KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112215764
Entry
112215764         CDS       T05605                                 

Definition
(RefSeq) RAF proto-oncogene serine/threonine-protein kinase-like isoform X1
  KO
K04366  RAF proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04012  ErbB signaling pathway
otw04068  FoxO signaling pathway
otw04140  Autophagy - animal
otw04150  mTOR signaling pathway
otw04210  Apoptosis
otw04218  Cellular senescence
otw04270  Vascular smooth muscle contraction
otw04370  VEGF signaling pathway
otw04371  Apelin signaling pathway
otw04510  Focal adhesion
otw04540  Gap junction
otw04625  C-type lectin receptor signaling pathway
otw04810  Regulation of actin cytoskeleton
otw04910  Insulin signaling pathway
otw04912  GnRH signaling pathway
otw04914  Progesterone-mediated oocyte maturation
otw04916  Melanogenesis
otw05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112215764
   04012 ErbB signaling pathway
    112215764
   04370 VEGF signaling pathway
    112215764
   04371 Apelin signaling pathway
    112215764
   04068 FoxO signaling pathway
    112215764
   04150 mTOR signaling pathway
    112215764
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112215764
  09143 Cell growth and death
   04210 Apoptosis
    112215764
   04218 Cellular senescence
    112215764
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112215764
   04540 Gap junction
    112215764
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112215764
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    112215764
  09152 Endocrine system
   04910 Insulin signaling pathway
    112215764
   04912 GnRH signaling pathway
    112215764
   04914 Progesterone-mediated oocyte maturation
    112215764
   04916 Melanogenesis
    112215764
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    112215764
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112215764
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112215764
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112215764
Protein kinases [BR:otw01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   112215764
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like Pkinase_fungal C1_2 zf-RING_2
Other DBs
NCBI-GeneID: 112215764
NCBI-ProteinID: XP_024230913
LinkDB
Position
16
AA seq 682 aa
MEHLQGAWKTLSNGFGMKDSVFEGPCLSPTLVQGFPYQRRSSDDSKIPDSKTSSTIRVYL
PNQQRTVVNVRPGMTLHSCLIKALKVRGLQPECCAVFRLHPGQRSKKSRMDWNTDSTSLI
GEELLVEVLDHVPLTTHNFVRKTFLKLAFCDICQKFLLNGFRCQTCGYKFHEHCSTKVPT
MCVDWSNIRQLLLFPTPGESGGPSLPPLTSRRMRESLSRFPSSSLHRYSTPHAFNYTAPY
PPTGITLSQRQRSTSTPNVHMVSTTLPVDSSMIELDCLNAYPSSWCRRFWLKRRVGIVRF
SNSFLEATSESPAKEAMRNHEAMRNHDSDGSSPSQSPTSWSQSKTPAPDRRERAPSFNTQ
EKHKIRPRDKRDSSYYWEIEASEVVLHSRIGSGSFGTVYKGKWHGDVAVKILKVIDPTPE
QFQAFRNEVAVLRKTRHVNILLFMGYMTKDNLAIVTQWCEGSSLYKHLHVQETNLQMFQL
IDIARQTAQGMDYLHAKNIIHRDMKSNNIFLHEGLTVKIGDFGLATVKARWSGSHQVEQP
SGSILWMAPEVIRMQDNMPYSFQSDVYSYGVVLYELMTGELPYSQIANRDQIIFMVGRGY
LSPDLSKLYKSCPKAMKRLVADCIKKIKDERPLFPQILSSIELLQHSLPKINRSASEPSL
HRASHTEDINVFTSTYSRLPVF
NT seq 2049 nt   +upstreamnt  +downstreamnt
atggagcacctccagggtgcgtggaagaccctgagcaacggctttggaatgaaagactct
gtgttcgagggcccctgcctctcccccaccttggttcagggctttccctaccagcgccgc
tcctcagacgacagcaagatccccgactctaagaccagcagcaccatccgagtctacctc
cccaaccagcagcgcaccgtggtgaacgtgaggccaggtatgaccctgcacagctgcctg
ataaaagcgctgaaggtgcggggtctgcagccggagtgctgtgctgtcttcagactgcac
ccaggacagaggagtaaaaagtcacgtatggattggaataccgactctacctcactaatt
ggggaagaactgctggtggaagtgttagatcatgtccccttgacgacgcacaactttgtt
cggaaaacatttcttaagttggccttctgcgatatatgccagaagttccttttgaacggt
ttccgttgccaaacatgcggctacaaattccatgagcattgcagcaccaaagtgcccacc
atgtgtgtggattggagcaacatcagacagctcctgttgttccctacaccaggtgaaagt
gggggtccatctcttcctcctcttacatctcgacgaatgagagaatcactatcccgattc
cctagcagctctctgcaccgctactcaacccctcacgccttcaactacacggccccctac
ccacccacagggatcactctgtcccagaggcagcgatccacctccacgcccaacgtccac
atggtcagcaccaccctgcctgtcgacagcagcatgattgagctagattgcctgaatgcc
taccctagctcctggtgcaggcgcttctggctgaagaggagagtaggtattgttcgcttc
tccaactcttttcttgaggcgacttcagagagcccagccaaggaggcaatgcgtaatcac
gaagcaatgcgtaatcatgactccgacgggagttcccccagccagagtcccacaagctgg
tcacagtctaaaaccccagcgccagacagacgagaacgggctccgtcgttcaacactcaa
gagaaacacaaaattcgtccgagggacaagcgagactctagttactactgggagatcgag
gccagtgaagtggtgctgcactcccgtatcggctcaggctcctttggaacggtgtacaaa
gggaaatggcacggtgacgtagcagtgaagatcctaaaggtgattgaccccacaccggaa
cagttccaggcctttagaaacgaggtggctgtgctaaggaaaacacgacacgtcaacatc
ctattgttcatgggctacatgacgaaggacaacctggccatcgtgacacagtggtgtgaa
ggcagcagcctctataaacacctccacgtccaggagactaacttacagatgttccagctc
atagacatcgccaggcagacagctcagggcatggactatttgcacgctaaaaacatcatc
caccgggacatgaaatcaaacaatatcttcctacacgagggcctgacggtgaagattggc
gactttggtctggccacagtcaaagccaggtggagtggttctcaccaggtggagcaacct
tcagggtccatactgtggatggctccagaggttatacggatgcaggacaatatgccctat
agtttccagtctgacgtatactcttacggtgttgtcctctatgagctgatgacaggagag
ctgccatactcacagatagccaacagagaccagatcatcttcatggtgggtcgggggtac
ctgtctccagacctcagtaagctttataagagctgccccaaagccatgaagaggctggtg
gctgactgcatcaagaaaatcaaagacgagaggcctctgtttccccagatcctatcgtcc
attgagctgctccagcactccctgcctaagatcaaccgcagtgcctcggaaccctccctg
cacagagcctcccacaccgaggacatcaacgtcttcacatcaacctatagcaggctgcct
gtgttctag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112222214
Entry
112222214         CDS       T05605                                 

Definition
(RefSeq) RAF proto-oncogene serine/threonine-protein kinase-like
  KO
K04366  RAF proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04012  ErbB signaling pathway
otw04068  FoxO signaling pathway
otw04140  Autophagy - animal
otw04150  mTOR signaling pathway
otw04210  Apoptosis
otw04218  Cellular senescence
otw04270  Vascular smooth muscle contraction
otw04370  VEGF signaling pathway
otw04371  Apelin signaling pathway
otw04510  Focal adhesion
otw04540  Gap junction
otw04625  C-type lectin receptor signaling pathway
otw04810  Regulation of actin cytoskeleton
otw04910  Insulin signaling pathway
otw04912  GnRH signaling pathway
otw04914  Progesterone-mediated oocyte maturation
otw04916  Melanogenesis
otw05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112222214
   04012 ErbB signaling pathway
    112222214
   04370 VEGF signaling pathway
    112222214
   04371 Apelin signaling pathway
    112222214
   04068 FoxO signaling pathway
    112222214
   04150 mTOR signaling pathway
    112222214
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112222214
  09143 Cell growth and death
   04210 Apoptosis
    112222214
   04218 Cellular senescence
    112222214
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112222214
   04540 Gap junction
    112222214
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112222214
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    112222214
  09152 Endocrine system
   04910 Insulin signaling pathway
    112222214
   04912 GnRH signaling pathway
    112222214
   04914 Progesterone-mediated oocyte maturation
    112222214
   04916 Melanogenesis
    112222214
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    112222214
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112222214
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112222214
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112222214
Protein kinases [BR:otw01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   112222214
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like Pkinase_fungal C1_2 zf-RING_2
Other DBs
NCBI-GeneID: 112222214
NCBI-ProteinID: XP_024240680
LinkDB
Position
22
AA seq 644 aa
MEHLQGAWKTLSNGFGMKDSVFEGPCLSPTMVQGFPSQRRSSDDSKIPDSKTSSTIRVYL
PNQQRTVVNVRPGMTLHSCLIKALKVRGLQPECCAVFRLHPGQRSKKSRMDWNTDSTSLI
GEELLVKVLDHVPLTTHNFVRKTFLKLAFCDICQKFLLNGFRCQTCGYKFHEHCSTKVPT
MCVDWSNIRQLLLFPTPGESGGPSLPPLTSRRMRESLSRLPSSSLHRCSTPHAFNYTAPY
PPTGGALSQRQRSTSTPNVHMVSTTMPVDSSMMEEAMRNHEAMRNHDSGGSSPSQSPTGW
SQSQSNTPAPDRRERAPSFNTQEKHKIRPRDKRDSSYYWEIEASEVVLHSCIGSGSFGTV
YKGKWHGDVAVKILKVIDPTPEQFQAFRNEVAVLRKTRHVNILLFMGYMTKDNLAIVTQW
CEGSSLYKHLHVQETNFQMFQLIDIARQTAQGMDYLHAKNIIHRDMKSNNIFLHEGLTVK
IGDFGLATVKARWSGSHQVEQPSGSILWMAPEVIRMQDNMPYSFQSDVYSYGVVLHELMT
GELPYSQIANRDQIIFMVGRGYLSPDLSKLYKSCPKAMKRLVADCIKKIKDERPLFPQIL
SSIELLQHSLPKINRSASEPSMHRASHTEDINAFTSTYSRLPVF
NT seq 1935 nt   +upstreamnt  +downstreamnt
atggagcacctccagggagcatggaagaccctgagcaacggctttgggatgaaggactct
gtgttcgagggcccttgcctttccccgaccatggtgcagggcttcccctcccagcgccgc
tcttccgacgacagtaagatccccgactccaagaccagcagcaccatccgcgtctacctc
cccaaccagcagcgcacagtggtgaatgtgaggccaggtatgaccctgcacagctgcctg
atcaaagcgctgaaggtgcggggcctgcaaccggagtgctgtgctgtcttcagactgcac
ccaggacagaggagtaaaaagtcacgtatggattggaataccgactctacctcactaatt
ggggaagaactgctggtgaaagtcttagatcatgtccccttgacgacgcacaactttgtt
cggaaaacatttctgaagttggccttctgcgatatatgccagaagttccttttgaatggt
ttccgttgccaaacatgcggctacaaattccatgagcattgcagcaccaaagtgcccacg
atgtgtgtggattggagcaacatcagacagctcctgttgttcccgacaccaggtgaaagt
gggggtccatctcttcctcctcttacttctcggcgaatgagagaatcgctgtcccgactc
cccagcagctctcttcatcgctgctctacccctcacgccttcaactacacggccccctac
ccacccacggggggcgctctgtcccagaggcagcgctccacctccacgcccaacgtccac
atggtcagcaccaccatgcccgtcgacagcagcatgatggaggaagcaatgcgtaatcat
gaagcaatgcgtaatcatgactcaggcgggagttcccccagccagagtcccacaggctgg
tcccagtcccagtctaacaccccagctccagacagacgagagagggctccttcattcaac
actcaggagaaacacaaaatacgtccgagggacaagcgggactccagttattactgggag
attgaggccagtgaagtggttcttcactcctgtatcggctcaggctccttcggaacggta
tacaaagggaaatggcacggtgacgtagcggtgaagatcctaaaggtgattgaccccacg
ccagagcagttccaggccttcagaaacgaggtggctgtccttaggaaaacgcggcacgtc
aacatcctgttgttcatgggctacatgacgaaggacaacctggccatcgtgacccagtgg
tgtgagggcagcagcctctacaaacaccttcacgtccaggagaccaacttccagatgttc
cagcttatagacattgccaggcagacagctcagggcatggactatttgcacgccaaaaac
atcatccaccgggacatgaagtcaaacaatatcttcctacatgagggcctgacggtgaag
ataggagactttggtctggccacggtcaaggccaggtggagtggttctcaccaggtggag
caaccctcagggtccatactgtggatggctcctgaggttatccgtatgcaggacaacatg
ccctatagtttccagtctgacgtgtactcctacggtgttgtcctccatgagctgatgacg
ggagagctgccatactcacagatagccaacagagaccagatcatcttcatggtgggccgg
gggtacctgtctccagatctcagtaagctttataagagctgtcctaaggccatgaagagg
ctggtggccgactgcatcaagaaaatcaaggacgagaggccactgttcccccagatcctg
tcgtcaattgagctgctccagcactccctgcctaagatcaaccgcagtgcctcagaaccc
tccatgcacagagcctcccacaccgaggatattaacgccttcacttccacctatagcaga
ctgcctgtgttctga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112248687
Entry
112248687         CDS       T05605                                 

Definition
(RefSeq) serine/threonine-protein kinase A-Raf-like
  KO
K08845  A-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04012  ErbB signaling pathway
otw04068  FoxO signaling pathway
otw04270  Vascular smooth muscle contraction
otw04810  Regulation of actin cytoskeleton
otw04910  Insulin signaling pathway
otw04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112248687
   04012 ErbB signaling pathway
    112248687
   04068 FoxO signaling pathway
    112248687
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112248687
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112248687
   04914 Progesterone-mediated oocyte maturation
    112248687
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    112248687
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112248687
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112248687
Protein kinases [BR:otw01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   112248687
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like Pkinase_fungal Kdo TUG-UBL1 APH
Other DBs
NCBI-GeneID: 112248687
NCBI-ProteinID: XP_024273695
LinkDB
Position
4
AA seq 611 aa
MSSNSSSCSSSGETSPEDVPRGGGTIRVFLPNQQRTVVNVRPGQTVYDSLDKALKVRGLS
QDCCAVFRLLEGRKRLTDWNTDITPLVGEELLVEVLDDVPLTMHNFVRKTFFKLAYCDFC
HKFLFNGFRCQTCGYKFHQHCSSKVPTVCVDMDTITKRCTPNPCPDEYPQISILLPDNSI
SQSDIALTPDPSGHGLLSPTSAFRFPLPGGDGQSLQRHRSTSTPNVHMVSTVGPAGVSII
EDALKLQNNTMVPEPSPKPSTSPPSLGSPGRRPPKSPSEHKERKPSSSDDKKKVHRGGYR
DSSYYWEVHSREVNIQKRIGAGSFGTVFKGKWHGDVAIKILKVTEPTPEQLQAFKNEMQV
LRKTRHVNILLFMGFMTKPNFAIITQWCEGSSLYRHLHVSETKFETMRRIDVARQTAQGM
DYLHAKNIIHRDLKSNNIFLHEGWTVKIGDFGLATVKSRWSGSEQVEQPSGSILWMAPEV
IRMQDANPYTFQSDVYGYGVVLFELMSGTLPYSQINNRDQILFMVGRGYLSPDLSLLSSS
SPKSMKRLIIDCLKFKRDERPLFPQVMLGIEQVQDLLPKIERSASEPSLHRAVHAEELNP
LLFHTTRLMPL
NT seq 1836 nt   +upstreamnt  +downstreamnt
atgtcctcaaactcttcctcctgctcctcctcgggagagacaagtccagaggatgtgccc
cgaggtgggggcaccatccgtgtcttcctccccaatcaacagaggaccgtggtgaatgtt
cgccctgggcagaccgtttatgacagtttggataaagcccttaaagtaaggggcctgagc
caggactgttgcgctgtgtttcgactcctagaaggtcgcaagagactaactgattggaac
actgacatcaccccactggtaggagaagagcttctggtggaggtgttggatgatgtcccc
ctcaccatgcataactttgtacgaaaaaccttctttaagttggcctattgtgacttttgt
cacaagtttctgttcaacggcttcagatgtcagacatgcggctacaagtttcaccagcac
tgcagcagcaaggtccccactgtgtgtgtggacatggacactataacaaaacggtgcaca
cctaatccttgcccagatgagtaccctcagatatccatactgttgccagacaactccata
tcccagagcgacatagccttaaccccggatccttctgggcacggactactgtccccaacc
tcggccttccggtttcctctgccaggtggagatggtcagtctctacagaggcatcggtcc
acctccacccccaatgtccacatggtcagcaccgtaggccctgccggtgtcagcatcata
gaggatgcgttaaaattacaaaacaatacaatggttcctgaaccatcacccaaaccctct
accagcccgccctccctgggctcccctggcaggagaccccccaaatccccctccgagcac
aaggagcgcaagccctcctcatctgacgacaaaaagaaagtgcaccgtggcggctataga
gactcaagttactactgggaggtacactcgcgagaagtcaacatccagaaaaggataggt
gcaggctcctttgggactgtcttcaagggcaagtggcacggcgacgtcgccatcaagatc
ctcaaagtgacagagccaacacctgagcagttgcaagcctttaaaaatgaaatgcaagtg
ctacgaaagacacgccacgtcaacattctgctgttcatgggcttcatgactaagcctaac
tttgccatcatcacacagtggtgtgagggcagcagcctgtaccgccatctgcacgtctct
gagaccaagtttgagaccatgcgtcgcatcgacgtggccaggcagacagcacagggcatg
gattatcttcatgccaagaatataattcatcgagacctgaaatcaaacaacatcttcctc
catgagggctggactgtgaagatcggggactttgggctggcaacggtgaagtctcgatgg
agtggctctgagcaggtagaacagcccagcggctccattctgtggatggctcctgaggtg
atccggatgcaggacgccaacccttacacgttccagtcagacgtgtacggctacggggtg
gtgctgtttgagctgatgtcggggacactgccttattcccagattaacaaccgagaccag
atactctttatggttgggcgtggctacttgtctccagacctcagtttgctgtccagtagc
tcacccaagtccatgaagaggctcatcattgactgcctgaagttcaaacgtgatgagagg
cccctctttccacaggtcatgttaggcattgagcaggtccaggacctgttgccaaaaatc
gagcggagtgcctcggagccctccctccaccgggctgtccatgcggaggaactgaaccca
ctcctgttccacaccactcggctgatgccactgtga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112248744
Entry
112248744         CDS       T05605                                 

Definition
(RefSeq) serine/threonine-protein kinase A-Raf-like
  KO
K08845  A-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04012  ErbB signaling pathway
otw04068  FoxO signaling pathway
otw04270  Vascular smooth muscle contraction
otw04810  Regulation of actin cytoskeleton
otw04910  Insulin signaling pathway
otw04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112248744
   04012 ErbB signaling pathway
    112248744
   04068 FoxO signaling pathway
    112248744
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112248744
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112248744
   04914 Progesterone-mediated oocyte maturation
    112248744
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    112248744
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112248744
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112248744
Protein kinases [BR:otw01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   112248744
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like Pkinase_fungal Kdo TUG-UBL1 APH
Other DBs
NCBI-GeneID: 112248744
NCBI-ProteinID: XP_024273798
LinkDB
Position
4
AA seq 611 aa
MSSNSSSCSSSGETSPEDVPRGGGTIRVFLPNQQRTVVNVRPGQTVYDSLDKALKVRGLS
QDCCAVFRLLEGRKRLTDWNTDITPLVGEELLVEVLDDVPLTMHNFVRKTFFKLAYCDFC
HKFLFNGFRCQTCGYKFHQHCSSKVPTVCVDMDTITKRCTPNPCPDEYPQISILLPDNSI
SQSDIALTPDPSGHGLLSPTSAFRFPLPGGDGQSLQRHRSTSTPNVHMVSTVGPAGVSII
EDALKLQNNTMVPEPSPKPSTSPPSLGSPGRRPPKSPSEHKERKPSSSDDKKKVHRGGYR
DSSYYWEVHSREVNIQKRIGAGSFGTVFKGKWHGDVAIKILKVTEPTPEQLQAFKNEMQV
LRKTRHVNILLFMGFMTKPNFAIITQWCEGSSLYRHLHVSETKFETMRRIDVARQTAQGM
DYLHAKNIIHRDLKSNNIFLHEGWTVKIGDFGLATVKSRWSGSEQVEQPSGSILWMAPEV
IRMQDANPYTFQSDVYGYGVVLFELMSGTLPYSQINNRDQILFMVGRGYLSPDLSLLSSS
SPKSMKRLIIDCLKFKRDERPLFPQVMLGIEQVQDLLPKIERSASEPSLHRAVHAEELNP
LLFHTTRLMPL
NT seq 1836 nt   +upstreamnt  +downstreamnt
atgtcctcaaactcttcctcctgctcctcctcgggagagacaagtccagaggatgtgccc
cgaggtgggggcaccatccgtgtcttcctccccaatcaacagaggaccgtggtgaatgtt
cgccctgggcagaccgtttatgacagtttggataaagcccttaaagtaaggggcctgagc
caggactgttgcgctgtgtttcgactcctagaaggtcgcaagagactaactgattggaac
actgacatcaccccactggtaggagaagagcttctggtggaggtgttggatgatgtcccc
ctcaccatgcataactttgtacgaaaaaccttctttaagttggcctattgtgacttttgt
cacaagtttctgttcaacggcttcagatgtcagacatgcggctacaagtttcaccagcac
tgcagcagcaaggtccccactgtgtgtgtggacatggacactataacaaaacggtgcaca
cctaatccttgcccagatgagtaccctcagatatccatactgttgccagacaactccata
tcccagagcgacatagccttaaccccggatccttctgggcacggactactgtccccaacc
tcggccttccggtttcctctgccaggtggagatggtcagtctctacagaggcatcggtcc
acctccacccccaatgtccacatggtcagcaccgtaggccctgccggtgtcagcatcata
gaggatgcgttaaaattacaaaacaatacaatggttcctgaaccatcacccaaaccctct
accagcccgccctccctgggctcccctggcaggagaccccccaaatccccctccgagcac
aaggagcgcaagccctcctcatctgacgacaaaaagaaagtgcaccgtggcggctataga
gactcaagttactactgggaggtacactcgcgagaagtcaacatccagaaaaggataggt
gcaggctcctttgggactgtcttcaagggcaagtggcacggcgacgtcgccatcaagatc
ctcaaagtgacagagccaacacctgagcagttgcaagcctttaaaaatgaaatgcaagtg
ctacgaaagacacgccacgtcaacattctgctgttcatgggcttcatgactaagcctaac
tttgccatcatcacacagtggtgtgagggcagcagcctgtaccgccatctgcacgtctct
gagaccaagtttgagaccatgcgtcgcatcgacgtggccaggcagacagcacagggcatg
gattatcttcatgccaagaatataattcatcgagacctgaaatcaaacaacatcttcctc
catgagggctggactgtgaagatcggggactttgggctggcaacggtgaagtctcgatgg
agtggctctgagcaggtagaacagcccagcggctccattctgtggatggctcctgaggtg
atccggatgcaggacgccaacccttacacgttccagtcagacgtgtacggctacggggtg
gtgctgtttgagctgatgtcggggacactgccttattcccagattaacaaccgagaccag
atactctttatggttgggcgtggctacttgtctccagacctcagtttgctgtccagtagc
tcacccaagtccatgaagaggctcatcattgactgcctgaagttcaaacgtgatgagagg
cccctctttccacaggtcatgttaggcattgagcaggtccaggacctgttgccaaaaatc
gagcggagtgcctcggagccctccctccaccgggctgtccatgcggaggaactgaaccca
ctcctgttccacaccactcggctgatgccactgtga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112262652
Entry
112262652         CDS       T05605                                 

Definition
(RefSeq) serine/threonine-protein kinase A-Raf-like isoform X1
  KO
K08845  A-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04012  ErbB signaling pathway
otw04068  FoxO signaling pathway
otw04270  Vascular smooth muscle contraction
otw04810  Regulation of actin cytoskeleton
otw04910  Insulin signaling pathway
otw04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112262652
   04012 ErbB signaling pathway
    112262652
   04068 FoxO signaling pathway
    112262652
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112262652
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112262652
   04914 Progesterone-mediated oocyte maturation
    112262652
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    112262652
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112262652
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112262652
Protein kinases [BR:otw01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   112262652
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like Pkinase_fungal Kdo TUG-UBL1 APH
Other DBs
NCBI-GeneID: 112262652
NCBI-ProteinID: XP_024294076
LinkDB
Position
12
AA seq 611 aa
MSSNSSSCSSSGETSPEDVPRGGGTIRVYLPNKQRTVVNVRPGQTVYDSLDKALKVRGLS
QDCCAVFRLLEGRKRLTDWNTDITPLVGEELLVDVLDDVPLAMHNFVRKTFFKLAYCDFC
HKFLFNGFRCQTCGYKFHQHCSSKVPTVCVDMDTMTKRFTRNPCTDEYPQISILLPDNSI
SQSDIALTPDSSGHGLLSPTSAFLFPQPVGDGPSLQRHRSTSTPNVHMVSTVGPAGVSII
EEALKIQNNTMGPEPSSKPSTSPPSLDSPGRRPPKSPSEHKERKPSSSDDKKKVHRGGYR
DSSYYWEVHSREVTMQKRIGAGSFGTVFKGKWHGDVAIKILKVTEPTPEQLQAFKNEMQV
LRKTRHVNILLFMGFMTKPNFAIITQWCEGSSLYRHLHVSETKFETMRRIDVARQTAQGM
DYLHAKNIIHRDLKSNNIFLHEGWTVKIGDFGLATVKSRWSGSEQVEQPSGSILWMAPEV
IRMQDTNPYTFQSDVYGYGVVLFELMSGTLPYSQINNRDQILFMVGRGYLSPDLSLLSSS
SPKSMKRLIIDCLKFKRDERPLFPQIMLGIEQVQDLLPKIERSASEPSLHRAVHAEELNP
LLFNTTRLMPI
NT seq 1836 nt   +upstreamnt  +downstreamnt
atgtcctccaactcctcctcttgctcctcctctggtgagaccagtccagaggatgtgccc
cgaggtggcggcaccatccgtgtctacctccccaataaacagaggactgtggtgaatgtt
cgccctggccagactgtttatgacagtttggataaagcccttaaagtgaggggcctcagc
caggactgttgcgcagtgtttagactcctagagggtcgcaagagactaactgattggaac
actgacatcaccccgcttgtaggagaagagctgcttgtagatgtgttggatgatgtccct
ctcgccatgcataactttgtacggaaaaccttcttcaagttggcctattgtgacttctgc
cacaagtttctgttcaacggcttcagatgtcagacatgtggctacaagtttcaccagcac
tgcagcagcaaagttcctactgtgtgtgtggacatggacactatgacaaaacggttcaca
cgtaatccctgcacagatgagtaccctcagatatccatactgttgccagacaactccata
tcccagagcgacatagccttaaccccagattcttctgggcatggacttctgtccccgacc
tctgccttcctgtttccccagccagttggagatggaccatccctacagaggcatcggtcc
acctccacccccaacgtccacatggtcagcactgtgggccctgccggagtcagcatcata
gaggaggcgttaaaaatacaaaacaatacaatgggtcctgaaccctcatccaaaccctcc
accagccccccctccctggactcccctggcaggagaccccctaaatccccctcagagcac
aaagagcgcaagccctcttcatctgacgacaaaaagaaagtgcaccgtggcggttataga
gactcaagttactactgggaggtccactctcgagaagtcaccatgcagaaaaggataggt
gcagggtcctttgggactgttttcaagggaaagtggcatggagatgtggccatcaagatc
ctcaaagtgacagagccaacacctgagcagctgcaggcttttaaaaatgaaatgcaagtc
ctaagaaagacacgccacgtcaacattctgctgtttatgggctttatgactaagcctaac
tttgccatcatcacacagtggtgtgagggcagcagcctgtaccgtcatctgcatgtctcc
gagaccaagtttgaaaccatgcgccgcatcgacgttgccaggcagacagcacagggcatg
gattatcttcatgccaagaatataattcatcgagacctgaaatcaaacaacatcttcctc
catgagggctggactgtgaagatcggggactttgggctggccacagtgaagtctcgatgg
agtggctccgagcaggtagaacagcctagtggttccattctgtggatggctcctgaggtg
atccggatgcaggacaccaacccttatacgtttcagtcagacgtgtatggctacggggtg
gttctgtttgagctgatgtcagggactctgccttattcccagatcaacaacagagaccag
atactctttatggttgggcgaggctatttgtctccagacctcagtttgctgtccagtagc
tcacccaaatcaatgaagaggctcatcattgactgcctgaagttcaaacgtgatgagagg
cccctctttccacagatcatgttaggcattgagcaggtccaggacctgttaccaaaaatc
gagcggagtgcctcagagccctccctccacagggctgtgcatgcagaggaactgaaccca
ctcctgttcaacaccactcggctgatgcccatttga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112265332
Entry
112265332         CDS       T05605                                 

Definition
(RefSeq) serine/threonine-protein kinase A-Raf-like isoform X1
  KO
K08845  A-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04012  ErbB signaling pathway
otw04068  FoxO signaling pathway
otw04270  Vascular smooth muscle contraction
otw04810  Regulation of actin cytoskeleton
otw04910  Insulin signaling pathway
otw04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112265332
   04012 ErbB signaling pathway
    112265332
   04068 FoxO signaling pathway
    112265332
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112265332
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112265332
   04914 Progesterone-mediated oocyte maturation
    112265332
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    112265332
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112265332
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112265332
Protein kinases [BR:otw01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   112265332
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like Pkinase_fungal Kdo TUG-UBL1 APH
Other DBs
NCBI-GeneID: 112265332
NCBI-ProteinID: XP_024298278
LinkDB
Position
13
AA seq 611 aa
MSSNSSSCSSSGETSPEDVPRGGGTIRVYLPNKQRTVVNVRPGQTVYDSLDKALKVRGLS
QDCCAVFRLLEGRKRLTDWNTDITPLVGEELLVDVLDDVPLAMHNFVRKTFFKLAYCDFC
HKFLFNGFRCQTCGYKFHQHCSSKVPTVCVDMDTMTKRFTRNPCTDEYPQISILLPDNSI
SQSDIALTPDSSGHGLLSPTSAFLFPQPVGDGPSLQRHRSTSTPNVHMVSTVGPAGVSII
EEALKIQNNTMGPEPSSKPSTSPPSLDSPGRRPPKSPSEHKERKPSSSDDKKKVHRGGYR
DSSYYWEVHSREVTMQKRIGAGSFGTVFKGKWHGDVAIKILKVTEPTPEQLQAFKNEMQV
LRKTRHVNILLFMGFMTKPNFAIITQWCEGSSLYRHLHVSETKFETMRRIDVARQTAQGM
DYLHAKNIIHRDLKSNNIFLHEGWTVKIGDFGLATVKSRWSGSEQVEQPSGSILWMAPEV
IRMQDTNPYTFQSDVYGYGVVLFELMSGTLPYSQINNRDQILFMVGRGYLSPDLSLLSSS
SPKSMKRLIIDCLKFKRDERPLFPQIMLGIEQVQDLLPKIERSASEPSLHRAVHAEELNP
LLFNTTRLMPI
NT seq 1836 nt   +upstreamnt  +downstreamnt
atgtcctccaactcctcctcttgctcctcctctggtgagaccagtccagaggatgtgccc
cgaggtggcggcaccatccgtgtctacctccccaataaacagaggactgtggtgaatgtt
cgccctggccagactgtttatgacagtttggataaagcccttaaagtgaggggcctcagc
caggactgttgcgcagtgtttagactcctagagggtcgcaagagactaactgattggaac
actgacatcaccccgcttgtaggagaagagctgcttgtagatgtgttggatgatgtccct
ctcgccatgcataactttgtacggaaaaccttcttcaagttggcctattgtgacttctgc
cacaagtttctgttcaacggcttcagatgtcagacatgtggctacaagtttcaccagcac
tgcagcagcaaagttcctactgtgtgtgtggacatggacactatgacaaaacggttcaca
cgtaatccctgcacagatgagtaccctcagatatccatactgttgccagacaactccata
tcccagagcgacatagccttaaccccagattcttctgggcatggacttctgtccccgacc
tctgccttcctgtttccccagccagttggagatggaccatccctacagaggcatcggtcc
acctccacccccaacgtccacatggtcagcactgtgggccctgccggagtcagcatcata
gaggaggcgttaaaaatacaaaacaatacaatgggtcctgaaccctcatccaaaccctcc
accagccccccctccctggactcccctggcaggagaccccctaaatccccctcagagcac
aaagagcgcaagccctcttcatctgacgacaaaaagaaagtgcaccgtggcggttataga
gactcaagttactactgggaggtccactctcgagaagtcaccatgcagaaaaggataggt
gcagggtcctttgggactgttttcaagggaaagtggcatggagatgtggccatcaagatc
ctcaaagtgacagagccaacacctgagcagctgcaggcttttaaaaatgaaatgcaagtc
ctaagaaagacacgccacgtcaacattctgctgtttatgggctttatgactaagcctaac
tttgccatcatcacacagtggtgtgagggcagcagcctgtaccgtcatctgcatgtctcc
gagaccaagtttgaaaccatgcgccgcatcgacgttgccaggcagacagcacagggcatg
gattatcttcatgccaagaatataattcatcgagacctgaaatcaaacaacatcttcctc
catgagggctggactgtgaagatcggggactttgggctggccacagtgaagtctcgatgg
agtggctccgagcaggtagaacagcctagtggttccattctgtggatggctcctgaggtg
atccggatgcaggacaccaacccttatacgtttcagtcagacgtgtatggctacggggtg
gttctgtttgagctgatgtcagggactctgccttattcccagatcaacaacagagaccag
atactctttatggttgggcgaggctatttgtctccagacctcagtttgctgtccagtagc
tcacccaaatcaatgaagaggctcatcattgactgcctgaagttcaaacgtgatgagagg
cccctctttccacagatcatgttaggcattgagcaggtccaggacctgttaccaaaaatc
gagcggagtgcctcagagccctccctccacagggctgtgcatgcagaggaactgaaccca
ctcctgttcaacaccactcggctgatgcccatttga

DBGET integrated database retrieval system