcaaccccaaat
atgaaggcaaatgatggagtttcaggtctcccagaacaacactgtatgcaaatatag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112233642
Entry
112233642         CDS       T05605                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: integrin beta-4-like
  KO
K06525  integrin beta 4
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112233642
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112233642
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112233642
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112233642
   04515 Cell adhesion molecules [BR:otw04515]
    112233642
   04090 CD molecules [BR:otw04090]
    112233642
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   112233642
  Exosomal proteins of bladder cancer cells
   112233642
Cell adhesion molecules [BR:otw04515]
 Integrins
  Integrin beta subunits
   112233642
CD molecules [BR:otw04090]
 Proteins
  112233642
SSDB
Motif
Pfam: Integrin_beta fn3 Integrin_B_tail Calx-beta PSI_integrin Pur_ac_phosph_N SEA EGF_2
Other DBs
NCBI-GeneID: 112233642
NCBI-ProteinID: XP_024257168
LinkDB
Position
Unknown
AA seq 1998 aa
MREMGRWTLNLLVGVVLLAVLTASCYAEKVNHCLATRASTCSECIQSGKGCAYCPDEIFD
GPRCDLHDNIISRGCNSAVTAKSSMSMERNEQIDMLLKQSQVAPQEMSMTLLPGEEREIE
MEVFEPAKGPLDLYILMDFSNSMEDDLDNLKRMGAELAALVGKLSDDYTIGFGKFVDKVV
EPQTDMRPSKLAKPWPNSDPPFSFRHVITLTPDLRFFTEKLQKERISGNLDAPEGGFDAI
LQAAVCGEKIGWRSHATHLLVFSTESAFHYEADGANVLAGIMPRNDEQCHLDPEGKYTED
TRQDYPSVPTLVRLLGKHNIIPIFAITNHSFTYYQKLYEYFPIAELGLLQEDSANILNIL
EKAFENIRSKISIRAEDRPKAIEAQVLSYSGSVAQAGTFKVKPGQIMEARWLQKQHPLAL
YSHGDLVCGKCRSTXGWLGPFCNCSTSASPVAGSSCLGPDVGEPCSGRGDCLCGTCVCYN
TDQYEGPLCQFDKSQCQRYGGFLCNDRGRCFMGQCACAEGWEGPACECPMSNQTCLDTKG
GVCNGRGVCKCGRCECQDSGLAMTPTCEANFQAQLGMCEDKRSCVQCQAWKTGEKKDSDQ
CDQCQFKVVMVDELKENKEVIEACSFRDEDDDCTYHYTVDYPEEQTDKELEVQVLKKKDC
PPAGFLWLIPLIMFLMLLLGLLLLCCWKYCACCKACLALLPCCGRGRMVGFKEDQYMLRQ
SLLTSDHLDTPLVRTGPPKSTDVVRWKITDNVHRSPNHPLAQVQPNPKETIQFPLSLRLN
RLFTESLSHPDARDTEMLRREVDDNLNEVYKHVPGAQRVQNTKFRLQRNAGKRKDHTIVD
TVVSAPRSSYPDIVKLTEKNVQSGNFQDLKVVPGYYTVATDREAAGAVEFQEGVETVDVR
VPLFIKEDDDDKKQLQVEAVDVPLGIAEIGKRFVNITIIKEHAKSIMSFLQPSYTYSRQD
RVANIPISREIIEDGHTQVTYRTRDLTAKDKKDYVTVDGELSYGPGETQQTVPVRLLELG
EGDGLLKDTQVKQFVMDLSNPRQGAKLGRYPRTTVTITDQPEPSVMMFMKSTQNFSTADP
TYSIPVVRTRNQEGPATVHWKTRNAKRFELSGPLKFSPGETEKNIVIDPRPHPGPVKPEI
FQLELFDPSTNAAVGERKTTMVTITDGALPEIAQKQQQGKDFINRTAMSPGGRLFSPTNV
KANATGPRNIRLNWDPLGSPLGYKVKYWIYGDPETDGQVIDVKTTHAELTNLYPFCDYEM
KVCGYNALGNGNYSDMVPCQTLEDVPSEPGRLAFNVISPTVTQVSWAEPAETNGVITNYE
VLYTPINDNTKPMGVAKKVKIDNPKKRMLLIENLQSAQTYCYKVRAKNSVGWGPFREATI
NLASQPVRPMSSEFLQGYCVAVLWKINPQMNQCFIKLVGSKLDLRSVSWKRHVDVIPYRL
STDTDTSTDETPRPSRAQTPSLKDQMNGRWEQNFLFPGGNNSMSRSANMSSSSYSQLSPM
STLSSNHRGGAGGSMTTESSTTYLSGQGGNSLSRTQVIGGGTRTENVVMRKRSENRGYYE
YDDNIRDSIVIGDLSSGLSGYTDGKSTYGFSPTQTQYSYSMSRVLRGRTQSEDVNDALLN
LDRVLQDSRLASGVPDTPTRLVFSALGPTALKVSWQEPHCDRDVLGYCVLYQLLNGGDMK
RIDVSSPAENSVVVQDLLPNHSYLFKVKAQSLEGWGPEREGVITIESAVNPNSPLSPMPG
SPFTLSTPSAPGPLVFTALSPEALQLSWDKPRKPNGDILGYVVTCEQLHGGGDMRSFQVS
GDSAETSLTVPDLSENMPYKFKVQARTTQGFGPEREGIITIESQDGGSTSQIGGIGGMSQ
LGGLGGMSQIQGLGGMSQLGGLGGMSQIEGLGGMSQLGGLGGMSQIEGLGGMSQYSSQSL
TKRDVFQLPTEVSTHSNVTHTMINDPYFSGDGMMMTSQHTETSGMVTRHVTKEVVQRSMQ
VAGSSSVTKKVERSFYEA
NT seq 5997 nt   +upstreamnt  +downstreamnt
atgagggagatggggagatggacattaaatctcttggtgggggttgtacttcttgctgtc
ctcacagccagttgctacgctgaaaaagtgaatcactgtctggctacgagggctagcacc
tgttcagaatgtattcagtcagggaagggctgtgcctactgtccagatgagatctttgat
ggtccccgctgcgaccttcatgacaacatcataagccgcggctgtaatagcgcggtgaca
gccaaaagcagcatgtcgatggaaagaaatgagcagatcgacatgctgttgaagcagtcc
caggtagctcctcaggagatgtctatgactctgctgccaggggaggagagggagatcgag
atggaggtgtttgaaccagctaaaggacctctggacctctacattcttatggacttctcc
aactccatggaggacgacctggacaacctcaagagaatgggtgctgagctggctgcgttg
gtagggaagctgtctgatgattacaccatcggtttcggcaagtttgtggacaaagtggtg
gagccccagacagatatgagaccatccaaacttgccaagccttggcccaacagtgaccct
cccttctcgttccgtcatgtgatcactctgacccctgacctgcggttcttcaccgagaag
ctgcagaaggagaggatctcagggaacctggacgctccagaggggggcttcgacgccata
ctgcaggctgcagtctgcggggaaaagatcggctggcgtagccatgccacccacctcctg
gtcttctccaccgagtcggccttccactacgaggcggatggtgccaacgtgctggcgggc
atcatgccacgcaacgacgagcagtgccacctggaccccgaggggaaatacacagaggac
accaggcaggactacccctctgtgcccaccctggtccgcctgctgggcaaacacaacatt
atccccatcttcgccatcacaaaccactcctttacctattatcagaagctttatgagtat
ttccccatcgctgagttgggtctgctacaggaagactctgctaacatcctcaatatcctg
gagaaagcctttgagaatatccgctctaagatcagcatccgtgctgaggacaggcctaaa
gctatagaagctcaggtcctatcgtacagtggcagtgttgcacaggctggaaccttcaaa
gtcaagcctggacaaataatggaggcgcggtggcttcaaaaacagcacccccttgctttg
tacagccacggggacctggtctgtgggaagtgccggtctacgngtggctggctgggtccg
ttctgtaactgctcaaccagtgcgtcgccggtcgcgggtagttcctgtctgggtcctgac
gtgggggagccgtgttctggccgaggagattgcctgtgtggaacgtgtgtgtgttacaac
accgaccagtacgagggacccctctgtcagtttgacaagtcccagtgtcaacgatacgga
ggcttcctctgcaacgaccgtggtcgttgcttcatgggtcagtgtgcgtgtgcagagggc
tgggagggaccggcctgtgagtgtcccatgagcaaccagacctgtctggacactaaaggg
ggtgtctgtaacgggcgtggtgtgtgtaagtgcggtcgctgtgagtgccaggactctggc
ctggccatgacccccacctgcgaggctaacttccaggcccagctggggatgtgtgaggac
aagaggagctgtgtccagtgtcaggcctggaagaccggagagaagaaggacagcgaccag
tgtgaccagtgccagttcaaagtggtcatggtggacgagctcaaggaaaataaagaggtg
attgaggcgtgtagtttccgcgacgaggatgacgactgtacgtaccactacaccgtggac
taccctgaggagcagactgacaaggaactggaagtccaggtgcttaaaaagaaagactgt
ccccctgctggcttcctgtggctgatccccctcatcatgttcctcatgctactgctgggt
ctactgctgctctgctgctggaagtactgcgcctgctgcaaggcatgtcttgctctgctg
ccatgctgtggaagaggccgtatggttggctttaaggaggaccagtacatgctccgccaa
tccctgctcacctctgaccacctggacacgcccctagtgaggaccggcccgcccaagagc
accgacgtggttcgctggaagatcaccgacaatgtgcaccgatcacccaatcacccgctg
gcgcaggtccagcccaaccccaaagagaccatccagttccctctgtccctgcgtctgaac
aggttgttcacagaaagtctgtctcaccccgacgccagagacacggagatgctgcgcagg
gaggttgatgacaacctgaatgaagtgtacaagcatgttcctggagcccagagggttcag
aataccaaatttagattacagaggaatgctggtaaaagaaaagaccacacaattgtagac
acagtcgtgtccgctcctcgctccagctaccccgacatcgtcaaattgactgagaaaaac
gtccagtctggaaacttccaagatctcaaagtggtgccgggctactacacagtggccaca
gacagagaggcggctggtgccgtggagttccaggagggggtggagacggtggatgtgcgc
gtgccgctcttcatcaaggaagatgacgatgataagaagcagctgcaggtggaggcggtg
gacgttcctctgggcatcgctgagatagggaaacgcttcgtcaacatcaccatcatcaaa
gaacacgccaagagtattatgtcgttcctgcagccttcctacacctacagccgacaggac
agagtggctaacatccccattagcagagagatcatagaggacggacacacacaggtcacc
taccgcacccgagacctcaccgccaaggacaagaaggactatgtgacagtggatggggaa
ctgtcctacgggccaggggagacccagcagactgtcccggtgcgtctattggagctggga
gagggagacggtctgctgaaggacacacaggtcaaacaatttgtcatggacctcagtaac
ccaagacagggagccaagctgggacgctaccccagaaccaccgtcaccatcactgaccaa
ccagagcccagtgtgatgatgtttatgaagagcacccagaacttctccacagctgaccca
acctactccatccccgtggtccgcacacgcaaccaggaggggcccgccaccgtccactgg
aagacccgcaatgccaagcgcttcgaactgtctggtcccctcaagttttctcccggggag
actgagaagaacatcgtgatcgacccacgccctcaccctggaccggtcaaaccagaaatc
ttccagctggagttgtttgaccccagtacgaacgccgcggtcggggagaggaagacgaca
atggtcacgattactgatggagcattaccagagattgcccagaagcagcagcagggtaag
gacttcatcaaccggacagccatgtcccctggtggtcgtctcttctctcccaccaacgtc
aaggctaatgccactggcccacgaaacatccgtctcaactgggaccccttaggaagcccc
ctgggctacaaggtgaagtattggatctatggggaccctgagactgatggccaggtgata
gatgtgaagaccacccacgctgagctgaccaacctgtaccccttctgtgactacgagatg
aaggtgtgtggctacaacgccctgggaaacggaaactacagcgacatggtgccctgtcag
accctggaggacgtccccagtgagcccggtcgtcttgcgttcaacgtcatcagtccaacc
gtcactcaggtcagctgggcggagcctgccgagaccaacggtgtcatcaccaactacgag
gtcctctacacacccatcaatgacaacacaaagccgatgggtgtagctaagaaggttaag
atagacaaccctaagaagaggatgttgctaattgagaacctgcagtcggcccagacctac
tgctataaggtccgggctaagaacagtgttggctggggtccattcagagaggcaaccatc
aacctggcctcacagcccgtcagacccatgtccagtgagttcctccaagggtactgcgtt
gctgttttgtggaaaataaatcctcaaatgaaccaatgctttatcaagttggtgggttcc
aagctggacctgcgttcggtgtcctggaagaggcatgtggatgtgatcccctaccgcctc
agcacagacacagacaccagcactgacgagactccccggcccagtcgagcacagacccca
tccctgaaagaccaaatgaacggcaggtgggaacaaaacttcctgttccccgggggaaat
aattccatgtcgcgcagtgccaatatgtcgtcttccagctacagccagctgtctcccatg
tccaccctcagctccaaccacagaggaggggccggaggttccatgactacggagtcctcc
acaacatacctctctggacaaggagggaactcgctctcccgcactcaggtgatcgggggc
gggacgcgcacagagaatgttgtcatgaggaagcggtcagagaaccgaggttactatgag
tacgacgacaacatccgagattccatcgtcataggagacctgtccagtggattgtcggga
tacacagacggcaaaagtacttatggcttcagccccactcagacacagtacagctacagt
atgtctcgggtcttgcggggcaggacccagtctgaggatgtcaacgatgcgctactgaat
ctggacagggtgctccaggactctcgtttggcctctggggtccctgacacccccaccagg
ttggtgttctctgccctgggccccacggccctgaaggtcagctggcaggagccccactgt
gacagggatgtgctggggtactgtgttctctaccagctactcaatggaggtgatatgaag
cgtatagacgtgtccagcccagcagagaactctgtggtggtgcaggacctgctgcctaac
cactcctacctgttcaaggtgaaggctcagagtctggagggctggggaccagagagagag
ggagtcatcaccatagagtcagccgtcaaccccaacagcccactcagtccaatgccaggt
tctcccttcactctcagcacccccagtgctccaggccccctggtattcacagctctgtcc
cccgaggcactgcagctgagctgggacaaaccccgcaaacccaacggagatatcctgggc
tacgtggtcacctgtgaacagctgcacggaggaggtgacatgcgttccttccaggtgagc
ggtgacagcgctgagaccagtctgacggttccggacctgagtgagaacatgccatacaag
ttcaaagttcaggccaggacgacgcagggcttcgggcccgagagggagggtatcatcacc
atcgagtctcaggatgggggtagcacgtctcaaataggtggaataggtggtatgtctcaa
ctaggaggcctaggtggtatgtcccaaatacaaggcctaggaggtatgtctcaactagga
ggcctaggtggtatgtcccaaatagaaggcctaggaggtatgtctcaactaggaggccta
ggtggtatgtcccaaatagaaggcctaggaggtatgtctcagtacagcagtcagtccttg
accaagagagatgtgttccaactgccgacagaggtcagcacccacagcaacgtcacacac
accatgatcaacgacccctacttctcaggggacggtatgatgatgacttcccagcacaca
gagaccagcggcatggtaacccgtcatgtgactaaggaggtggtccagaggagcatgcag
gtggccggctccagcagcgtcaccaagaaggttgagaggtcgttctatgaggcttga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112237626
Entry
112237626         CDS       T05605                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: integrin beta-4-like
  KO
K06525  integrin beta 4
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112237626
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112237626
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112237626
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112237626
   04515 Cell adhesion molecules [BR:otw04515]
    112237626
   04090 CD molecules [BR:otw04090]
    112237626
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   112237626
  Exosomal proteins of bladder cancer cells
   112237626
Cell adhesion molecules [BR:otw04515]
 Integrins
  Integrin beta subunits
   112237626
CD molecules [BR:otw04090]
 Proteins
  112237626
SSDB
Motif
Pfam: fn3 Integrin_B_tail Calx-beta Pur_ac_phosph_N EGF_2
Other DBs
NCBI-GeneID: 112237626
NCBI-ProteinID: XP_024261989
LinkDB
Position
Unknown
AA seq 1529 aa
IFLPRLGPFCNCSASASTDPGTSCLGPGVEEPCSGRGDCLCGACVCYNTDQYEGSLCQFD
KSQCQRYGGFLCNDRGRCFMGQCACAEGWEGPACECPMSNQTCLDTKGGVCNGRGVCKCG
RCECQDSGLAMTPTCEANFQAQLGMCEDKRSCVQCQAWKTGEKKDSDKCDQCQFKVVMVE
ELKENKEVIEACSFRDEDDDCTYHYTVDYPEDQTVKELEVQVLKKKDCPPAGFLWLIPLI
MFLMLLLGLLSLCCWKYCACCKSCLALLPCCGRGRMVGFKENQYMLRQSMLTSDHLDTPL
VRTGPPKSTDVVRWKITDNVHRSPNHPLAQVQPNPKETIQFPLSLRLNRLFTDSLSRSDA
RDTELLRREVDDNLNEVYKQVPGTQRVQNTTFRLQRNAGKRADHAIVDTVLPAPRSSYPN
IVKLTEKNVQSGNFQDLKVVPGYYTVATDREAAGAVEFQEGVETVDVHVPLFVKEEDDDK
KQLQVEAVDVPLGIAEIGKRFVSITIIKEHAKSVMSFLQPSYTYSRQDKVANIPITREII
EDGHAQVSYRTRDLTAKDKKDYVTVDGELSYGPGETQQTVPVRLLEMGEGDGLLKDTQVK
QFVMDLSNPRQGAKLGRYPRTTVTITDKPEPSVMMFMKSTQNFSTADPTYSIPVVRTRNK
EGPATVHWRTRNAKRFELSGPLKFGPGETEKNIVIDPRSHPGPVKPESFQLELFDPSTKA
VVGERKTTMVTITDGAPLSPQDFQKMPRXESAGFINQTATSPCGRLNSPTNVKAKSHRPR
SIRLNWDPXGKSLGYKVKYWIYGDPEADAPPAMNVKTNHADLANLYPYCDYETKVCGYNA
LGDGNYSDMVPCKTLEDVPSEPGRLAFNVISPTVTQVSWAEPAETNGVITAYEVLYTPIN
DDTKPMGAAKKVKIDNPKKRMLLIENLQSAQTYCYQVRAKNSVGWGPFKEATINLASQPT
RPMSIPIIPDIPIVDAEAGDEYDGYLMYSSEVMRSPTDSKRPSVSDEEPINGRLEQNFLF
PGGNNSMSRSTNMSSSSYSQVSPMSTLSSSHRGGAGGSMSMESTTTYLSGQGGNSLSRTQ
VIGGGTRTENVVMRKRSENRGYYEYDDNIRDSIIIGDLSSGLSGYTDGQSTYGFSPTQTQ
SQYDYGMSQAFRARTQSEDVNDALQNLDRVIQDARLAPGVPDTPTRLVFSALGPTALKIS
WQEPHCDRDVLGYCVLYQLLNGGDVKRINMSSPADNSVVVQDLLPNHSYLFKVKAQSQEG
WGPEREGVITIESAVDPNSPLSPMPGSSFTLSTPSAPGPLVFTALSPEALQLSWEKPRKP
NGDILGYVVTCEHLHGGGDMRSFQVSGDSAETSLTVPDLSENMPYKFKVQARTTQGFGPE
REGIITIESQDDGSMSQLGGLGGTSQLGGLGSMSQLGGLGSMSQLGGLGSMSQLGGLGGT
SQYSSQSLTKRDVYQLPTEGSTHTNVTHTMINDPYYSGDGMMVVGKTTQHTETSGMVTRH
VTKEVVQRSMQVAGTSSVTKKVERSFYET
NT seq 4590 nt   +upstreamnt  +downstreamnt
atctttctccccaggctgggtccgttctgtaactgctctgccagcgcgtcgacggatccg
ggcacttcctgtctgggtcctggcgtggaggagccgtgttctggccgaggagattgcctg
tgtggagcgtgtgtttgttacaacacggaccagtacgagggatccctctgtcagtttgac
aagtcccagtgtcaacgatacggaggtttcctctgcaacgaccgtggtcgctgcttcatg
ggccagtgtgcgtgtgcagagggctgggagggaccggcctgtgagtgtcccatgagcaac
cagacctgtctggacacgaaagggggcgtctgtaacgggcggggtgtgtgtaagtgtggt
cgctgtgagtgccaggactctggcctggccatgacccccacctgcgaggctaacttccag
gcccagctggggatgtgtgaggacaagaggagctgtgtccagtgtcaggcctggaagacc
ggagagaagaaggacagcgacaagtgtgaccagtgccagttcaaagtggtcatggtggaa
gagctcaaggaaaataaagaggtgattgaggcgtgtagtttccgcgacgaggatgacgac
tgtacgtaccactacaccgtggactatcctgaggaccagactgttaaggaactggaggtc
caggtgctcaagaagaaagactgtccccctgctggcttcctgtggctgatccctctcatc
atgttcctcatgctactgctgggtctactgtcgctctgctgttggaagtactgcgcctgc
tgcaagtcctgtcttgctttgctgccatgctgtggaagaggtcgtatggttggctttaag
gaaaatcagtacatgctccgccaatccatgctcacctctgaccacttagacacgccccta
gtgaggaccggcccacccaagagcaccgacgtggttcgctggaagatcactgacaatgtc
caccgatcgcccaatcatccgcttgcgcaggttcagcccaaccccaaagagaccatccag
ttccctctgtctctgcgtctgaacaggttgttcacagacagtctgtctcgctccgacgcc
agagacactgagttgctacgcagggaggttgatgacaacctgaatgaagtgtacaagcag
gttcctggcacccagagagttcagaacaccacatttagattacagagaaatgctggtaaa
agagctgaccacgccatcgtagacactgttctgcccgctcctcgctccagctaccccaac
atcgtcaaactgactgagaaaaacgtccagtctggaaacttccaggatctcaaagtggtg
ccgggctactacacagtggccacagacagagaggcggctggtgccgtggagttccaggag
ggggtggagacggtggatgtgcacgtgccgctcttcgtcaaggaggaagatgatgataag
aagcagctgcaggtggaggcggtggacgttcctctgggcatcgctgagatagggaaacgc
tttgtcagcatcactatcatcaaagaacacgccaagagtgttatgtcgttcctccagcct
tcgtacacctacagccgacaggacaaagtggctaacatccccattactagagagatcata
gaggatggacacgcacaggtcagctaccgcacccgagacctcaccgccaaggacaagaag
gactatgtgacagtggatggggagttgtcctatgggccaggggagacccagcagactgtc
cctgttcgtttgttggagatgggagagggagacggtctgctgaaggacacacaggtcaaa
caatttgtcatggacctcagtaacccaagacagggtgcaaagttgggacgctaccccaga
accaccgtcaccatcactgacaaaccagagcccagtgtgatgatgtttatgaagagcacc
cagaacttctccaccgccgacccaacctactccatccccgtggtccgcacccgcaataag
gaggggcccgccaccgtccactggaggacccgcaacgccaaacgctttgagctgtccggc
cccctaaagtttggtcccggggaaactgagaagaacatcgtgatcgatccacgctctcac
cctggcccggtgaaaccagagtccttccaactggaactgtttgaccccagtacgaaagct
gtggtcggagagaggaagacaacgatggtcactattactgatggagctcctctatcccct
caggacttccagaaaatgcccagatgagagagtgcgggcttcatcaaccagacagccacg
tctccttgtggtcgtctcaactctcccaccaacgtgaaggccaaaagccaccggccccgg
agcatccgccttaactgggaccctntaggaaaatctctgggctacaaggtgaagtattgg
atctatggggatcctgaggctgacgccccccctgcgatgaatgtaaagacaaaccatgct
gacctggccaacctgtacccctattgtgactacgagacgaaggtgtgtggctacaacgcc
ctgggagacggaaactacagcgacatggtgccctgtaagaccctggaggatgtccccagt
gagcccggtcgtctggcgtttaacgtcatcagtccaactgtcactcaggtcagctgggcg
gagcctgccgagaccaatggtgtcatcaccgcctacgaggttctctacacgcccatcaat
gacgacacgaagccgatgggtgcagctaagaaggtgaagatagacaaccctaagaagagg
atgttgctgattgagaacctgcagtcggcccagacttactgctatcaggtccgggctaag
aacagcgtgggttggggtcctttcaaagaagcgaccatcaacctggcctcccagcccacc
agacccatgtccatccctatcatcccagacatcccwatagtggacgcggaggcgggggat
gagtacgacggctacctgatgtacagcagtgaggtcatgagatcgccaacagactccaag
agacccagcgtctcagacgaagaaccaattaacggcaggttggaacagaacttcctcttc
cccgggggaaataattccatgtcgcgcagtaccaacatgtcttcatccagctacagccag
gtttctcccatgtccaccctcagctccagccaccgagggggggccggggggtccatgtcc
atggagtccaccacaacatacctctctggacaaggaggaaactctctctcccgcactcag
gtgattgggggcgggacgcgcacggagaatgttgtcatgaggaagcgatcagagaacaga
ggttactatgagtatgacgacaacatccgagattccatcatcataggagacctgtccagt
ggattgtctggatacacagatggccaaagtacgtatggcttcagtcccactcagacacag
agtcagtacgactacggtatgtctcaggccttccgggccaggacccagtctgaggatgtc
aacgatgcactacagaacctggacagggtgatccaggatgctcgtttggcccctggggtc
cctgacacccccaccaggctggtgttctctgccctgggccccactgccctgaagatcagc
tggcaggagccccactgtgacagggatgttttagggtactgtgttctctaccagctgctg
aatggaggtgatgtgaagcgcataaacatgtccagccccgcagacaactccgtggtggtg
caggacctgctgcctaaccactcctacctgttcaaggtgaaggctcagagtcaggaaggc
tggggaccggagagggagggagtcatcaccatagagtcagctgtcgaccccaacagccca
ctcagcccaatgccaggttcttccttcactctcagtacccccagtgctccaggacccctg
gtgttcacagctctgtcccccgaggcactgcagctgagctgggagaaaccccgcaaaccc
aacggagacatcctgggctacgtggtcacctgtgaacatctgcacggaggaggtgacatg
cgttccttccaggtgagcggtgacagcgctgagaccagtctgacagttccggacctgagt
gagaacatgccgtacaagttcaaagttcaggccaggacgacccagggcttcggccccgag
agggagggcattatcaccatcgagtctcaggatgatggtagcatgtctcaactaggaggc
ctaggtggtacatctcaactaggaggcctaggcagtatgtctcaactaggaggcctaggt
agtatgtctcaactaggaggcctaggtagtatgtctcaactaggaggcctaggtggtaca
tctcagtacagcagtcagtccttgaccaagagagatgtgtaccaacttcctacagagggc
agcacacacaccaacgtcacacacaccatgatcaacgacccatactactcaggagatggt
atgatggtggtggggaagacaacccagcacacagagaccagcggcatggtgacacgtcat
gtgacgaaggaggtggtgcagaggagcatgcaagtggccggcaccagcagcgtcaccaag
aaggtcgagaggtcattctacgagacctga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112238437
Entry
112238437         CDS       T05605                                 

Definition
(RefSeq) integrin beta-5-like
  KO
K06588  integrin beta 5
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04145  Phagosome
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112238437
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    112238437
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112238437
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112238437
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112238437
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:otw04515]
    112238437
Membrane trafficking [BR:otw04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    112238437
Cell adhesion molecules [BR:otw04515]
 Integrins
  Integrin beta subunits
   112238437
SSDB
Motif
Pfam: Integrin_beta Integrin_B_tail Integrin_b_cyt PSI_integrin I-EGF_1 EGF_2 DUF4361
Other DBs
NCBI-GeneID: 112238437
NCBI-ProteinID: XP_024262788
LinkDB
Position
3
AA seq 804 aa
MWSPWQLVYRTAFGCMVLEIFIHNVAQGLNVCMSGSATSCEECLLISPSCAWCAQEEFGR
ARTLTSRCDLSQNLQKRGCEAHNIESPSSTIMVVKSEPLSSKGSGPTQYDVIQIMPQKIS
LNLRPGDQTSFEVQVRQVEDYPVDLYYLMDLSLSMKDDLDTIRNLGTKLADEMRKLTSNF
RLGFGSFVDKNMSPFSYTATKYQDNPCNGYKLFPNCVPSFGFRHLLSLTDKVDRFNEEVQ
KQMVSRNRDAPEGGFDAILQAAVCKERIGWRKEAFHLLVFATDDVPHLALDGKLGGLVQP
HDGECHMNENNEYSGSTKMDYPSLALLGEKLAENNIYLIFAVTKRLYVIYKNFTALIPGT
TVEILDQDSKNIIQLIVNAYNNIRSKVELTVWDQPEDLSLSFTATCQDGQPLPGLRKCAD
LKIGDTVSFNVSVDARGCPAPGTQQRFTIKPVGFKNRLEVSVDYRCACGCTDQTQANSSR
CSSIGQYTCGTCHCDPGYLGARCECQEGEAGSMYLSACREAEGKQICGGRGECSCNQCLC
YESEFGKIYGTFCECDDFSCARHKGILCSGHGECHCGECKCHAGYIGDNCNCSTDTSSCV
SDDGKICSGRGSCVCGHCQCTEPGAFGDTCEKCPTCPDACGTKRECIECRLFDSGRLSDN
QTCQRLCKDEIITVETLKTEDPNAVLCLYKTENECVMKFMYSEHANGMSVLTALKEPECG
AAPDAMTVLLAVVGSILLVGIVLLAIWKLVITVHDRREFARFQSARCRARYEMASNPLYK
QPISSHPIETDFIMYGKSYNGAAH
NT seq 2415 nt   +upstreamnt  +downstreamnt
atgtggagcccatggcagttggtgtaccgtacagccttcggctgcatggttctggaaata
tttattcacaatgttgcacaaggactcaatgtttgtatgagtggcagcgctacatcctgt
gaagaatgcctcctcatctctccgagctgcgcctggtgcgcgcaagaggagtttggcagg
gcgaggaccctgacgtcacggtgtgacttgagtcagaacctgcagaagagaggctgtgag
gcccataacatagagagtcctagtagcacaatcatggtagtgaagagcgaacccctcagc
tccaaaggctccgggccgacccagtatgatgtcatccagatcatgccccagaagatctcc
ctgaatcttagaccaggtgaccagacctcattcgaagtgcaggtgcgtcaggtggaggac
taccctgttgacctgtactacctgatggacctgtctctgtccatgaaggatgacctggac
accatcaggaacctgggcaccaagctggctgacgagatgaggaaactcacctcaaacttc
agactaggctttggctccttcgtagacaagaacatgtcaccattctcttacacagccacc
aagtaccaggacaacccctgcaatggatacaagctgttccccaactgtgtcccttccttc
gggttccgccacctcctctccctgacggacaaggtggatcgcttcaacgaggaggtgcag
aaacagatggtgtctcgcaacagggacgctccggagggaggcttcgacgccatcctgcag
gctgccgtctgtaaggagaggataggttggaggaaggaggccttccacctgctggtgttt
gccacagacgatgtgcctcacctggccttggacggtaaactgggaggcctggtccagccc
catgatggggagtgccacatgaatgagaataacgaatacagcggctccaccaagatggac
tatccctctctggctctgttgggagagaagctggcggagaacaacatctatctcatcttc
gccgtgactaaaaggctctatgtcatttacaagaatttcacagcactgatacctggaact
acagtggagattctggatcaggactccaagaacatcatccaactcatcgttaacgcctac
aataacatccggtccaaagtggagctgacggtgtgggatcaacctgaagacctcagtctg
tccttcacggccacctgtcaggacggacagcccctaccaggcctcaggaagtgtgccgac
ctcaagatcggagacacggtgtccttcaacgtgagtgtggatgctaggggctgccctgcc
cctggcacccagcagagattcaccatcaaacctgtgggtttcaagaatcgtctggaggtg
tcagtggactaccgctgtgcctgtggctgcaccgaccagacccaggctaacagtagccgc
tgcagctctatcggacagtacacctgtggtacctgccactgtgacccgggctacctgggc
gcccgctgtgagtgccaggagggcgaggctggcagcatgtacctgagcgcctgtagagag
gcggaggggaagcagatctgtggtgggagaggggagtgcagttgtaaccaatgcctctgc
tacgagtcagagttcgggaagatttacgggaccttctgcgagtgtgacgacttctcctgc
gcccgacacaagggcatcctctgctcaggtcacggagagtgccactgtggggagtgtaag
tgccatgcgggctacatcggagacaactgtaactgctccacggacacgtcttcctgtgtg
tctgatgacgggaagatctgtagtgggcgaggcagctgtgtgtgcgggcactgccagtgt
acagaaccaggggccttcggggacacctgcgagaaatgccccacctgccccgatgcctgt
ggcaccaaaagggaatgcatcgagtgccggcttttcgactccggaagactgtccgacaac
cagacgtgccagcggctatgcaaggacgagatcatcactgtggaaacgcttaaaacggaa
gacccaaacgctgtcctttgcttgtacaagacggagaacgagtgtgtgatgaagttcatg
tactctgaacacgccaacggcatgtcagtcctcaccgcgctcaaagagccagagtgtggc
gcagcgccggatgccatgacggtcctcctggcagtggtgggcagtatcctgctggtgggc
attgtgctgctagccatctggaagctggtcatcaccgtgcacgaccgacgggagtttgcc
cgcttccagagcgcacgctgccgcgcacgttacgagatggcctccaaccccctctacaag
cagcccatctccagccacccaatagagaccgacttcattatgtatggcaagtcttacaac
ggagcagcccactga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112247447
Entry
112247447         CDS       T05605                                 

Definition
(RefSeq) integrin beta-6-like
  KO
K06589  integrin beta 6
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112247447
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112247447
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112247447
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112247447
   04515 Cell adhesion molecules [BR:otw04515]
    112247447
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   112247447
Cell adhesion molecules [BR:otw04515]
 Integrins
  Integrin beta subunits
   112247447
SSDB
Motif
Pfam: Integrin_beta PSI_integrin PSI
Other DBs
NCBI-GeneID: 112247447
NCBI-ProteinID: XP_024271975
LinkDB
Position
Unknown
AA seq 357 aa
MGIAVLLLLILRHWINNVEGTCSVGSAVTCDECLQLGPHCAWCTQENFTDSFLISERCDT
PYVLLGRGCPQDQVEFPVTNSEVLRDQPLGKKMGNTNSTQISPQKMALKLRTGSEVTFQI
SVQQTEDYPVDIYYLMDLSASMIDDLEMIKDLGSTLSKEMAKLTSKFRLGFGSFVEKPVL
PFIKITPGELENPCRSVDESCLPTFGYKHILPLTSSTEKFNNIITNQRVSANIDLPECGF
DAIMQAAVCIVVPNDGECHLDSNNEYSMAAHLEYPTLGQLMDKLVDNNILLIFAVTENQK
HNYENYASFIPGATVGVLESDSRNILKLIVTAYKVRVRFCHCGSTVCLLVSRTIETC
NT seq 1074 nt   +upstreamnt  +downstreamnt
atggggattgctgtacttctgctcctgattcttcggcattggatcaacaacgtggaggga
acatgttcggttggcagcgcagtgacttgtgacgagtgtctccagctggggccccactgt
gcatggtgcacacaagagaatttcacagactcgtttttaattagtgagcgatgtgacacg
ccgtacgtcctcctagggagaggctgtccccaggaccaggtagaatttcctgtgaccaac
tccgaggtcctccgggaccagcctctcgggaagaagatggggaataccaacagcacccag
atttcaccacagaagatggccctcaaactcagaactggcagtgaggtgaccttccagatc
agtgtgcagcagacagaggactaccctgtagacatctactacctgatggacctctcagcc
tccatgattgacgacctggagatgattaaagacttgggctccaccctatccaaagagatg
gcaaagctcaccagtaaattcagacttggattcgggtccttcgttgagaaaccagtcctc
ccgttcattaagatcactcctggagagctggagaacccttgtaggagtgtggatgagagc
tgtctgccaacgtttggatacaaacacatcctacctctcaccagcagcacagagaagttc
aacaatatcatcaccaaccagcgtgtttctgccaacatcgacctgccggagtgtggcttc
gatgccattatgcaggctgctgtctgcatcgtcgtccctaacgacggggagtgccatctg
gacagcaacaatgaatactctatggctgcccatctggaatacccaactctgggacagctg
atggataaactggtggacaataatatcctgcttatattcgctgtgacggaaaatcagaaa
cacaactacgagaactatgcaagtttcatacctggtgccacggtgggggttctggaatca
gattcaagaaacatcctgaaactgattgtgacggcgtataaagtaagagttcgattctgt
cactgtgggagtacagtgtgtttgttagttagcaggactattgagacttgctga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112254586
Entry
112254586         CDS       T05605                                 

Definition
(RefSeq) integrin beta-7-like isoform X1
  KO
K06590  integrin beta 7
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
otw04514  Cell adhesion molecules
otw04672  Intestinal immune network for IgA production
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112254586
   04514 Cell adhesion molecules
    112254586
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112254586
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112254586
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    112254586
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112254586
   04515 Cell adhesion molecules [BR:otw04515]
    112254586
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112254586
Cell adhesion molecules [BR:otw04515]
 Integrins
  Integrin beta subunits
   112254586
SSDB
Motif
Pfam: Integrin_beta Integrin_b_cyt EGF_2 I-EGF_1
Other DBs
NCBI-GeneID: 112254586
NCBI-ProteinID: XP_024283064
LinkDB
Position
7
AA seq 767 aa
MVGFFLLGTFILYCVGQIQIQGIPQICVSQPSCSACLRSPGCAWCKHKDFLKSGESTERR
CDTAESLRTRGCEQTDIINPQSELVFLKNNELSSDPDNVVQLKPQNLLFKLRVGVPQTFS
VSFKRAEGYPIDLYYLMDLSFSMRDDLDTIKNLGQEILSTLKNVTNKVRIGFGSFVDKVA
LPYVSQVKDKKNNPCPSRLYTCQPAFSFQNILGLTQDVAEFKTRVSNQIISGNLDSPESG
FDAIMQAAVCQGVIGWNNVTRILVYTSDDTFHIAGDGRLAGIFEPNDGKCHLNGSGFYDG
TKYDYPSVGQLARVLAANNIQLIFAVTEDSVAAYKALSKLIPQSVLGVLKNDSSNVVQLI
LEAYSNLSSTILLEHHGAPSGLDVTYRSHCTPAEGDNTPWQRRGECMNVKLNQQVDFTVS
LNISMSEGECLKEKKQFFLKLQGISETLKVSVETLCDCDCHDREQQSTHCNEKGTLNCGI
CSCDEDHLGQRCECEQPKDMISADSMDTTCHQDSSLLLCSGHGGCECGICVCQGTHRGDF
CQCDDNSCDRHNNMLCSGNGQCDCGTCKCHANYTGSACDCSTLTDQCRTAGKLCNGQGTC
QCNQCQCNNDFFGMSCSKIANACAKFLACVTCELANKESDGLKSNCSRPCGSVKPTWVEG
PQEFPCREDTISYKVELFPDGNILVLYADLPRSVDKTYVIIGSSVSSIIFIGIAVILISW
LMLEFHYRREYASFLKATETVVWKNIENPLFQDATTIVMNPIHIQED
NT seq 2304 nt   +upstreamnt  +downstreamnt
atggttggtttctttttattaggaacctttattttgtactgtgtgggacagatacaaatt
caagggatcccccaaatatgtgtgtcccagccttcatgttcagcctgcctgaggagccct
ggatgtgcttggtgcaaacacaaggacttcctgaagtctggggagtccactgagaggagg
tgtgacactgctgagtctctgaggaccagaggctgtgagcagacagacatcatcaacccc
caatcagaactggtcttcctaaagaacaatgagctcagcagcgacccagacaatgtggtc
cagcttaagccacaaaacctcctcttcaaactcagagtcggagtccctcagaccttcagt
gtgtcattcaagagagccgagggctaccccatagacctgtactacctaatggacctgtcc
ttctccatgagggacgacctggacaccatcaagaatctgggccaggaaatcctctctacg
ctaaaaaacgtcaccaataaggtccgcataggctttggctcgtttgtggacaaggtggct
ctgccatatgtcagccaggttaaggacaagaagaacaacccctgtcccagccgcctgtac
acctgtcaacctgccttcagcttccagaacattctgggactaacccaagacgtggccgag
ttcaagaccagggtcagcaaccagatcatctctggaaacctggactcccccgagtccggc
tttgacgccatcatgcaggcagctgtctgccagggtgtgattggttggaacaatgtcacc
cggatcctggtttacacgtcagatgacaccttccacattgccggggacggcaggctggct
gggatattcgaacctaatgatgggaagtgtcatctcaatggcagcggcttctacgatggc
actaaatatgactacccatcggttggccagctcgccagggtcctggcagccaataacatc
cagctcatctttgctgtcaccgaggacagtgttgctgcctacaaggcattgagtaaacta
atccctcagtcagtgctgggagtcctgaagaacgactccagcaacgtggtccagctcatc
ttagaggcctacagtaacctgtcctccactatcttattggagcaccatggagccccctca
ggtctggacgtgacctacagatcccactgcacccctgcagaaggggacaacaccccgtgg
cagaggaggggcgagtgcatgaacgtcaagctcaaccagcaggttgacttcacagtgagt
ctgaatatttcaatgtctgaaggagaatgtctgaaggagaagaagcagtttttcctcaaa
ctgcagggcatcagcgagaccctgaaggtctccgtggaaaccctgtgtgactgtgactgc
catgacagagaacagcagtccacacactgcaatgaaaagggaacgctcaactgcggaatc
tgcagctgtgacgaggatcacctgggtcaaaggtgtgagtgtgagcagcctaaggacatg
atctctgccgactctatggacacaacatgtcaccaagacagctccctgctgctatgtagt
gggcacgggggctgtgagtgtggcatatgtgtgtgccagggcacccaccgtggtgatttc
tgccaatgtgatgacaacagctgtgaccgccacaacaacatgctctgcagtggtaatggg
cagtgtgactgtggaacatgtaagtgtcatgccaactacacaggctctgcgtgtgactgt
tccaccctcaccgaccagtgcaggactgctgggaagctgtgcaatggccagggaacatgc
cagtgtaaccagtgccagtgcaacaatgacttctttggcatgagctgctcaaagattgct
aatgcatgcgcaaaattcctggcctgtgtgacgtgtgaattggccaataaggaaagtgac
ggactaaagagtaactgtagccgaccatgtggctcagtcaagcccacttgggttgaggga
ccccaggagttcccctgcagagaagacaccatctcctacaaagtggagctgttccctgac
ggcaacatcctggtcctctacgcagatctgccccgctctgttgacaagacttatgtgatc
attggcagctcggtgtccagcatcatcttcattgggatcgcagtgatcctcatcagctgg
ctgatgctggagttccactaccggagagagtacgccagcttcctcaaagcaacggagact
gtagtctggaaaaatatcgaaaatcctttgttccaggacgccacaaccatagttatgaac
cccatacacattcaagaggactga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112255159
Entry
112255159         CDS       T05605                                 

Definition
(RefSeq) integrin beta-6-like
  KO
K06589  integrin beta 6
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112255159
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112255159
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112255159
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112255159
   04515 Cell adhesion molecules [BR:otw04515]
    112255159
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   112255159
Cell adhesion molecules [BR:otw04515]
 Integrins
  Integrin beta subunits
   112255159
SSDB
Motif
Pfam: Integrin_beta PSI_integrin PSI
Other DBs
NCBI-GeneID: 112255159
NCBI-ProteinID: XP_024283982
LinkDB
Position
7
AA seq 357 aa
MGIAVLLLLILRHWINNVEGTCSVGSAVTCDECLQLGPHCAWCTQENFTDSFLISERCDT
PYVLLGRGCPQDQVEFPVTNSEVLRDQPLGKKMGNTNSTQISPQKMALKLRTGSEVTFQI
SVQQTEDYPVDIYYLMDLSASMIDDLEMIKDLGSTLSKEMAKLTSKFRLGFGSFVEKPVL
PFIKITPGELENPCRSVDESCLPTFGYKHILPLTSSTEKFNNIITNQRVSANIDLPECGF
DAIMQAAVCIVVPNDGECHLDSNNEYSMAAHLEYPTLGQLMDKLVDNNILLIFAVTENQK
HNYENYASFIPGATVGVLESDSRNILKLIVTAYKVRVRFCHCGSTVCLLVSRTIETC
NT seq 1074 nt   +upstreamnt  +downstreamnt
atggggattgctgtacttctgctcctgattcttcggcattggatcaacaacgtggaggga
acatgttcggttggcagcgcagtgacttgtgacgagtgtctccagctggggccccactgt
gcatggtgcacacaagagaatttcacagactcgtttttaattagtgagcgatgtgacacg
ccgtacgtcctcctagggagaggctgtccccaggaccaggtagaatttcctgtgaccaac
tccgaggtcctccgggaccagcctctcgggaagaagatggggaataccaacagcacccag
atttcaccacagaagatggccctcaaactcagaactggcagtgaggtgaccttccagatc
agtgtgcagcagacagaggactaccctgtagacatctactacctgatggacctctcagcc
tccatgattgacgacctggagatgattaaagacttgggctccaccctatccaaagagatg
gcaaagctcaccagtaaattcagacttggattcgggtccttcgttgagaaaccagtcctc
ccgttcattaagatcactcctggagagctggagaacccttgtaggagtgtggatgagagc
tgtctgccaacgtttggatacaaacacatcctacctctcaccagcagcacagagaagttc
aacaatatcatcaccaaccagcgtgtttctgccaacatcgacctgccggagtgtggcttc
gatgccattatgcaggctgctgtctgcatcgtcgtccctaacgacggggagtgccatctg
gacagcaacaatgaatactctatggctgcccatctggaatacccaactctgggacagctg
atggataaactggtggacaataatatcctgcttatattcgctgtgacggaaaatcagaaa
cacaactacgagaactatgcaagtttcatacctggtgccacggtgggggttctggaatca
gattcaagaaacatcctgaaactgattgtgacggcgtataaagtaagagttcgattctgt
cactgtgggagtacagtgtgtttgttagttagcaggactattgagacttgctga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112258603
Entry
112258603         CDS       T05605                                 

Definition
(RefSeq) integrin beta-3-like
  KO
K06493  integrin beta 3
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04145  Phagosome
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
otw04810  Regulation of actin cytoskeleton
otw05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112258603
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    112258603
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112258603
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112258603
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    112258603
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112258603
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112258603
   04515 Cell adhesion molecules [BR:otw04515]
    112258603
   04090 CD molecules [BR:otw04090]
    112258603
Membrane trafficking [BR:otw04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    112258603
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112258603
Cell adhesion molecules [BR:otw04515]
 Integrins
  Integrin beta subunits
   112258603
CD molecules [BR:otw04090]
 Proteins
  112258603
SSDB
Motif
Pfam: Integrin_beta Integrin_b_cyt Integrin_B_tail PSI_integrin I-EGF_1 EGF_2
Other DBs
NCBI-GeneID: 112258603
NCBI-ProteinID: XP_024288850
LinkDB
Position
9
AA seq 787 aa
MGTFFDRLWIFSGLLLASSEVLGSNICTSRGVSTCRQCLAIHPSCAWCFKEEFGQGGSSV
SRCDLKQNLLDGGCTKEELEFPFSTLSVQKDTPLSDKASGAADDVTQIRPQKLRLTLRPD
DARRFTVTVKQVEDYPVDLYYLMDLSYSMKDDLARLRSLGNQLAAAMGRTTSNLRMGFGA
FVDKPLSPYMYTFPEEAVSNPCHGIQTRCLPQFGYKHVLSLTKQVERFTEEVAKQQVSRN
RDSPEGGFDAVIQAVVCKDKIGWRGDASHLLVFTTDATTHIALDGRLAGLVQPNDGQCHI
DRDNNYDKSSTLDYPSLALITEKMSENNINLIFAVTNNVVPLYQNYSQLIPGTTVGTLSD
DSGNVIQLILDAYERIRSKVELELLGVPEELALSFNATCLNGELIQGLKSCSGLKIGDTV
SFSVEARLHGCPKEKNRTFTIKPVGFKDALEVTVHFACGCDCEATAQPESPLCNQGNGTY
ECGVCQCHPGRLGDRCECADGDYRPSDQGNCSPKAEDAICSGRGNCVCGQCSCHTSGFGK
VWGKYCECDDFNCLRFKGEICSGHGKCDCGFCKCGSDWMGENCNCTTRTDTCMSSMGLLC
SGRGQCVCGACECTQPGAYGATCERCPTCPDACSIKKECVECKHFKRGRLFEEKSCARIC
RDEIQKVEELVFYEKNAVNCTYKDENDCVEHFQYYEDASGKSILYVMEPDCPKGPDILVV
LMAVAGAILFLGLAGLLIWKLLVTVHDRREFAKFEEERAKAKWDTANNPLYKGATTTFTN
VTYRGNS
NT seq 2364 nt   +upstreamnt  +downstreamnt
atgggaactttttttgaccgactatggatattttctggtttattattagcttcttctgaa
gttcttggctcaaacatctgcacatctcgaggggtgagcacctgcagacagtgtttggct
atccaccctagctgtgcttggtgctttaaggaagagtttggccaagggggctccagtgtg
tcccgttgtgatctgaagcagaacctgttggatgggggttgtacgaaggaggagctagag
ttccccttcagtaccctcagcgtgcagaaagacacgcccctcagtgacaaggcgtcgggg
gcggctgacgacgtcacccagatcagaccccagaaactccgcctcactctgagaccagat
gatgccaggcgtttcacagtgacagtgaagcaggtggaggactacccagttgacctgtac
tatctgatggacctctcctactccatgaaggacgacttggcccgcctgcgctccctgggc
aaccagctggctgcagccatgggccgcaccaccagcaacctgcgtatgggctttggggcc
tttgtggacaagcccctgtccccatatatgtacaccttccctgaggaagccgtcagtaac
ccttgccatgggatccagacgcggtgcctgcctcagtttggctacaagcacgtgctgtct
ctgaccaagcaggtggagcgcttcaccgaggaggtggcgaagcagcaggtgtctcgtaac
agagactctccagagggaggcttcgacgcagtcatacaggcagtggtgtgcaaggacaag
ataggctggcgtggggatgcctcccacctgttggtgttcactaccgacgctacgacacac
atagccctggacggccggctggctggtctagtgcagcccaatgatggacagtgtcacatc
gacagagacaacaactatgacaagtcgtcaaccctggactacccctctctggctctgatc
acagagaagatgtctgagaacaacatcaacctaatttttgccgtgaccaacaatgtggtg
cccctctaccagaactacagccagctgatccctggcaccacagttggaacgctgtcggat
gactctgggaatgtgatccaactcatcctggatgcttacgagaggatccgttccaaggtg
gagctggagttgctgggtgttccagaggagctggctctgtccttcaatgccacctgtctc
aacggagagctcatccagggactcaagtcctgctccggacttaagatcggagacacagtg
tcgttcagtgtggaggccaggttacacggctgccctaaggagaagaaccgtaccttcacc
attaaacctgtgggcttcaaggacgccctggaggttacggtccacttcgcctgcgggtgt
gactgtgaggccacagcccagcccgagagccctctctgtaaccagggaaatgggacctac
gagtgtggtgtgtgccagtgtcacccggggcgcctgggagaccgctgtgagtgtgccgac
ggggactacaggccctcagaccagggcaactgcagccccaaagctgaagacgccatctgc
agtgggaggggcaactgtgtgtgtggccagtgctcctgccacactagtggctttggaaaa
gtgtggggcaagtactgcgagtgtgacgacttcaactgcctgcgcttcaaaggagagatc
tgctcaggccatgggaaatgtgactgtggcttctgcaagtgtggctctgactggatgggg
gagaactgtaactgcacaacccggacagacacctgcatgtccagtatgggcctgctgtgc
agcggccggggccagtgtgtgtgtggggcctgtgagtgcacccagccaggggcctacggg
gccacttgtgagaggtgtccaacctgccctgatgcctgcagcatcaagaaggaatgtgtt
gaatgtaagcacttcaagagaggccgtctctttgaggagaaaagctgtgcccgaatctgc
agggatgaaattcagaaggtggaagaactagtcttctatgagaagaatgctgtgaactgc
acctataaggatgagaatgactgtgtagagcacttccagtactacgaggatgccagtgga
aagtccatcctatatgtcatggagcctgactgccctaaagggcctgatatcctggtggtt
ctcatggcggtggcaggggccatcttgtttctgggtctggctggcctcctcatctggaag
ctgctggtcaccgttcatgatcgccgagagttcgccaagtttgaggaagagagggctaag
gccaaatgggatacggctaacaaccccttgtacaaaggagccaccaccactttcaccaat
gtgacctaccgtgggaactcttga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112260414
Entry
112260414         CDS       T05605                                 

Definition
(RefSeq) integrin beta-1-like isoform X1
  KO
K05719  integrin beta 1
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04145  Phagosome
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
otw04514  Cell adhesion molecules
otw04530  Tight junction
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112260414
   04514 Cell adhesion molecules
    112260414
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    112260414
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112260414
   04530 Tight junction
    112260414
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112260414
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112260414
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112260414
   04515 Cell adhesion molecules [BR:otw04515]
    112260414
   04090 CD molecules [BR:otw04090]
    112260414
Membrane trafficking [BR:otw04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    112260414
Exosome [BR:otw04147]
 Exosomal proteins
  Proteins found in most exosomes
   112260414
Cell adhesion molecules [BR:otw04515]
 Integrins
  Integrin beta subunits
   112260414
CD molecules [BR:otw04090]
 Proteins
  112260414
SSDB
Motif
Pfam: Integrin_beta Integrin_b_cyt Integrin_B_tail I-EGF_1 EGF_2
Other DBs
NCBI-GeneID: 112260414
NCBI-ProteinID: XP_024291255
LinkDB
Position
10
AA seq 804 aa
MDLKLLSIATLLGILCFCSAQQEGSDCIKANAQSCGECIQVAEKCGWCTDADFLKQGESK
SARCDELKSLITKGCSKAKIENPRGSISIDKDKPVTNRKKDVAEKLKPDQITQIQPQKLS
LNLRSGEAQTFKLKFKRAEDYPIDLYYLMDLSFSMKDDLENVKNLGTDLMREMQEITSDF
KIGFGSFVEKTVMPYISTTPARLLNPCTSNENCTSPFSYKNVLKLTENGQQFNSLVSKQQ
ISGNLDSPEGGFDAIMQVAVCGDAIGWRNVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGK
CHLENNMYTMSHYYDYPSIAHLVQKLSDNNIQTIFAVTEEFQPVYKELKNLIPKSAVGTL
SSNSSNVIKLIIDSYNSLSSEVILENNKVPEGVSIKYKSICKNGVVGTGENGRKCSNISI
GDEVSFDITIESQKCPSQGKSETIRIKPLGFNEDVEIVLNFICECECSKGGEPLSKICHN
GNGTFECGACRCNEGRIGRLCECSTDEVRTDDLDGNCRKDNGTDICSNNGDCVCGTCECK
KRENPEERYSGKFCDCDNFNCDRSNNKLCGGHGRCECRVCICDANYTGSACDCSLDTSTC
LAANKQICNGRGTCECGVCKCTNPKFQGPTCEICPTCPGVCAEHKECVQCRAFETGEKKD
TCQRDCSYFNLIRVKDRDKLPQPADQSYPLSHCKERDANDCWFYYTYAVRNDTMREVYVV
ETLECPAGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDTQ
ENPIYKSPINKFQNPSYGRKGVVL
NT seq 2415 nt   +upstreamnt  +downstreamnt
atggatctgaagctactttctatagcaacattattaggaatcctatgtttctgcagtgca
cagcaagagggcagtgattgcatcaaggcgaatgcacaatcatgtggggaatgcatccag
gtggcagagaaatgtggatggtgtacagacgctgacttcctgaagcagggagagtctaag
tcagctcgctgtgatgagctgaagtccctgatcacgaagggctgcagtaaggccaagatc
gagaacccccggggcagtatctccatcgacaaggacaagcccgtcaccaaccgcaagaag
gacgtggccgagaagctgaagcctgaccagatcactcagatccagccccagaaactcagc
ctcaacctccgatctggtgaggcccagacgtttaagttgaagttcaagcgggcagaggac
taccccatcgacctctactacttgatggacctctctttctccatgaaagacgatttggag
aacgtcaagaacctggggactgacctgatgcgtgagatgcaggagatcacgtcagacttc
aagattggtttcggctcatttgtggagaagactgtgatgccctacatcagcaccacccca
gccaggctgttgaacccctgcacgagcaatgagaactgcaccagccctttcagctataag
aatgtgctcaagttgaccgagaatgggcagcagttcaacagcctggtcagcaagcagcag
atctctggaaacctggactcccctgagggaggcttcgatgccatcatgcaggtggcggtc
tgtggggatgccattggctggaggaacgtcactcgtctgctggtgttctccactgacgct
gggttccactttgctggagacggcaaactgggcggcatcgttctgcccaacgatggaaag
tgtcatctggaaaacaacatgtacaccatgagccattactacgactatccctccattgcc
catttggtccagaaactgagcgacaacaacattcagacaatttttgcagttactgaggaa
ttccagccggtttacaaggaactgaagaatctcatccccaagtcagcagtaggaaccctg
tcctccaactccagcaacgtcatcaagctcattatcgattcttacaattctctttcatct
gaagtcattctggagaacaacaaggtgcctgaaggtgtgtccataaaatacaagtccatc
tgcaagaatggcgtggttggtacgggagagaacggaagaaaatgctctaacatctccatt
ggagatgaggtgtcctttgacattaccatcgagtcccagaagtgtccatctcaaggcaag
tcagagaccattaggatcaagccgctgggtttcaatgaggatgtggagattgtcctcaac
ttcatctgcgaatgtgaatgttccaaaggcggagaacctctcagcaagatctgccacaat
ggcaacgggacctttgagtgtggagcctgcaggtgcaacgaaggacgtatcggcagactg
tgtgagtgcagcacagatgaggtgaggacagacgacctggacggtaactgtcggaaggac
aacggtacagacatctgcagcaacaacggagactgtgtgtgtggaacttgtgagtgtaag
aagagggagaaccccgaagaacggtacagtgggaaattctgcgactgtgacaacttcaac
tgtgaccgctccaacaacaaactctgtggaggacatgggcgttgtgagtgcagggtgtgt
atctgcgatgccaactacacaggcagcgcctgcgactgttcactggacacctccacctgc
ctggcagccaacaagcagatatgtaatggccggggcacctgcgagtgtggcgtctgcaaa
tgcaccaaccccaagttccagggtcccacctgtgagatctgccccacctgccccggagtc
tgcgctgagcacaaggagtgtgttcagtgccgggcctttgaaaccggagagaagaaggac
acgtgtcagagggactgcagctatttcaacctgatcagagtgaaggatcgggacaagctg
ccccaaccagccgaccaatcctaccccctatcccactgtaaggagagggacgccaacgac
tgctggttctactacacctacgccgtcaggaacgacacaatgagggaggtctacgtggtc
gagactctggagtgcccagcgggccctgacatcatccccatcgtggctggcgtggtggcg
ggcattgtgctcattggcctggccctactgctcatctggaagctgctcatgatcatccac
gaccgcagagagttcgccaagttcgagaaggagaagatgaacgccaaatgggacacgcaa
gagaatcctatatacaagagccctataaataagttccagaatccaagctatgggcgtaaa
ggcgtggtcctataa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112266506
Entry
112266506         CDS       T05605                                 

Gene name
itgb6
Definition
(RefSeq) integrin beta-6
  KO
K06589  integrin beta 6
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04510  Focal adhesion
otw04512  ECM-receptor interaction
otw04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112266506 (itgb6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112266506 (itgb6)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112266506 (itgb6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112266506 (itgb6)
   04515 Cell adhesion molecules [BR:otw04515]
    112266506 (itgb6)
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   112266506 (itgb6)
Cell adhesion molecules [BR:otw04515]
 Integrins
  Integrin beta subunits
   112266506 (itgb6)
SSDB
Motif
Pfam: Integrin_beta Integrin_b_cyt I-EGF_1 PSI_integrin Integrin_B_tail EGF_2
Other DBs
NCBI-GeneID: 112266506
NCBI-ProteinID: XP_024299791
LinkDB
Position
14
AA seq 784 aa
MGTAVLLLLILRHWINNVEGTCSVGSAVTCDECLQLGPHCAWCTQENFTDSFLISERCDT
PYLLQERGCPQDQVEFPVTTSEVLRDQPLGKKTGNTNSTEISPQKMALKLRTGSEVTFQV
SVQQTEDYPVDIYYLMDLSASMIDDLEMIKDLGSTLSKEMAKLTSKFRLGFGSFVEKPVL
PFIKITPGELDNPCRSVDESCLPTFGYKHVLPLTSSTEKFNNIITNQRVSANIDLPECGF
DAIMQAAVCGDKIGWRNDSMRLLVFVSDADSHFGMDSKMSGIVVPNDGECHLDSNNEYSM
AAHLEYPTLGQLMDKLVDNNILLIFAVTENQKHNYENYASFIPGATVGVLESDSRNILEL
IVTAYKELRSEIELEVLARHRDLQISFSICQDGTYYWTETSSNVKAGDTVSFNVTVELSE
CLDGPQRFLIKPVGFQDPLEIDLESLCXCACQQTPEPNSSHCSLGRGSLECGSCLCDPGY
MGSKCECTEESVQSSNCKESGASESCSGQGECYCGQCVCHPSSFGRVYGAYCECDDFSCV
RFRGLLCGGHGDCDCGECVCHSGWIGEYCNCSSSRDTCVSEDGALCSGRGKCVCGKCVCS
MPGASGDTCERCPTCGDSCTSARTCVECHLQAEDEATEECVQRCSVPHVFVNNSTEYDES
RSTLCTLKSENNCFISFSVVAGDAGSTVYNLKMYDCPEPPNIAMIVLGVSLSILTIGLIL
LGVWKLLISVHDRNEVAKFEAERAKAKWQSGTNPLFRSSTSTFKNVTYKSAGGPKVDIHS
MDGY
NT seq 2355 nt   +upstreamnt  +downstreamnt
atgggaactgctgtacttctgctcctgattcttcggcattggatcaacaacgtggaggga
acatgttcggttggcagtgcagtgacttgtgacgagtgtctccagcttggtccccactgt
gcatggtgcacacaagagaatttcacggactcgtttttaatcagtgagcgatgtgacaca
ccgtacctcctccaagagagaggctgtccccaggaccaggtggaattcccagtgaccact
tccgaggtcctccgggaccagccactcgggaagaagacaggaaataccaacagcacagag
atatcaccacagaagatggccctcaaactcagaactggcagtgaggtgaccttccaggtc
agtgtgcagcagacagaagactaccctgtagacatctactacctgatggacctctcagcc
tccatgattgacgacctggagatgattaaagacttgggctccaccctgtccaaggagatg
gcaaagctcaccagtaaattcagacttggatttgggtccttcgttgagaaaccagtcctc
ccgttcattaagatcactcctggagagctggataacccttgtaggagtgtggatgagagc
tgtctgccaacgtttggatacaaacacgtcctacccctcaccagcagcacagagaagttc
aacaatatcatcaccaaccagcgtgtgtctgccaacatcgacctgccggagtgtggcttc
gatgccattatgcaggctgctgtctgtggggacaagataggctggaggaacgactccatg
cgtctgctggtgtttgtgagcgacgccgactctcactttgggatggacagcaagatgtca
ggcatcgtcgtccctaacgacggggagtgccatctggacagcaacaatgaatactctatg
gctgcccatctggaatacccaactctgggacagctgatggataaactggtggacaataat
atcctgctgatattcgctgtgacggaaaatcagaaacacaactacgagaactatgcaagt
ttcatacctggcgccacggtgggggttctggagtcagattcaaggaacatcctggaactg
attgtgacggcgtataaagagctgcggtctgagatagagctggaggtgctagcgagacac
agggatctacagatctccttcagcatctgtcaggatgggacgtactactggacagaaacg
agctccaacgtcaaagctggagacacggtctccttcaacgtgactgtagaactctctgag
tgtctcgacggtccccagcgtttcctcatcaaaccggtgggctttcaggaccccctggag
atagacctggagtccctgtgckcctgtgcctgtcagcagaccccygagcccaacagcagc
cactgcagcctgggccggggatctctggagtgtggctcctgtctgtgtgatcccgggtac
atgggttccaagtgtgagtgtacggaggagagcgtccagagcagtaactgcaaggaaagt
ggcgcttcggagtcctgtagcgggcaaggggagtgttactgcggccagtgtgtgtgtcac
ccgtctagtttcggacgcgtctacggggcctactgcgagtgtgacgacttctcgtgtgtg
aggttccgagggttactctgtggaggtcacggggactgtgactgcggcgagtgtgtgtgt
catagcggctggataggggagtactgtaactgcagcagcagcagggacacgtgtgtgtcg
gaggacggagcgctgtgcagcggacgggggaagtgtgtgtgcgggaagtgtgtgtgttcc
atgcccggagcctctggagacacctgtgaaaggtgccctacctgtggagactcctgtacc
tcagctagaacctgtgtggagtgtcatctgcaagcagaagacgaggccacagaggagtgt
gtccaaaggtgcagcgtccctcacgtcttcgtcaacaattccacagaatacgatgagagc
cggtccacactgtgtaccctaaagagtgagaacaactgcttcatctctttcagtgtggtg
gctggagacgcagggagcactgtgtataatctaaagatgtacgactgtcctgagcccccc
aacatagctatgatagtactgggggtctctctgtccattctcaccatcggcctcatcctg
ctgggggtgtggaagctgttgatctcagtccacgaccgcaatgaggtcgccaagtttgag
gccgagagggcaaaggctaaatggcagtcgggtacaaaccctctgtttagaagctcgaca
tcaacgttcaaaaatgtaacttataaaagtgcagggggaccgaaagttgatattcattca
atggatggctactga

DBGET integrated database retrieval system