KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112215780
Entry
112215780         CDS       T05605                                 

Definition
(RefSeq) mitogen-activated protein kinase 1-like
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04012  ErbB signaling pathway
otw04068  FoxO signaling pathway
otw04114  Oocyte meiosis
otw04140  Autophagy - animal
otw04150  mTOR signaling pathway
otw04210  Apoptosis
otw04218  Cellular senescence
otw04261  Adrenergic signaling in cardiomyocytes
otw04270  Vascular smooth muscle contraction
otw04350  TGF-beta signaling pathway
otw04370  VEGF signaling pathway
otw04371  Apelin signaling pathway
otw04510  Focal adhesion
otw04520  Adherens junction
otw04540  Gap junction
otw04620  Toll-like receptor signaling pathway
otw04621  NOD-like receptor signaling pathway
otw04625  C-type lectin receptor signaling pathway
otw04810  Regulation of actin cytoskeleton
otw04910  Insulin signaling pathway
otw04912  GnRH signaling pathway
otw04914  Progesterone-mediated oocyte maturation
otw04916  Melanogenesis
otw05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112215780
   04012 ErbB signaling pathway
    112215780
   04350 TGF-beta signaling pathway
    112215780
   04370 VEGF signaling pathway
    112215780
   04371 Apelin signaling pathway
    112215780
   04068 FoxO signaling pathway
    112215780
   04150 mTOR signaling pathway
    112215780
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112215780
  09143 Cell growth and death
   04114 Oocyte meiosis
    112215780
   04210 Apoptosis
    112215780
   04218 Cellular senescence
    112215780
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112215780
   04520 Adherens junction
    112215780
   04540 Gap junction
    112215780
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112215780
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    112215780
   04621 NOD-like receptor signaling pathway
    112215780
   04625 C-type lectin receptor signaling pathway
    112215780
  09152 Endocrine system
   04910 Insulin signaling pathway
    112215780
   04912 GnRH signaling pathway
    112215780
   04914 Progesterone-mediated oocyte maturation
    112215780
   04916 Melanogenesis
    112215780
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112215780
   04270 Vascular smooth muscle contraction
    112215780
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112215780
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112215780
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:otw03036]
    112215780
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112215780
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     112215780
Protein kinases [BR:otw01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   112215780
Chromosome and associated proteins [BR:otw03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     112215780
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112215780
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr FTA2 Kdo
Other DBs
NCBI-GeneID: 112215780
NCBI-ProteinID: XP_024230940
LinkDB
Position
16
AA seq 179 aa
MATAAVSASAGSGPNPGSGAELVRGQAFDVGPRYHNLSYIGEGAYGMVCSAYCRDNKVRV
AIKKISPFEHQTYCQRTLREIKILLRFKHENIISINDIILTPSIDQMKDVYIVQDLMETD
LYKLLKTQRLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKVQNPDP
NT seq 540 nt   +upstreamnt  +downstreamnt
atggcgacagcagcagtatctgccagtgctggcagcggccccaaccccggatctggcgct
gagttagtccgaggacaggccttcgatgtcggccctcgctaccacaatctctcctatatt
ggcgagggcgcctatggaatggtgtgctctgcatattgccgtgacaacaaggtccgcgtg
gcgattaagaagatcagtccgtttgaacaccagacatactgccagaggactctgagagag
attaagatcctgctgcgcttcaaacatgagaacatcatcagcatcaacgacatcatcctc
acgccctccatcgatcagatgaaggacgtctacatagtgcaggacctgatggagacagac
ctgtataagctgctgaagacccagcgcctgagcaacgatcacatctgttacttcctgtac
cagatcctgagaggcctgaagtacatccattctgccaacgtcctgcaccgtgatctcaaa
ccctccaacctgctgctcaataccacctgtgatctaaaggtacagaaccctgacccctga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112237408
Entry
112237408         CDS       T05605                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: mitogen-activated protein kinase 1-like
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04012  ErbB signaling pathway
otw04068  FoxO signaling pathway
otw04114  Oocyte meiosis
otw04140  Autophagy - animal
otw04150  mTOR signaling pathway
otw04210  Apoptosis
otw04218  Cellular senescence
otw04261  Adrenergic signaling in cardiomyocytes
otw04270  Vascular smooth muscle contraction
otw04350  TGF-beta signaling pathway
otw04370  VEGF signaling pathway
otw04371  Apelin signaling pathway
otw04510  Focal adhesion
otw04520  Adherens junction
otw04540  Gap junction
otw04620  Toll-like receptor signaling pathway
otw04621  NOD-like receptor signaling pathway
otw04625  C-type lectin receptor signaling pathway
otw04810  Regulation of actin cytoskeleton
otw04910  Insulin signaling pathway
otw04912  GnRH signaling pathway
otw04914  Progesterone-mediated oocyte maturation
otw04916  Melanogenesis
otw05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112237408
   04012 ErbB signaling pathway
    112237408
   04350 TGF-beta signaling pathway
    112237408
   04370 VEGF signaling pathway
    112237408
   04371 Apelin signaling pathway
    112237408
   04068 FoxO signaling pathway
    112237408
   04150 mTOR signaling pathway
    112237408
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112237408
  09143 Cell growth and death
   04114 Oocyte meiosis
    112237408
   04210 Apoptosis
    112237408
   04218 Cellular senescence
    112237408
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112237408
   04520 Adherens junction
    112237408
   04540 Gap junction
    112237408
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112237408
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    112237408
   04621 NOD-like receptor signaling pathway
    112237408
   04625 C-type lectin receptor signaling pathway
    112237408
  09152 Endocrine system
   04910 Insulin signaling pathway
    112237408
   04912 GnRH signaling pathway
    112237408
   04914 Progesterone-mediated oocyte maturation
    112237408
   04916 Melanogenesis
    112237408
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112237408
   04270 Vascular smooth muscle contraction
    112237408
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112237408
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112237408
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:otw03036]
    112237408
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112237408
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     112237408
Protein kinases [BR:otw01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   112237408
Chromosome and associated proteins [BR:otw03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     112237408
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112237408
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH FTA2
Other DBs
NCBI-GeneID: 112237408
NCBI-ProteinID: XP_024261771
LinkDB
Position
Unknown
AA seq 530 aa
MACHVLVTKIICFHQAELVYRQLLYSLKQLDGNWFIDRDPDSTGNRDPDTQTVRVTETQN
STGKRDPASTGKSPDSRVTETQQKGNRTRQYGYRDPDITGNRDPDRRVTEPRQYGTRDTD
STGNRDPDSTGNRSTVTEVRVTETQTVRVTETQTVRVTETQTYGSDSNLLSLSLSSIPSS
AYCRDKSPVAIKKISPFEHQTYCQRTLREIKILLRFKHENIISINDIIRMPSIHQMKDVY
IVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCD
LKICDFGLARVADPDHDHTGFLTETLRLWDMPLPLSRVTTKSIDIWSVGCILAEMALHRP
IFPGKHYLDQLNHILGILGSPSQEDLNCIINIKARNYLLSLPLRCKVPWNRLFPNADPKA
LDLLDKMLTFNPHKRIEVEEALAHPYLEQYYDPTDEYYGPTEEVMTPDPDSLLPGAVLRP
YRRGNXEQYYGPTEERGSFQFDMELDDLPXETLKELIXEETARFNTVCRS
NT seq 1593 nt   +upstreamnt  +downstreamnt
atggcctgtcacgttctagtcaccaaaataatctgtttccatcaggctgaactcgtctac
cgacagttactttactcactaaaacagttggatggaaactggtttatagacagagaccca
gacagtacgggtaacagagacccagacacccagacagtaagggtaacagagacccagaac
agtacgggtaaaagagacccagcaagtacgggtaaaagcccagacagtcgggtaacagag
acccaacagaagggtaacagaacccgacagtacgggtacagagacccagacataacgggt
aacagagacccagacagacgggtaacagagcccagacagtacggtacaagagacacagac
agtacgggtaacagagacccagacagtacgggtaacagaagtacggtaacagaagtacgg
gtaacagagacccagacagtacgggtaacagagacccagacagtaagggtaacagagacc
cagacgtacggctctgactctaacctcctctctctctctctctcctccatccccagctct
gcatattgccgtgacaaaagtcccgttgcgattaagaagatcagtccgtttgaacaccag
acatactgccagaggactctgagagagattaagatcctgctgcgcttcaaacatgagaac
atcatcagcatcaacgacatcatccgcatgccctccatccaccagatgaaggacgtctac
atagtgcaggacctgatggagacagatctgtataagctgctgaagacccagcacctgagc
aacgatcacatctgttacttcctgtaccagatcctgagaggcctgaagtacatccactca
gctaacgtcctgcaccgcgacctcaaaccctccaacctgctgctcaataccacctgtgat
ctaaagatctgtgactttggtcttgcacgtgtggctgacccggaccatgaccacacaggc
ttcctgacagagacgttgcgactctgggacatgcctcttcctctctcaagggttacaacc
aagtctattgatatctggtctgtgggctgcatcctggctgaaatggctctccacagaccc
atcttccccgggaagcactacctggaccagctcaaccacatactgggtatcctagggtct
ccttcccaggaggatctgaactgcatcattaacatcaaggccaggaactacctgctgtct
ctcccactgcgctgcaaggtcccctggaaccgcctcttccccaacgccgaccccaaagct
ctggacctgctggacaagatgttgacctttaacccccacaagaggatcgaggtagaggag
gctctggctcacccttacctggagcagtactatgatcctacagatgagtactacggccct
acagaagaggtaatgacccctgaccctgactcactcttacctggagcagtactacggccc
tacagaagaggtaatgangagcagtactacggccctacagaagagcgaggctcctttcag
tttgacatggagctggatgatctccccnaagagaccctgaaggagctgatcnttgaagag
acggctcgcttcaacacagtctgcaggtcctaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112251950
Entry
112251950         CDS       T05605                                 

Definition
(RefSeq) mitogen-activated protein kinase 1-like
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04012  ErbB signaling pathway
otw04068  FoxO signaling pathway
otw04114  Oocyte meiosis
otw04140  Autophagy - animal
otw04150  mTOR signaling pathway
otw04210  Apoptosis
otw04218  Cellular senescence
otw04261  Adrenergic signaling in cardiomyocytes
otw04270  Vascular smooth muscle contraction
otw04350  TGF-beta signaling pathway
otw04370  VEGF signaling pathway
otw04371  Apelin signaling pathway
otw04510  Focal adhesion
otw04520  Adherens junction
otw04540  Gap junction
otw04620  Toll-like receptor signaling pathway
otw04621  NOD-like receptor signaling pathway
otw04625  C-type lectin receptor signaling pathway
otw04810  Regulation of actin cytoskeleton
otw04910  Insulin signaling pathway
otw04912  GnRH signaling pathway
otw04914  Progesterone-mediated oocyte maturation
otw04916  Melanogenesis
otw05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112251950
   04012 ErbB signaling pathway
    112251950
   04350 TGF-beta signaling pathway
    112251950
   04370 VEGF signaling pathway
    112251950
   04371 Apelin signaling pathway
    112251950
   04068 FoxO signaling pathway
    112251950
   04150 mTOR signaling pathway
    112251950
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112251950
  09143 Cell growth and death
   04114 Oocyte meiosis
    112251950
   04210 Apoptosis
    112251950
   04218 Cellular senescence
    112251950
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112251950
   04520 Adherens junction
    112251950
   04540 Gap junction
    112251950
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112251950
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    112251950
   04621 NOD-like receptor signaling pathway
    112251950
   04625 C-type lectin receptor signaling pathway
    112251950
  09152 Endocrine system
   04910 Insulin signaling pathway
    112251950
   04912 GnRH signaling pathway
    112251950
   04914 Progesterone-mediated oocyte maturation
    112251950
   04916 Melanogenesis
    112251950
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112251950
   04270 Vascular smooth muscle contraction
    112251950
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112251950
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112251950
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:otw03036]
    112251950
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112251950
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     112251950
Protein kinases [BR:otw01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   112251950
Chromosome and associated proteins [BR:otw03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     112251950
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112251950
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo FTA2 Choline_kinase YukC
Other DBs
NCBI-GeneID: 112251950
NCBI-ProteinID: XP_024278581
LinkDB
Position
1
AA seq 389 aa
MADSSNSAAAAGATGSNTGAAGAVAPEGATGAAGIKPVLEVVKGQNFDVGPRYVNLSYIG
EGAYGMVCSAHDGMTDSRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDILRA
RRIECMRDVYIVQDLMETDLYKLLKTQMLSNDHTCYFLYQILRGLKYIHSANVLHRDLKP
SNLLINTTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYSKSIDIW
SVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPTPDDLNCIINMKARNYLQSLPEKPK
IPWNKLFPKADSKALDLLGRMLTFNPIKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFT
MELDDLPKEKLKELIFEETFRFQATYQGS
NT seq 1170 nt   +upstreamnt  +downstreamnt
atggcggattcgagcaacagtgctgcggcggctggagccacaggctcgaatactggtgcc
gccggggctgttgcgcccgagggagcgactggagctgcggggataaagcccgtgttggag
gtggtaaaggggcagaactttgacgttggcccccgctatgtcaacctctcgtacatcggg
gaaggggcctatggaatggtttgctcggcccatgacggcatgacggattctcgcgtggcc
attaagaagatcagtccgtttgagcaccagacgtactgtcagcgcaccctgagggagatc
aagatcctgctgcggttccgccatgagaacatcatcggcatcaacgacatcctgagggcc
cgccgcatcgagtgcatgagggacgtctacatagtgcaggacctgatggagacagacttg
tacaagctcctgaagactcagatgttgagcaacgaccatacctgctacttcctgtaccag
atcctgagaggcctgaagtacatccactctgccaatgtgctgcaccgtgacctcaagccc
tctaacctgctcatcaacaccacctgtgacctcaagatctgtgactttgggctggcacgg
atagctgacccagagcatgaccacacaggcttcctgacagagtacgtggctacgcgctgg
tacagggcccccgagatcatgctcaactccaagggctactccaagtccattgatatctgg
tcagtgggctgcatcctggctgagatgctgtccaacaggcccatcttccctgggaagcat
tacctggaccagctcaaccacatactgggcatccttggctctcccactccggatgacctg
aactgcatcatcaacatgaaggccaggaactacctgcagtctctgcctgagaaacccaag
atcccttggaacaagctgttccccaaggcggacagcaaggctctggacctgctgggccgc
atgttgacttttaaccctatcaagcgcatcacggtagaggaggccctggctcatccctat
ctggagcagtactacgaccccactgacgagcctgtagcagaggagccgttcaccttcacc
atggagctggatgacctgcctaaggagaagctgaaggagctcatctttgaggagacgttc
cgcttccaggccacctaccagggctcctga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112251959
Entry
112251959         CDS       T05605                                 

Definition
(RefSeq) mitogen-activated protein kinase 1-like
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04012  ErbB signaling pathway
otw04068  FoxO signaling pathway
otw04114  Oocyte meiosis
otw04140  Autophagy - animal
otw04150  mTOR signaling pathway
otw04210  Apoptosis
otw04218  Cellular senescence
otw04261  Adrenergic signaling in cardiomyocytes
otw04270  Vascular smooth muscle contraction
otw04350  TGF-beta signaling pathway
otw04370  VEGF signaling pathway
otw04371  Apelin signaling pathway
otw04510  Focal adhesion
otw04520  Adherens junction
otw04540  Gap junction
otw04620  Toll-like receptor signaling pathway
otw04621  NOD-like receptor signaling pathway
otw04625  C-type lectin receptor signaling pathway
otw04810  Regulation of actin cytoskeleton
otw04910  Insulin signaling pathway
otw04912  GnRH signaling pathway
otw04914  Progesterone-mediated oocyte maturation
otw04916  Melanogenesis
otw05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112251959
   04012 ErbB signaling pathway
    112251959
   04350 TGF-beta signaling pathway
    112251959
   04370 VEGF signaling pathway
    112251959
   04371 Apelin signaling pathway
    112251959
   04068 FoxO signaling pathway
    112251959
   04150 mTOR signaling pathway
    112251959
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112251959
  09143 Cell growth and death
   04114 Oocyte meiosis
    112251959
   04210 Apoptosis
    112251959
   04218 Cellular senescence
    112251959
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112251959
   04520 Adherens junction
    112251959
   04540 Gap junction
    112251959
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112251959
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    112251959
   04621 NOD-like receptor signaling pathway
    112251959
   04625 C-type lectin receptor signaling pathway
    112251959
  09152 Endocrine system
   04910 Insulin signaling pathway
    112251959
   04912 GnRH signaling pathway
    112251959
   04914 Progesterone-mediated oocyte maturation
    112251959
   04916 Melanogenesis
    112251959
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112251959
   04270 Vascular smooth muscle contraction
    112251959
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112251959
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112251959
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:otw03036]
    112251959
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112251959
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     112251959
Protein kinases [BR:otw01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   112251959
Chromosome and associated proteins [BR:otw03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     112251959
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112251959
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo FTA2 Choline_kinase YukC
Other DBs
NCBI-GeneID: 112251959
NCBI-ProteinID: XP_024278591
LinkDB
Position
1
AA seq 389 aa
MADSSNSAASTGATGSNTGAAGAVEPEGATGAAGIKPVLEVVKGQNFDVGPRYVNLSYIG
EGAYGMVCSANDGMTDSRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDILRA
RRIECMRDVYIVQDLMETDLYKLLKTQMLSNDHTCYFLYQILRGLKYIHSANVLHRDLKP
SNLLINTTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYSKSIDIW
SVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPTPDDLNCIINMKARNYLQSLPEKPK
VPWNKLFPKADSKALDLLGRMLTFNPIKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFT
MELDDLPKEKLKELIFEETLRFQATYQGS
NT seq 1170 nt   +upstreamnt  +downstreamnt
atggcggattcgagcaacagtgctgcttcgactggagctacaggctcgaatactggtgcc
gccggggctgttgagccggagggagctactggagctgcggggatcaagcccgtgttggag
gtggtaaaggggcagaactttgacgttggaccccgctatgtcaacctctcgtacatcggg
gaaggggcctatggaatggtttgctcggccaatgacggcatgacagattctcgcgtggcc
attaagaagatcagtccatttgagcatcagacgtactgtcagcgcacactgagggagatc
aagatcctgctgcggttccgccatgaaaacataatcggcatcaacgacatcctgagggcc
cgccgcatcgagtgcatgagggacgtctacatagtgcaggacctgatggagacagacctg
tacaagctcctgaagacccagatgttgagcaacgaccacacctgctacttcttgtaccag
atcctgagaggcctgaagtacatccactctgccaacgtgctgcaccgtgacctcaagccc
tccaacctgctcatcaacaccacctgcgacctcaagatctgtgactttgggctggcacgg
attgctgacccagagcatgaccacacaggcttcctgacagagtatgtggctacgcgctgg
tacagggctcccgagatcatgctcaactccaagggctactccaagtccattgatatctgg
tcagtgggctgcatcctggctgagatgctgtccaacaggcccatcttccctgggaagcac
tacctggaccagctcaaccacatactggggatcctgggctctcccactccggatgacctg
aactgcatcatcaacatgaaggccaggaactacctgcagtctctgcctgagaaacccaag
gtcccctggaacaagctgttccccaaggcggacagcaaggctctggacctgctgggccgc
atgttgacctttaaccctatcaagcgcatcacggtagaggaggctctggctcatccctat
ctggagcagtactacgaccccactgacgagcctgtagcagaggagccgttcaccttcacc
atggagctggatgacctgcctaaggagaagctgaaggagctcatctttgaagagacgctc
cgcttccaggccacctaccagggctcctga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112262493
Entry
112262493         CDS       T05605                                 

Definition
(RefSeq) mitogen-activated protein kinase 1-like
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04012  ErbB signaling pathway
otw04068  FoxO signaling pathway
otw04114  Oocyte meiosis
otw04140  Autophagy - animal
otw04150  mTOR signaling pathway
otw04210  Apoptosis
otw04218  Cellular senescence
otw04261  Adrenergic signaling in cardiomyocytes
otw04270  Vascular smooth muscle contraction
otw04350  TGF-beta signaling pathway
otw04370  VEGF signaling pathway
otw04371  Apelin signaling pathway
otw04510  Focal adhesion
otw04520  Adherens junction
otw04540  Gap junction
otw04620  Toll-like receptor signaling pathway
otw04621  NOD-like receptor signaling pathway
otw04625  C-type lectin receptor signaling pathway
otw04810  Regulation of actin cytoskeleton
otw04910  Insulin signaling pathway
otw04912  GnRH signaling pathway
otw04914  Progesterone-mediated oocyte maturation
otw04916  Melanogenesis
otw05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112262493
   04012 ErbB signaling pathway
    112262493
   04350 TGF-beta signaling pathway
    112262493
   04370 VEGF signaling pathway
    112262493
   04371 Apelin signaling pathway
    112262493
   04068 FoxO signaling pathway
    112262493
   04150 mTOR signaling pathway
    112262493
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112262493
  09143 Cell growth and death
   04114 Oocyte meiosis
    112262493
   04210 Apoptosis
    112262493
   04218 Cellular senescence
    112262493
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112262493
   04520 Adherens junction
    112262493
   04540 Gap junction
    112262493
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112262493
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    112262493
   04621 NOD-like receptor signaling pathway
    112262493
   04625 C-type lectin receptor signaling pathway
    112262493
  09152 Endocrine system
   04910 Insulin signaling pathway
    112262493
   04912 GnRH signaling pathway
    112262493
   04914 Progesterone-mediated oocyte maturation
    112262493
   04916 Melanogenesis
    112262493
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112262493
   04270 Vascular smooth muscle contraction
    112262493
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112262493
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112262493
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:otw03036]
    112262493
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112262493
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     112262493
Protein kinases [BR:otw01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   112262493
Chromosome and associated proteins [BR:otw03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     112262493
Exosome [BR:otw04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112262493
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH FTA2 Choline_kinase
Other DBs
NCBI-GeneID: 112262493
NCBI-ProteinID: XP_024293877
LinkDB
Position
12
AA seq 365 aa
MATAAVSARGPNPGTGAVGPRPGLRCRAPVPTICRISVRAPTERCALRIAVTTRSAWRLE
DHRFEHQTYCQRTLREIKYLLRSNIENIISINDIHPHALHRSDEGRYIVQDLMETDLYKL
LKTQRLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVAD
PDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLD
QLNHILGILGSPSQEDLNCIINIKARNYLLSLPLRCKVPWNRLFPNADPKALDLLDKMLT
FNPHKRIEVEEALAHPYLEQYYDPTDEPVAEAPFKFDMELDDLPKETLKELIFEETARFN
TVCRS
NT seq 1098 nt   +upstreamnt  +downstreamnt
atggcgacagctgcggtttctgcccgtggccccaatcccggaaccggagctgttggtccg
aggccaggccttcgatgtcgggccccggtacccacaatctgtcgtatatcggtgagggcg
cctacggaacggtgtgctctgcgtattgccgtgacaacaaggtccgcgtggcgattagaa
gatcatcgttttgaacaccagacatactgccagaggactctgagagagattaagtatctg
ctgcgttcaaacattgagaacatcatcagcatcaacgacatccatcctcacgccctccat
cgatcagatgaaggacgctacatagtgcaggacctgatggagacagacctgtataagctg
ctgaagacccagcgcctgagcaacgatcacatctgttacttcctgtaccagatcctgaga
ggcctgaagtacatccattctgccaacgtcctgcaccgtgatctcaaaccctccaacctg
ctgctcaataccacctgtgatctaaagatctgtgacttcggtctggcgcgtgtggctgac
ccagaccacgaccacacaggcttcctgacggagtatgtagctactcgctggtaccgggca
cctgaaatcatgctcaactccaagggttacaccaagtctattgatatctggtctgtgggc
tgcatcctggctgaaatgctctccaatagacccatcttccccgggaagcactacttggac
cagctcaaccacatactgggtatcctagggtctccttcccaggaggatctgaactgcatc
attaacatcaaggccaggaactacctgctgtctctcccactgcgctgcaaggtcccctgg
aaccgcctcttccccaacgccgaccccaaagctctggacctgctggacaagatgttgacc
tttaacccccacaagaggatcgaggtagaggaggctctggctcacccttacctggagcag
tactatgatcctacagatgagcctgtagccgaggctcctttcaagtttgacatggagctg
gatgatctccccaaagagaccctgaaagagctgatctttgaagagacggctcgcttcaac
acagtctgcaggtcctaa

DBGET integrated database retrieval system