KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112215828
Entry
112215828         CDS       T05605                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: voltage-dependent L-type calcium channel subunit alpha-1D-like
  KO
K04851  voltage-dependent calcium channel L type alpha-1D
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04020  Calcium signaling pathway
otw04218  Cellular senescence
otw04260  Cardiac muscle contraction
otw04261  Adrenergic signaling in cardiomyocytes
otw04270  Vascular smooth muscle contraction
otw04530  Tight junction
otw04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112215828
   04020 Calcium signaling pathway
    112215828
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    112215828
  09144 Cellular community - eukaryotes
   04530 Tight junction
    112215828
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    112215828
  09153 Circulatory system
   04260 Cardiac muscle contraction
    112215828
   04261 Adrenergic signaling in cardiomyocytes
    112215828
   04270 Vascular smooth muscle contraction
    112215828
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:otw04040]
    112215828
Ion channels [BR:otw04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   112215828
SSDB
Motif
Pfam: Ion_trans CAC1F_C Ca_chan_IQ GPHH PKD_channel Rer1
Other DBs
NCBI-GeneID: 112215828
NCBI-ProteinID: XP_024231017
LinkDB
Position
16
AA seq 2118 aa
MQEAEEQPEGAQYASSNRAHHSGDTSALGSENPSHPQPEPCPQTGTISWQAAIHAARNAQ
GEAPQSMSARPPVPGATPAPVGSLSQRKRQLYAKSKKQGGSTNSRPPRALFCLTLNNPIR
RACISLVEWKPFDIFILLSIFANCVALAVYIPFPEDDSNSTNHDLETVEYAFLIIFTIET
FLKIIAYGLVMHQNSYVRNGWNMLDFVIVIVGLFSVVLEVITKEGDAGGQGGKPGGFDVK
ALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFIGKM
HASCYLVGTGILAEEEPVPCAVSGHGRQCRMNGTVCREGWHGPNGGITNFDNFLFAMLTV
FQCITMEGWTDVLYWMNDAMGSELPWVYFVSLVIFGSFFVLNLVLGVLSGEFSKEEEKAK
ARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPENDEEGDEEGGKRNPSVPASETESVNT
DNPNGEDDKANCCGPHCQKITKSKYSRRWRHWNRFCRRKCRAAVKSVSFYWLVIILVFLN
TLTISSEHYNQPDWLTEVQDVANKVLLALFTCEMLVKMYSLGLQAYFVSLFNRFDCFVVC
GGIVETILVELAVMSPLGISVFRCVRLLRIFKVTRHWASLSNLVASLLNSMKSIASLLLL
LFLFIIIFSLLGMQLFGGKFNFDETITKRSTFDNFPQALLTVFQILTGEDWNAVMYDGIM
AYGGPFSSGMVVSIYFIILFVCGNYILLNVFLAIAVDNLADAESLNTAQKEEEEEKERKK
SSRSDTDKTEDLKPEGQDGEIKLPLEEEVEEEKEPYPTPDTPVGDDDDDDDELPEVPIGP
RPQRLSDLSVKEKTPPIPEGSAFFIFSNTNLVRVACHKLTNHHLFTNLILVFIMLSSVSL
AAEDPYRSQPFSSTILGYFDYAFTAIFTVEILLKMTAFGAFLHKGAFCRNYFNLLDLLVV
GVSLVSFGIQSSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIMIVTT
LLQFMFACIGVQLFKGKFYRCTDEAKSSPDECKGTYILYKDGDTVLPAVRERIWYNSDFN
FDNVLMAMMALFTVSTFEGWPALLYKAIDSNRENMGPIYNYRVEISIFFIIYIIIIAFFM
MNIFVGFVIVTFQEQGEKEYKNCELDKNQRQCVEYALKARPLRRYIPKNPYQYKFWYVVN
STGFEYVMFVLIILNTLCLAIQHYGQSHLFNYAMDVLNMVFTGVFTVEMILKLIAFRPRG
YFGDAWNVFDALVVIGSVVDIILSQVDNTEDSARISITFFRLFRVMRLVKLLSRGEGIRT
LLWTFIKSFQALPYVALLIAMLFFIYAVIGMQVFGKIAMVDGTQINHNNNFQTFPQAVLM
LFRCATGEVWQEIMLACLPGKLCDSESDYNPGEERTCGSGLAIIYFISFYMLCAFLIINL
FVAVIMDNFDYLTRDWSILGPHHLDEFKRIWSEYDPEAKGRIKHLDVVTLLRRIQPPLGF
GKLCPHRVACKRLVAMNMPLNSDGTVMFNATLFALVRTALKIKTEGNLEQANEELRAVIK
KIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQDYFRKFKKRKEQGLVGRNSFTSLNS
TIALQAGLRTLHDIGPEIRRVISCDLQDEGLVDINAEDGEEMYRRNGVIFSNHVNGDHRG
SAHQTKVTQRPLQVPPPSCHASVEPSQVGSEERAGEPHWYNYYYPKSPISSNANLNNANV
HSVPSLTNGGQRRCLRREHPSANGAPSSGSHRKIVDFDTHTTVQSARSDSGGVHYPTVRR
EEPGRADSDEDRGSGEYFSGEEYQEDDIMLHKDRMSRKECQDHQPDSLCDDHQQPIYQDG
GRSLKQWFLPSTPQALLRPSFNFHCLRKQSSQGDDTPLTPSVPLRTALPLHLLQQQVMAV
AGLDSSRVQRLSPSRSLRSWATLPVSPSSRDHSHYYTPLIQVDWRGLSSVSSTPGSVRRS
SWYTDVQEAPLSRTYSPLQLQIPPEYRRQYHQNRGSANSLVEAVLISEGLGKYAKDPKFV
SATKHEIADACEMTIDEMESAASNLLNGSMGNGAGAMDTVTGTSLMDRNLEDYSDEEPDT
CGKYEEDLTDEMICISTL
NT seq 6357 nt   +upstreamnt  +downstreamnt
atgcaagaggcagaggaacagcccgaaggggcacagtatgccagcagcaacagagcccat
cactctggtgacacgtcggccctcgggtcagaaaacccctcccacccgcagcccgaaccc
tgcccccagaccggcactatctcctggcaggccgcgatccatgctgctcgtaacgcccag
ggcgaggcaccccagagcatgagcgcccgcccccctgtccctggggccacacccgccccg
gtgggctcactgtcacagaggaagaggcagctgtatgccaagagcaagaagcagggcggc
tccaccaacagcagaccgcccagggcactgttctgcctcaccctcaacaaccccatccgc
agagcctgcatcagcctggtggagtggaaaccctttgatatctttatactgctctctatt
tttgccaattgtgtggccttagctgtttacatccccttcccagaggacgactccaactcc
accaaccacgacctggaaacagtagaatatgccttcctaatcatctttactatagagacc
tttctgaagatcatagcgtatggtttagtcatgcaccagaactcctacgtaagaaacgga
tggaacatgctggattttgtcattgtcatagtagggttgttcagtgtagttctggaggtg
ataaccaaagagggcgatgccgggggccaggggggtaagccgggaggcttcgacgtcaag
gccctccgagcattccgggtgctccgccccctccgccttgtctcaggagtacccagttta
caggtagtgttgaactccatcattaaagccatggttcctctgctccacatcgctctgctc
gtcctcttcgtcatcatcatctacgccatcatcggcctcgaactcttcattggcaagatg
cacgccagctgctacctggtgggcactggtattctggccgaggaggagcctgttccgtgt
gcggtgtcaggccatgggcgccagtgcaggatgaatgggactgtgtgtagggaaggatgg
cacgggcccaatggtggcatcaccaactttgacaacttcctgtttgccatgctcactgtt
ttccagtgtatcaccatggagggctggactgatgttctgtactggatgaacgatgccatg
ggttctgagctaccctgggtctacttcgtcagtctggtcatcttcggttccttctttgtt
cttaacctggttctgggagtgttaagcggagagttctccaaggaggaggagaaggccaag
gctcgtggggacttccagaagctgagagagaagcagcagctggaggaggatctgaagggc
tacctggactggatcactcaggccgaggatatcgaccctgagaatgacgaggagggggac
gaggaggggggcaaacgcaatccaagcgtgcctgccagcgagaccgagtctgtgaacact
gacaaccccaatggagaggacgataaggctaactgctgtggaccacactgtcaaaaaatt
actaaatcaaagtacagtcggcgatggcgtcactggaaccggttctgccgcaggaagtgt
cgtgctgccgtgaagtctgtgtctttctattggctggtgatcatcctggtgtttctgaac
acgctcaccatctcgtcagagcactacaaccagcctgactggctcacggaagtacaggat
gtggccaacaaggttctgctggctttgttcacgtgtgagatgctggtgaagatgtacagt
ctgggcctgcaggcctacttcgtgtccctgttcaaccgcttcgactgcttcgtggtgtgc
ggcggcatcgtggagaccatcctggtggagctggccgtcatgtctcctctgggcatctct
gtgttccgttgtgtccgcctgctacgcatcttcaaggtcacacgccactgggcatctctc
agtaacctggtggcgtcgctgctcaactccatgaagtccatcgcttccctgctgctcctg
ctcttcctcttcatcatcatcttctccctgttgggcatgcagctcttcggcggcaagttc
aacttcgacgagacgataaccaagaggagcaccttcgacaacttcccccaggcactactc
acagtgtttcagatcctgacaggcgaggattggaacgctgtgatgtatgatggcatcatg
gcgtacggtggacccttctcatcgggcatggtcgtcagcatctacttcatcatactcttc
gtctgcggaaactacatcctgctgaacgtcttcttggccattgccgttgacaacctggca
gacgcagagagcctgaacacagcccagaaggaggaagaggaggagaaggagaggaagaag
agttccagaagtgacacagacaagacagaggatctgaaacctgaaggccaggatggggag
atcaagcttccattggaggaggaagtggaagaggagaaggagccgtatcccactccagat
actccagtaggtgacgatgacgacgacgacgatgagctcccggaggttccgattgggcca
cgtcctcagaggctgtcagacctcagcgtcaaggagaagactccgcccatccctgagggc
agcgctttcttcatcttcagcaacactaacctggtccgggtggcctgccacaagctgacc
aaccaccacctcttcaccaacctcatcctggtcttcatcatgctgagctctgtgtctctg
gctgctgaggacccataccgcagccagcctttctcctctacaatacttggttattttgac
tatgctttcacggcaatctttactgttgagatcctgttgaagatgacagcgtttggggct
ttcctccataaaggagccttctgcaggaactacttcaacctgctggacctactggtggtg
ggagtctctctggtgtccttcggcattcagtcatccgccatctctgtggtgaagatcctg
cgtgtgctgagggtgctgcggcccctgagggccatcaacagagccaagggcctcaagcat
gtggtccagtgtgtatttgtggccatcaggaccattggtaatatcatgatcgtcaccacg
ctgctacagttcatgttcgcctgcataggagtgcagctcttcaagggcaagttctatcgc
tgcacagacgaggcaaagtccagcccggatgaatgcaaaggcacatacattctgtataag
gatggcgacacagtgttgcctgcggtcagggagaggatctggtacaacagtgacttcaac
tttgacaacgtcctcatggctatgatggctctgttcaccgtctctacatttgaaggctgg
cctgctctgctgtacaaggccatcgactccaacagagagaatatgggtcccatctacaac
taccgcgtggagatctccatcttcttcatcatctacatcatcatcatcgccttcttcatg
atgaacatctttgtcggtttcgtcatcgtcaccttccaggagcagggagagaaagagtac
aagaactgtgagctggacaaaaaccagcgtcagtgtgtagagtatgctctgaaggctcgt
ccactgcggaggtacatccctaagaacccctaccagtataagttctggtatgtggttaac
tccactggctttgagtacgtcatgttcgttctcatcatcctcaacacactgtgtttggcg
atccagcactatggccagtcccacctgttcaactacgccatggacgtcctcaacatggtc
ttcactggcgtcttcaccgtagagatgatcctcaaactgattgccttcagacccaggggg
tattttggagacgcctggaacgtcttcgatgccctggtggtgattggcagcgtagttgac
atcattctcagtcaggtagataacacagaggacagcgctcgcatctccatcacattcttc
cgcttgttcagagtcatgcgattggtcaagctgctcagcagaggggagggcatccgaacg
ctcctgtggaccttcatcaagtccttccaggctcttccctatgttgccctcctgatagcc
atgctattcttcatctacgctgttatcggcatgcaggtgtttggaaagattgccatggta
gacggcacacagataaaccacaacaacaacttccagacctttcctcaagctgtcctgatg
ctcttcaggtgtgctacaggcgaggtgtggcaggagatcatgctggcatgtctgccaggg
aagctgtgtgactccgagtcagactacaaccccggagaggagagaacctgtggaagcgga
ctcgccatcatctacttcatcagcttctacatgctctgcgccttcctgatcatcaacctg
ttcgtggctgtcatcatggataactttgactatctgacgcgggattggtccattctgggt
cctcaccacctggatgagtttaaaaggatctggtctgagtacgaccctgaggctaagggc
aggataaagcatctggatgtggttaccttgctgagacgcatccagcctcctctaggcttc
ggcaagctgtgtccacacagagtggcctgcaagagattggttgccatgaacatgcccctg
aacagtgatggcacggtcatgtttaacgccaccctgtttgccttggtgaggaccgctctg
aagatcaagaccgaaggcaacctggagcaggccaatgaggagttgcgagcagtcatcaag
aagatctggaagaggaccagcatgaagctgctggaccaagtggtgccccctgctggcgat
gatgaggtaaccgtggggaagttctatgctaccttcctgatacaggactacttcaggaaa
ttcaagaaacgcaaagagcaaggcctggtgggaagaaactcattcaccagcctgaactcc
accatcgccctccaggccggtctccgcacactgcatgatattgggcctgaaatccgccga
gtcatatcatgtgacctgcaagacgagggccttgtcgacattaacgcagaagacggcgaa
gagatgtacaggaggaacggcgtgatcttctccaatcacgttaacggggaccaccggggt
tccgcccaccagacaaaagtcactcagcggcccctccaggtccctccgccttcctgccac
gcctccgtggagccctcccaggtcggctctgaggagagggcaggcgaaccccactggtac
aactactactaccccaaatcccccatatcctcaaacgccaaccttaacaatgccaacgtg
cactctgtgccctccctgacaaacggggggcagcgccgctgtcttcgccgtgagcacccg
tccgccaatggggcaccctcttccggctcgcaccgaaagattgttgacttcgacacccac
accacggtccaatctgcaaggtcagattcagggggtgttcattaccctaccgttcgtaga
gaggagccagggagggcagacagtgatgaagacaggggctctggggaatacttcagcggg
gaagagtaccaggaggatgatatcatgttgcacaaagacaggatgtcccgtaaggagtgt
caagaccatcaaccggacagtctctgtgatgaccaccagcaacccatttaccaggatggt
gggcggtcactgaagcaatggtttctcccctctacaccccaggccctcctcagaccctca
ttcaactttcattgtctgcggaaacaaagcagtcaaggcgatgacacgcccttgacccct
tccgttccccttcgaacagctctacccctgcatctgctgcagcagcaggtgatggcggtg
gctggcctggactccagcagagtccagcgtctctctccgtcacgctctctacgctcctgg
gccacgctccccgtctcccccagcagcagggaccactcccattattacacacccctcatc
caggtggactggcgtgggctgagcagtgtgagtagcacccctggctctgtgcgaaggagc
agctggtacactgacgtccaagaagcccccctaagccgtacttactcccccttacagctc
cagatcccaccagaatatcgcaggcagtaccaccagaacagaggcagtgctaacagccta
gtggaggctgtgttgatttcagaaggactggggaaatacgccaaggaccccaagtttgtg
tcggcgaccaagcatgagatcgcggacgcctgcgagatgaccatcgacgagatggagagt
gccgccagcaacctgctgaacggcagtatgggtaatggggcgggggcaatggacacagtg
actggcacgagcctcatggaccgcaatctcgaggactacagcgatgaggagccggacacg
tgcgggaaatacgaggaggatctgactgatgagatgatatgcatcagcaccctatag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112244799
Entry
112244799         CDS       T05605                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: voltage-dependent L-type calcium channel subunit alpha-1D-like
  KO
K04851  voltage-dependent calcium channel L type alpha-1D
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04020  Calcium signaling pathway
otw04218  Cellular senescence
otw04260  Cardiac muscle contraction
otw04261  Adrenergic signaling in cardiomyocytes
otw04270  Vascular smooth muscle contraction
otw04530  Tight junction
otw04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112244799
   04020 Calcium signaling pathway
    112244799
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    112244799
  09144 Cellular community - eukaryotes
   04530 Tight junction
    112244799
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    112244799
  09153 Circulatory system
   04260 Cardiac muscle contraction
    112244799
   04261 Adrenergic signaling in cardiomyocytes
    112244799
   04270 Vascular smooth muscle contraction
    112244799
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:otw04040]
    112244799
Ion channels [BR:otw04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   112244799
SSDB
Motif
Pfam: Ion_trans CAC1F_C GPHH Ca_chan_IQ PKD_channel DUF2975
Other DBs
NCBI-GeneID: 112244799
NCBI-ProteinID: XP_024268366
LinkDB
Position
Unknown
AA seq 2049 aa
MSANGPANAPAAPAATPVAPPVPSPVAAPPAAPVPVPTVPVGALAQKKRAQYAKSKKQGS
NANTRPARALFCLKLNNPIRRACISLVEWKPFDIFILIAIFANCMALAVYIPFPQDDSNS
TNHDLETVEHVFLVIFTIETFLKIIAYGLVAHQNAYVRNGWNMLDFVIVVVGLFSVVLEL
LTKDSVETKEEAEAGAAAAAAAAAALHPSAQGHGGKSGGFDVKALRAFRVLRPLRLVSGV
PSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFIGKMHATCFFPSTGKTEDEPA
PCAISGHGRQCPINGTECREGWHGPNDGITNFDNFLFAMLTVFQCITMEXWTDVLYWMND
AMGLELPWVYFVSLRIILGSFFMLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLDED
LKGYLDWITQAEDIDPENEDEEGYEEGKRNLSIPASETESVNTENVAEDEVKTPCCGPFC
QKISKSKFSRRWRRWNRFCRRKCRVAVKSVPFYWLVIILVFLNTLTISSEHYNQPDWLTQ
VQDVANKVLLGMFTCEMMTKMYSLGLQAYFVSLFNRFDCFVVCGGITETILVELAIMSPL
GISVFRCVRLLRIFKVTRSSMCVASKMIECIWVCCGQILTGEDWNAVMYDGIMAYGGPSS
SGMIVSFYFIILFICGNYILLNVFLAIAVDNLADAESLNAPGDKKDEKKEEVELHPKTYL
EEEEENAAEEEEEPEVPAGPRPAISELVKKEKITPIPDGSAFFIFSKTNPIRVGCHRLIN
HHIFTNLILVFIMLSSVSLAAEDPIRNFSARNIVLGYADYVFTSMFTFEIMLKMTTYGAF
LHKGAFCRNTFNLLDLLVVGVSLVSFCIQSSAISVVKILRVLRVLRPLRAINRAKGLKHV
VQCVFVAIRTIGNIMIVTTLLQFMFACIGVQLFKGKFYRCTDEAKSGPDDCKGTYILYKD
GDVNQPFVHKRVWHNSEFNFDNVLMAMMALFTVSTFEGWPSLLYKAIDSNRENLGPIYNY
RIEISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEKEYKNCELDKNQRQCVEYALKAHP
LRRYIPKNPYQYKFWYVVNSTGFEYIMFVLIMLNTLCLAVQHYGQSATFNYVMDILNMVF
TAVFTAEMVLKLIAFKPRHYFTDAWNTFDALIVVGSVVDIAITEVNPTEAPQVDESGNTE
DNARISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIAMLFFIYAVIG
MQVFGKIAMVDGTHINRNNNFQTFPQAVLLLFRCATGEAWQEIMLACISGKLCDPESDYN
PGEEMTCGASFAYIYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRI
WSEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVAMNMPLNSDGTVMFNA
TLFALVRTALKIKTDGNLERQRGELRAVIKQIWRKRTSMKLLDPVVPPAWYDEVTVGKFY
ATFLIQDYFRKFKKRKEEGLVGVHASQSNTAIALQAGLRTLHDIGPEIRRAISCDLQDEE
LVDFIPEEDEEIYRRNGGLFGNHINHVNGDHHRRSSGQQTNTTQRPLQVQPPPHYAHMEQ
PVGRLCRANVMSHQHPNQHHHHHNSSYGKSPKSTNVNLNNANVSSLPNGGGHHHCYYEYT
PPPANGYPGHCGGLYYTDFDKPPPRGTPQGQRRYYETYVRSHRGDARLPTIRREEFDDDR
YSGEYYSGEEFYEDDSMLSGDRYQNSDTEYETPRGYHHPNSYYNDDEQPLYQDGRRSPKR
RMLPATPQGHRRPSFNFECLRRQGSQDELPHQRTALPLHLMQHQVWLYAGAAPSSRAPHL
SPSRSTRSWTTPPACSSSKEQSPSTRPSRVDHPGRENAVSSQVPLRKSSWYTDDPEYSQG
IYSPAHLQVAPEYHQQRNQKSATSLVEAVLISEGLGRYAMDPKFVAATKHEIADACEMTI
DEMESAASHLLSAGVAPAVNGVHVYPVMSERDYDLQDATASYSDEEPEVELRVVYEEDLA
DEMICITTL
NT seq 6150 nt   +upstreamnt  +downstreamnt
atgagtgccaacgggccagccaacgcccctgcggccccggctgcaaccccagttgccccg
ccggtgcccagtccggtagccgcccctccggctgccccggtcccagtgccgactgtcccg
gtgggcgcattggcacagaagaagcgggcgcagtacgccaaaagcaagaagcaggggagc
aacgccaacaccaggccagccagggccctgttctgcctcaaactcaacaatcccatacga
agagcctgcatcagcctggtagagtggaagccatttgatatctttatattaatagctatt
tttgccaactgtatggccttagctgtgtacatccccttccctcaggatgactccaactcc
accaaccatgacctggaaacggtagaacatgtcttcctcgtcattttcactatcgaaacc
tttctgaagattatcgcctacggtttagtggcgcaccagaacgcgtatgtgagaaacgga
tggaacatgctggattttgtcatcgtcgttgtcgggctgttcagtgttgtcctggagctt
ttgaccaaagactctgttgagacgaaggaggaagcggaggcgggtgcggctgcggcggca
gctgcggcggcagcgctccacccctccgcccaaggccacgggggaaagtcgggcggcttc
gacgtcaaagccctccgagccttccgtgtgctgcgacccctacgcctggtctcaggagtg
cccagtttacaggttgtgttgaactccattattaaagccatggttcctctcctccacatc
gccctgctggtcctgtttgtcatcatcatctacgccatcatcggccttgagctcttcatt
ggtaaaatgcacgctacctgcttcttccccagcacaggtaagacggaggacgagccggct
ccatgtgcgatctcagggcacgggcgccagtgtcccatcaatggcaccgagtgcagggag
ggctggcacggccccaacgacggcatcaccaactttgacaacttcctgttcgccatgctg
accgtgttccagtgtatcaccatggaangctggacggacgtgctctactggatgaatgat
gctatgggtctagagcttccatgggtctactttgtatctcttcgaatcattctgggctcc
tttttcatgcttaaccttgtgcttggtgtgctgagtggagagttctccaaggagagagag
aaggccaaggctcgtggagactttcagaaactgagagagaagcaacagctggatgaggac
ctcaagggctacctggactggataactcaggccgaggacatcgatccagagaacgaggac
gaggagggctacgaggagggcaaacgcaacctgagtataccagccagtgagacggagtcg
gtgaacacagagaacgtggccgaggatgaggtgaagacaccgtgctgcggacctttttgt
caaaaaatttcaaagtcaaagttcagtcggcgctggcgtcgctggaacaggttctgccgc
agaaagtgccgggtggcggtgaaatcggtgcctttctattggctggtgatcatcctggtg
tttctcaacacgctcaccatctcctccgagcactacaaccagcctgactggctcacacaa
gtacaggacgtggcaaacaaggttctgctgggcatgtttacgtgtgagatgatgaccaag
atgtacagtctgggcctgcaggcctactttgtgtccctgttcaaccgatttgactgcttc
gtggtgtgtggaggcatcaccgagaccatcctggtggagctggccatcatgtctcctctg
ggcatctccgtgttccgctgtgtccgcttgctcaggatcttcaaggtcacacggtcctcc
atgtgtgtcgcatccaaaatgatcgagtgcatttgggtgtgttgtggccagatcctgaca
ggtgaagactggaacgctgtgatgtatgacggcatcatggcgtacggcggcccttcttcc
tcggggatgatcgtctccttctacttcattatcctcttcatctgcggaaactacatcctg
ctgaacgtcttcttggctatcgctgtggacaacctggcagacgcagagtctctcaacgct
ccaggagacaaaaaggacgagaaaaaggaagaggtagaactccaccccaagacatatttg
gaggaggaagaggagaatgctgcagaggaggaggaggagccagaggttccagcagggcca
cgcccagccatctctgagctggtcaagaaggagaagatcacccccatccctgacggcagc
gctttcttcatcttcagcaagaccaacccgatccgggtgggatgtcatagactcatcaac
caccacatcttcaccaatctcatcctggtcttcatcatgctcagctctgtctccctcgct
gcagaagaccccatacgcaacttctccgcacgcaacatcgtcctaggctatgcagattat
gtcttcactagcatgtttacatttgagatcatgttgaagatgaccacatacggagcgttc
ctccataaaggggcgttctgtcggaacaccttcaacctgctggatctgctggtggtgggg
gtctccctggtctccttctgcatccagtcctccgccatctctgtggtgaagattctgaga
gtcctgcgagtgctcaggcccctgagggccatcaaccgagccaagggcctcaagcacgtg
gtccagtgtgtgttcgtggccatcaggaccatcggtaacatcatgatcgtcaccacgctg
ctgcagttcatgttcgcctgcataggggtgcagctcttcaaggggaagttttaccgctgc
acggacgaagccaagtctggccccgacgattgcaagggcacctacatcctttataaggac
ggggacgtgaaccagccgttcgtccataagagagtgtggcacaacagcgagttcaacttt
gacaacgtgctcatggccatgatggctctgttcacggtgtctaccttcgagggctggcct
tcgttgctctacaaggccatagactcgaacagggagaacctgggtcccatctacaactac
cgcatcgagatctccatcttcttcatcatctacatcatcatcatcgccttcttcatgatg
aacatctttgtgggtttcgtcatcgtcacattccaggagcagggagagaaagagtacaag
aactgtgagctggataagaaccagcgtcagtgtgtggagtatgccctgaaggcccatccg
ttgaggaggtacatccctaagaacccctaccagtataagttctggtacgtggtcaactcc
accgggtttgagtacatcatgttcgtcctcatcatgctcaacacactctgcctggctgtg
cagcactatggccagtctgcgacatttaactatgtgatggacatcctcaacatggtcttc
actgctgttttcactgcggagatggtgctcaaactcatcgccttcaaacccaggcactat
ttcactgatgcgtggaacacgtttgatgccttaattgtagttggtagcgtcgttgatatt
gctatcactgaagtgaacccaacggaggctcctcaggtggatgagtcggggaacacggag
gacaacgctcgcatctccatcaccttcttccgcctcttccgagtcatgcgattggtcaaa
ctgctgagcagaggggaggggatccgcaccctcctgtggaccttcatcaagtctttccag
gctctgccatatgttgcccttctgatcgccatgctcttcttcatctatgctgtcattggc
atgcaggtgtttgggaagatagccatggtggacggcacccacatcaaccggaacaacaac
ttccagaccttccctcaggccgtgttgctgctcttcaggtgtgccacgggtgaggcgtgg
caggagatcatgttggcgtgtatttcgggaaagctgtgtgacccagagtcggactacaac
cctggggaggagatgacctgtggcgccagcttcgcctacatctacttcatcagcttctac
atgctctgtgccttcctgatcatcaatttgtttgtggcggtcatcatggacaactttgac
taccttactcgcgattggtccatcctgggtcctcaccacttggacgagttcaagaggatc
tggtctgagtacgacccagaggccaagggcaggattaaacatctggacgtggtcactctg
ctccgacgcatccagcctcccctgggcttcggcaaactctgccctcatagagtggcctgc
aagagactggtggccatgaacatgcctctaaacagcgacggcaccgtcatgttcaatgcg
acgctgtttgcgttagtacgcaccgccctgaagatcaaaacagacggtaatctggagagg
caacgaggggagctgagagccgtcatcaagcagatctggaggaagaggacaagcatgaaa
ctgctggatccagtggtgccccctgcctggtatgatgaggtaaccgtggggaagttctat
gccaccttcctgatacaggactactttaggaaattcaagaaacgtaaagaggagggcctg
gtgggggtgcacgcctcccagagcaacacagccatcgctctacaggctggccttcgcacg
ctacatgatattgggcccgaaattcgacgagcgatatcatgtgacctgcaagatgaggag
ctagtagactttattccagaggaggacgaggagatttataggcgcaatggtggcctgttc
ggtaaccacatcaaccatgtgaacggggaccaccaccggcgctcgtcagggcaacagacc
aacaccacccagaggcccctgcaggtgcagccacctccgcactatgcccacatggagcag
ccggtggggcgtctctgccgggccaacgtcatgtcccaccagcaccccaatcagcaccac
caccaccacaactcctcatacggcaagtcgcccaagtccaccaacgtcaacctgaacaac
gccaacgtgtccagtctgcccaacggaggaggacaccaccactgttactatgagtacact
ccgccccccgccaacggttacccgggacactgcggtggcctctactacaccgacttcgac
aagccgccacctcgcggcacgccgcagggacaaaggcgctactatgagacctatgttagg
tcccaccggggagatgcccgccttcccaccatccgacgggaggagtttgatgatgacagg
tactcgggagagtactacagcggggaggagttctatgaggatgacagcatgttgtcagga
gacaggtaccagaacagtgacacggagtacgagacgccgagaggctaccatcaccccaac
agttactacaacgacgatgagcaacccctctaccaagacggaaggaggtcgcctaagaga
cggatgcttcctgccacaccccaaggtcacaggaggccctccttcaactttgagtgtctg
agaaggcaaggcagtcaggacgagctgccacaccaacgcactgctctaccactgcaccta
atgcagcaccaggtatggctgtacgcaggggctgcgccatccagccgagccccccatctc
tccccctcccgctccacccgctcctggaccactccccctgcctgctcgtccagtaaggag
cagtcgccctctacacgcccctctcgggtggatcaccccggacgggagaatgccgtcagc
agtcaggtgcctctgaggaagagctcttggtacacagatgacccagagtactcccagggg
atctattcccccgcccacctccaggtggccccggagtaccaccagcagcgcaatcagaag
agcgccaccagcttggtggaggcggtgttgatatcagagggtctcgggagatacgccatg
gatccaaagtttgtggccgccaccaagcacgagatagcggacgcgtgcgagatgaccatc
gacgagatggagagcgcggccagccacttgctgagcgctggcgtggcgccggcggttaac
ggggtccacgtgtaccccgtcatgagcgagcgggactacgacctccaagacgccacagcc
agttatagtgatgaggagccggaggtggagcttagagtggtgtacgaggaggacctggca
gacgagatgatctgcatcaccactttatag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112247175
Entry
112247175         CDS       T05605                                 

Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1F-like
  KO
K04851  voltage-dependent calcium channel L type alpha-1D
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04020  Calcium signaling pathway
otw04218  Cellular senescence
otw04260  Cardiac muscle contraction
otw04261  Adrenergic signaling in cardiomyocytes
otw04270  Vascular smooth muscle contraction
otw04530  Tight junction
otw04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112247175
   04020 Calcium signaling pathway
    112247175
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    112247175
  09144 Cellular community - eukaryotes
   04530 Tight junction
    112247175
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    112247175
  09153 Circulatory system
   04260 Cardiac muscle contraction
    112247175
   04261 Adrenergic signaling in cardiomyocytes
    112247175
   04270 Vascular smooth muscle contraction
    112247175
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:otw04040]
    112247175
Ion channels [BR:otw04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   112247175
SSDB
Motif
Pfam: Ion_trans PKD_channel FAM176
Other DBs
NCBI-GeneID: 112247175
NCBI-ProteinID: XP_024271659
LinkDB
Position
Unknown
AA seq 920 aa
MAGKEDGVSLAGSVAGDKSDTLGSAASGKKRGGGQKKQIQANKSALRAPRALCCLTLSNP
IRMAALALVEWKSFDIFILLAIFANCVALGVSKPFPEEDSNSTNHNLEQVEYVFLVIFTI
ETFTKILAYGLVMHPSAYIRSGWNLLDFVIVVVGLFSVVAEGTADHKPGEAHHAAGKPGG
LDVKALRAFRVLRPLRLVSGVPSLQIVLNSIMKPWFPYSTGLLVSFFLIIYAIIGLELFL
GRMHKTCFYLGTELNVDDDPTPCAFAGNGRDCVGNGTECRGPWEGPNGGITNFDNIFFAM
LTVFQCITMEGWTDVLYWMNDAIGFEIPWVYFVSLVIFGSFFVLNLVLGVLSGEFSKERE
KAVARGELQDAQNKKQMEEDMCGYMDWLIEAEDVDEEGNKRAAVAKKKMMKKFGWYKHSE
DGESDSDSEFEAYLDDDNGCCASLMAKMMANSFCEQLCQLNHAFRKNCRVAVKSQNFYWL
VLLLVFLNTAASASEHYGQPKWLTEMQERANKILLMLFTLEMLLKMYSFGFQIHFMALFN
RFDCFVVCGGILETVLVELQIIPPIGISVLRCVRLLRVFKVTRHWAALSNLVNSLLNSMK
AICSLLLLLFLFLIIFSLLGMQLFGGKFNFDETQMKRSTFDTFPQALLTCFQILTGEDWN
AVMYDGIMAYGGPVFPQMIVCVYFVSLFVVGNYILLNVFLAIAVDNLAGGDGGKKQVEEK
KDDEEDWDEDEDKEEDAANEMDDWEENEELRAIEGLEGIMPVKPESAPKEKIEPIPDGSS
FFILGKRNCLRVACHNLIHHSYFTNLILVFIIASSISLAAEDPIRAHSFRNNMLGYADYA
FTSIFTVEIILKVTVFGAFLHPGSFCRNAFNLLDLLVVSVSLASFFLHSSAISVVKIFRV
LKVLRPLRAINRAKGLKVII
NT seq 2763 nt   +upstreamnt  +downstreamnt
atggcaggaaaagaggatggcgtctccttggccggctcggttgccggggacaagtccgac
accctcggctctgctgcctcgggcaagaagaggggtggtggacagaagaagcagatacaa
gccaacaaatctgctctccgagcccctcgagccctctgctgcctcaccctcagtaacccc
atccgcatggctgccttagcccttgttgaatggaaatcttttgatatcttcattctactt
gctatctttgccaactgtgtggccctgggtgtatctaaacccttccccgaggaggactcc
aattccaccaaccacaacctggaacaagtagagtatgtcttcctggtcatcttcaccatt
gaaaccttcactaagatcctggcctatggcttggtratgcaccctagcgcctacatccgc
agtggctggaatttgcttgattttgtcatcgttgtcgtcgggttgttcagtgtggttgct
gaggggacggccgaccacaagcctggagaggcccaccacgcagcaggcaaaccaggagga
ctggatgtcaaagcgctccgagccttcagggtgctgcgaccccttaggctggtgtctggc
gttcccagtctccagattgtcttgaactccatcatgaagccatggttcccctactccact
ggtctgctggtcagttttttcctcatcatctatgccatcatcggcctggagctcttcctc
ggcaggatgcacaagacctgtttctacttgggcacagaactgaacgtggatgatgacccc
acaccgtgtgcgtttgctggaaatgggcgcgattgtgtgggcaatgggacagagtgcaga
ggaccgtgggaggggcctaatggcgggatcaccaactttgacaacatattttttgccatg
ttgactgtgttccagtgtatcaccatggagggctggaccgatgtgctctactggatgaat
gatgcaattggctttgaaataccctgggtgtactttgtctctctggtcatatttggctcg
tttttcgtactcaaccttgtattgggagtgttgagcggggagttctccaaggaaagagag
aaagccgtggctcgtggagagctgcaggacgcccagaataagaagcagatggaggaggat
atgtgtggttacatggactggctcatcgaggccgaggatgtggatgaggaaggaaacaaa
cgtgctgctgttgccaagaagaaaatgatgaagaagtttggctggtataaacacagcgag
gacggagaatcggattcagactctgaatttgaagcatatctagatgacgacaatggctgc
tgcgcatctcttatggctaaaatgatggccaacagtttctgtgaacagctatgccaactg
aaccacgcctttcggaagaactgtcgtgtagcagtcaaatcccagaacttctactggctg
gtgcttcttctggtgtttctcaacactgcagccagcgcctctgaacactacggccagccc
aagtggctcaccgagatgcaggagcgggccaataagatcctgttgatgttgttcacgctg
gagatgctgttaaagatgtacagtttcggtttccagatccacttcatggctctgtttaac
cgcttcgactgcttcgtggtgtgtggtggcatcctggagacagtcttggtagagttgcaa
atcatccctcccatcggcatctctgtgctacgctgtgtccgcctgctcagggtgttcaaa
gtgacacggcactgggcagccctatcaaacctggtcaattccctgctcaactccatgaag
gctatctgctccctgctgctcctgcttttcctcttcctcatcatcttctccctgctgggg
atgcagctgtttgggggcaagttcaactttgatgagactcagatgaagagaagcacgttt
gacacttttccccaggccctgctcacctgcttccagatccttacaggagaggactggaat
gctgtgatgtatgatgggatcatggcttatggcgggccagtcttcccacagatgattgtg
tgtgtctacttcgtctccctctttgttgttggcaactatatcctgctcaatgtcttcttg
gctatcgctgtggacaacttggcaggtggcgatggtggaaaaaagcaagtagaagagaaa
aaggatgatgaagaggactgggacgaagatgaagacaaagaggaagatgcggcgaatgag
atggatgactgggaggagaatgaggagttgagagccatcgagggtctggagggaatcatg
cctgtgaagcctgaatccgctccaaaagagaagattgaacccattccagatgggagctcc
ttcttcattcttggaaaaagaaactgcctccgagtggcctgtcacaacctcatccaccac
tcctacttcaccaacctcatcctcgtcttcatcatcgccagtagtatttctctggccgct
gaggatccaatcagagctcactcctttaggaacaacatgcttggctacgctgattatgcg
ttcacctccatattcactgtggaaatcatactgaaggtgacggtttttggtgcgttcctt
catcctggttccttctgtaggaatgccttcaacctcctggaccttttggttgtcagtgtg
tctctcgcgtccttcttcctccattccagcgctatctctgtggtcaagatattcagggta
ctcaaagtgctcaggcctcttcgagcaatcaacagagccaagggactcaaggtaatcatt
tga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112255325
Entry
112255325         CDS       T05605                                 

Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1D-like
  KO
K04851  voltage-dependent calcium channel L type alpha-1D
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04020  Calcium signaling pathway
otw04218  Cellular senescence
otw04260  Cardiac muscle contraction
otw04261  Adrenergic signaling in cardiomyocytes
otw04270  Vascular smooth muscle contraction
otw04530  Tight junction
otw04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112255325
   04020 Calcium signaling pathway
    112255325
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    112255325
  09144 Cellular community - eukaryotes
   04530 Tight junction
    112255325
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    112255325
  09153 Circulatory system
   04260 Cardiac muscle contraction
    112255325
   04261 Adrenergic signaling in cardiomyocytes
    112255325
   04270 Vascular smooth muscle contraction
    112255325
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:otw04040]
    112255325
Ion channels [BR:otw04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   112255325
SSDB
Motif
Pfam: Ion_trans GPHH Ca_chan_IQ PKD_channel
Other DBs
NCBI-GeneID: 112255325
NCBI-ProteinID: XP_024284101
LinkDB
Position
7
AA seq 1482 aa
MTLEQETVEHVFLVIFTIETFLKIIAYGLVAHQNAYVRNGWNMLDFVIVVVGLFSVVLEL
LTKDSVETKEEAEAGAAAAAAAAALHPSAQGHGGKSGGFDVKALRAFRVLRPLRLVSGVP
SLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFIGKMHATCFFPSTGMIAEDDPA
PCAISGHGRQCPINGTECREGWHGPNNGITNFDNFLFAMLTVFQCITMEGWTDVLYWMND
AMGLELPWVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDL
KGYLDWITQAEDIDPDNEDEEGNEEGKRNPSMPASETESVNTENVAEDEVKTPCCGPFCR
RWRRWNRFCRRKCRLAVKSVPFYWLVIILVFLNTLTISSEHYMQPDWLTQVQDVANKVLL
GCFTCEMMTKMYSLGLQAYFVSLFNRFDCFVVCGGITETILVELAIMSPLGISVFRCVRL
LRIFKVTRHWQSLSNLVASLLNSMKSIASLLLLLFLFIIIFSLLGMQVFGGKFNFDETQT
KRSTFDNFPQALLTVFQILTGEDWNAVMYDGIMAYGGPSSSGMIVSFYFIILFICGNYIL
LNVFLAIAVDNLGDAESLNAPREKKEEKKEDLVPVEEEEENAAAEEEEEPEVPAGPRPPI
SELVKKEKITPIPDGSAFFIFSKTNPIRVGCHKLINHHIFTNLILVFIMLSSVSLAAEDP
IRNFSARNIILGYFDYAFTAIFTVEILLKMTTYGAFLHKGAFCRNTFNLLDLLVVGVSLV
SFCIQSSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIMIVTTLLQFM
FACIGVQLFKGSFNRCTDEAKSSPDECKSGHYIHLRTGLNQPTIQKRVWHNSEFNFDNVL
MAMMALFTVSTFEGWPSHRPLTERTWVPSTTTPHRDLHLFTSTSSSAFSHDEHLRRLRHR
HLPGARRERYKNCELDKNQRQCVEYALKARPLRRYIPKNPYQYKFWYVVNSTGFEYIMFV
LIMLNTLCLAVQHYGQSATFNYVMDILNMVFTAVFTAEMVLKLIAFKPRHYFTDAWNTFD
ALIVVGSVVDIAITEVNVSTAFSASLMELKPYYNTRIDSSTTIIPKCVLRLRKVLVLTFS
PQCPHNTEDSARISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIAML
FFIYAVIGMQVFGKVAMVDGTHINRNNNFQTFPQAVLLLFRCATGEAWQEIMLACVSGKL
CDPESDYNPGEEMTCGASFAYIYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPH
HLDEFKRIWSEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVAMNMPLNS
DGTVMFNATLFALVRTALKIKTDGNLEQANEELRAVIKKIWKRTSMKLLDQVVPPAGGQS
KHTILVATHKLDPGSIYRPTRPTSQHTITQKYITHTHNAFSL
NT seq 4449 nt   +upstreamnt  +downstreamnt
atgactttggaacaggaaacggtagaacatgtcttcctcgtcattttcactatagagacc
ttcctgaagattatcgcctatggtttagtggcgcaccagaacgcatatgtgagaaacgga
tggaacatgctggattttgtcattgtcgttgttggactgttcagtgttgtcctggaactt
ttgaccaaagactctgtagagacgaaggaggaggcagaggcgggtgcggctgcagcagcg
gcagcggcagcgctccacccctccgcacaaggccacgggggaaagtcgggcggcttcgac
gtcaaagccctccgagccttccgtgtactgcgacccctacgcctggtctcaggagtgccc
agtttacaggttgtgttgaactccattattaaagccatggtccctctcctccacatcgcc
ctgctggtcctgtttgtcattatcatctacgccatcatcggccttgagctcttcattggc
aaaatgcacgctacctgcttcttccccagcacaggcatgatagcggaggatgatccggct
ccatgtgcgatctcagggcacgggcgccaatgtcccatcaatggcactgagtgcagggag
ggctggcacggccccaacaacggcatcaccaactttgacaacttcctgttcgccatgctg
actgtgttccagtgtatcaccatggagggctggacagacgtgctctactggatgaatgat
gctatgggtctagagctaccatgggtctactttgtttctcttgtcatcttcggctccttc
tttgttctaaacctggttctgggagtgttgagcggagagttctccaaggagagagagaag
gccaaggccagaggagacttccagaagctgagagagaagcagcagctagaggaggacctg
aagggctacctggactggatcactcaggccgaggacatcgaccctgacaacgaggacgag
gagggcaacgaggagggcaaacgcaacccgagtatgccagccagtgagacggagtcggtg
aacacagagaacgtggccgaggatgaggtgaagacaccgtgctgtggacctttttgtcgg
cgctggcgtcgctggaacaggttctgccgcaggaagtgccggttggcagttaaatcggtg
cctttctattggctggtgatcatcctggtgtttctcaacacactcaccatctcctcagag
cactacatgcagcctgactggctcactcaagtacaggacgtggcaaacaaggttctactg
ggatgttttacgtgtgagatgatgaccaagatgtacagtctgggcctgcaggcctacttc
gtgtccctgttcaaccgctttgactgctttgtagtgtgtggaggcatcacagagaccatc
ctggtggagctggccatcatgtctcctctgggcatctctgtgttccgctgtgtccgcctt
ctcaggatcttcaaggtcacacgtcactggcagtctctcagtaacttggtggcatcgctg
ctcaactccatgaagtccatcgcctccctgctgctcctgctcttcctcttcatcatcatc
ttctccctgctgggcatgcaggtgttcggaggcaagttcaacttcgacgagacacagacc
aagaggagcaccttcgataacttcccccaggcactgctcactgtgtttcagatcctgacg
ggtgaagactggaacgctgtgatgtatgatggcatcatggcgtacggtggcccttcctca
tcagggatgatcgtctccttctacttcatcatcctcttcatctgcggaaactacatcctg
ctgaacgtctttttggctatcgctgtggacaacctgggagacgcggagtctctcaatgct
ccacgagagaaaaaggaagagaaaaaggaagacttggtaccagtggaggaagaagaggag
aatgctgcagcagaggaggaggaggagccggaggttccagcagggccacgcccacccatc
tctgaactggtcaagaaggagaagatcacccccatccctgatggcagcgccttctttatc
ttcagcaagaccaacccgatccgggtgggatgtcataaactcatcaatcaccacatcttc
accaacctcatcctggtcttcatcatgctcagctctgtctccctcgctgcagaggacccc
atacgcaacttctctgcacgcaacattatacttggttactttgactatgctttcacggct
atctttactgttgagatcctattgaagatgaccacatacggtgcgttcctccataaagga
gcgttctgtaggaacaccttcaacctgctggatctgctggtggtgggggtctccctggtc
tccttctgcatccagtcatctgccatctcagtggtgaagattctgagggtcctgcgtgtg
cttcggcccctgagggctatcaacagagccaaaggtctcaagcatgtagtccagtgtgtg
tttgtggccatcaggaccatcggtaacatcatgatagtcaccacgctgttgcagttcatg
tttgcctgcataggagtacagctctttaagggaagttttaaccgatgtacagacgaagcc
aagtccagcccagacgaatgcaagtcagggcactacatccatttaaggacgggactgaac
cagccgaccatccaaaagagagtgtggcacaacagcgagttcaactttgacaacgtgctg
atggccatgatggctcttttcaccgtgtctaccttcgagggctggccttcgcatagacct
ctaacagagagaacctgggtcccatctacaactaccccgcatcgagatctccatctcttc
acatctacatcatcatcagcgttttctcatgatgaacatcttcgtcggcttcgtcatcgt
caccttccaggagcaaggagagaaagatacaagaactgtgagcttgataagaaccagcgg
cagtgtgtggagtatgccctgaaggcccgtccgttgaggaggtacatccctaagaacccc
taccagtataagttctggtatgtggtcaactccacagggtttgagtacatcatgttcgtc
ctcatcatgctcaacacactctgcctggctgtgcagcactatggccagtctgcaacattt
aactatgtgatggacatcctcaacatggtcttcactgctgttttcactgcagagatggtg
ctcaaactcatcgccttcaaacctcggcactatttcactgacgcgtggaacacatttgat
gccttaattgtagttggtagcgtcgttgatattgctatcactgaagtgaatgtaagtact
gccttttctgcctctctcatggaactgaagccttactataacaccagaattgacagtagc
accaccattattcccaagtgtgttctgagattgaggaaggtgcttgtgcttacattcagc
ccacagtgcccccataacacggaggacagtgctcgcatctccatcaccttcttccgactg
ttccgagtcatgcgattggtcaagctgctgagtagaggggagggcatccgcaccctcctg
tggaccttcatcaagtcctttcaggctctgccctatgtcgcccttctgatcgccatgctc
ttcttcatctatgctgtcatcggcatgcaggtgttcgggaaggtagccatggtggacggc
acccacatcaacaggaacaacaactttcagaccttccctcaggccgtgctgttgctcttt
aggtgtgccactggggaggcgtggcaggagatcatgttggcgtgtgtgtctggaaagctg
tgtgacccagagtctgactacaaccctggagaggagatgacctgtggagccagcttcgcc
tacatctacttcatcagcttctacatgctctgtgccttcctgattatcaatttgtttgtg
gctgtcatcatggacaactttgactatctgactcgtgattggtcaatcctgggtcctcac
cacttggacgagtttaagaggatctggtctgagtatgacccagaggccaagggcaggatt
aaacatctggacgtggtcactctgctccgacgaattcagcctcctttgggcttcggcaaa
ctctgtcctcatagagtggcctgcaagagactggtggccatgaacatgcctctaaacagc
gacggcaccgtgatgttcaatgctaccctatttgcattagtacgcacagccctgaagatc
aaaactgatggtaatctggagcaggccaacgaggagctgagagcagtcatcaagaagatc
tggaagaggaccagtatgaagctactggaccaagtggtgccccctgctggtggtcagtca
aaacacacaatcctagtagcaacacacaaattagatcccggtagcatatatagacccaca
cgcccaacatcccagcacactatcacacagaaatatattacacacacacataatgccttc
tcattgtaa

DBGET integrated database retrieval system