KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112215922
Entry
112215922         CDS       T05605                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: serine/threonine-protein kinase mTOR-like
  KO
K07203  serine/threonine-protein kinase mTOR [EC:2.7.11.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04012  ErbB signaling pathway
otw04136  Autophagy - other
otw04140  Autophagy - animal
otw04150  mTOR signaling pathway
otw04218  Cellular senescence
otw04371  Apelin signaling pathway
otw04910  Insulin signaling pathway
otw04920  Adipocytokine signaling pathway
otw05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    112215922
   04371 Apelin signaling pathway
    112215922
   04150 mTOR signaling pathway
    112215922
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112215922
   04136 Autophagy - other
    112215922
  09143 Cell growth and death
   04218 Cellular senescence
    112215922
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112215922
   04920 Adipocytokine signaling pathway
    112215922
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    112215922
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112215922
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112215922
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112215922
Protein kinases [BR:otw01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   112215922
Membrane trafficking [BR:otw04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    112215922
SSDB
Motif
Pfam: FAT PI3_PI4_kinase DUF3385 FRB_dom FATC HEAT_2 HEAT EPSP_synthase Nipped-B_C HEAT_EZ
Other DBs
NCBI-GeneID: 112215922
NCBI-ProteinID: XP_024231192
LinkDB
Position
16
AA seq 2517 aa
MVIMSGTATVLQQFVSGLKSRNEDTRAKSAKDLQHYVTTELRELSQDEATTFYDELNHHI
FELVSSSDVNEKKGGILAIVSLIGVEGGNATRISRFANYLRNLLPSSDSVVMEMASKAMG
HLSMAGDTFTAEYVEFEVKRALEWLGADRNEGRRHAAVLVLRELAVSAPTFFFQQVQPFF
DNIFYAVWDQKQAIREGAVAALRACLILTTQRETKEMQKPQWYKQTFDEAEKGFDETLSK
EKGMNRDDRVHGALLILNELVRISSMEGERMREEMEEITQQQLVHDKYCKELMGFGTKPR
HITPFTSFQSVQPQQSNALLGLLGYSTPQGFLSFGATPVPAKSSLVESRYCRELMEECFD
QVCRWVLKYRTSKNPLIQMTILNLLPRLAAFQPHTFTDQYLADTMGYLLGCLKKEKERTA
AFQALGLLVVAVRAEIQPYLTKILEIIKAALPPKDFAHKRQKTMQVDATVFTCISMLSRA
MGPSIQQDIKELLEPMLAVGLSPALTAVLYDLSRQIPQLKKDIQDGLLKMLSLVLMHKPL
RHPGMPKGLAQQLASPSLTNIPEASDVGSITLALRTLGSFEFEGHSLTQFVRHCADHFLN
SEHKEIRMEAARTCSRLLTPSIHLISGHGHVVSQTAVQVVADVLSKLLVVGITDPDPDIR
YCVLASLDERFDAHLAQAENLQALFVALNDEVFEIRELAICTIGRLSSMNPAFVMPFLRK
MLIQILTELEHSGVGRNKEQSARMLGHLVSNAPRLIRPYMEPILKALILKLKDPDPNPGV
VISVLATIGELAQVSGLEMRKWMDELFPIIMDMLQDSSSLAKRQVALWTLGQQVASTGYV
VEPYRKYPSLLEVLLNFLKTEQNQGIRREAIRVLGLLGALDPYKHKVNIGMIDQSRDASA
VSLSESKSSQDSADYSTSEMLVNMGNLPLDEFYPAVAIVTLMRILRDPSLSNHHTMVVQA
VTFIFKSLGLKCVQFLPQVMPTFLNVIRVCDASIREFLFQQMGMVVCFVKIHIRPYMDDI
FTLIREYWTPNNPMQNTIILLIEQIVVALGGEFKLYLPQLIPHMLRVFMHDMSMGRSVTI
KLLNAIQLFGANLDDYLHLLLPPIVKLFDAPDVPLQARKVALETLDRLTESLDFTDYASR
IIHPIVRALDNTPELRSTAMDTLSSLVFQLGKKYQIFIPMVNKVMLKHRINHQRYDVLIC
RIVKGYTLAEEEEDPLIFQHRQLRSNQGDVGSGPAEAGPMKKLHVSTTALQKAWGAARKV
SKDDWLEWLRRLSVVLLKESSSPALRSCWSLAQTYIPLARDLFNAAFLSCWSELSEDQQD
ELIRSIELALTSQDIAEVTQTLLNLAEFMEHSDKGPLPLRDDNGIVLLGERAAKCRAYAK
ALHYKELEFQKGASPLILESLISINNKLQQPEAASGVLEYAMKHFGELEIQATWYEKLHE
WEDALVAYDKKIDINKDDPELILGRMRCLEALGEWGQLHQQCCEEWTLVTEDTQAKMARM
AAAAAWGLGHWDSMEEYTCMIPRDTHDGAFYRAVLALHQDLFSLAQQCIDKARDLLDAEL
TAMAGESYSRAYGAMVSCQMLSELEEVIQYKLVPERRDIIRDTWWERLQGCQRIVEDWQR
ILMVRSLVINPHEDMRTWLKYASLCGKSGRLALAHKTLVLLLGVDPSKQLDHPLPTAHPH
VTYAYMKYMWKSQHKIEAFQHMQHFVQGLQQQRPACHRRADQQHKQELHKLVQRCFLKLG
EWQLSLQGINESTIPKVLQYYNHSTEHDRNWYKAWHAWAVMNFEAVLHYKHQNQGRDEKK
KKRHVSGTSANSEASNSDSEVDSTEHSPVPSPGQKKANEDLSKTLLLYTVPAVQGFFRSI
SLSRGNNLQDTLRVLTLWFDYGHWPEVNEALVEGIKTIQIDTWLQVIPQLIARIDTPRAL
VGRLIHQLLTDIGRYHPQALIYPLTVASKSTTTARHNAANKILKNMCEHCNTLVQQAIMV
SEELIRVAILWHEMWHEGLEEASRLYFGERNVKGMFAVLEPLHAMMERGPQTLKETSFNQ
AYGRDLMEAQDWCRKYMRSGNVKDLTQAWDLYYHVFRRISKQLPQLTSLELQYVSPKLLM
CRDLELAVPGTYDPNQPIIRIQSIAPSLQVITSKQRPRKLTIMGSNGHEFMFLLKGHEDL
RQDERVMQLFGLVNTLLANDPASLRKNLSIQRYAVIPLSTNSGLIGWVPHCDTLHALIRD
YREKKKILLNIEHRIMLRMAPDYDHLTLMEKVEVFEHAVNNTAGDDLAKLLWLKSPSSEV
WFDRRTNYTRSLAVMSMVGYILGLGDRHPSNLMLDRLSGKILHIDFGDCFEVAMTREKFP
EKIPFRLTRMLTNAMEVTGLDGNYRITCHTVMEVLREHRDSVMAVLEAFVYDPLLNWRLM
DTNTKGNKRSRTRTDSYTAGQSVEALEGIDLGETTHKKPGTTVPESIHSFLGDGTVQPEA
LNKKAIQIINRVRDKLTGRDFSHDETLDVPTQVELLIKQATSHENLCQCYIGWCPFW
NT seq 7554 nt   +upstreamnt  +downstreamnt
atggttatcatgtctggcacagccacggtgctgcaacaatttgtcagtggcctgaagagt
cgaaatgaagacacaagggcaaaatctgcgaaagatctccagcactatgtgacgacagag
ctcagagagttgagccaagatgaagccactactttctacgatgaattgaatcatcacatt
tttgagctggtttccagctctgatgtgaatgagaaaaaaggagggattcttgctatagtg
agtctgattggagtagaaggaggcaatgccacccgaatcagccgcttcgccaactacctc
cgcaacctgctgccctccagtgactcggtggtcatggagatggcctccaaggccatgggc
cacctgtccatggcaggggacaccttcaccgcagagtatgtggagtttgaggtgaagagg
gcactggagtggctgggcgccgacaggaacgagggcaggcgccatgctgcggttcttgtc
ctaagggagttggccgtcagcgcacccacctttttcttccagcaagtccagccctttttc
gacaacatcttctatgcggtgtgggaccagaagcaggccatccgtgaaggggccgtggcc
gctctcagggcctgcctcatcctcactacccaacgagagaccaaggagatgcagaaacca
cagtggtacaaacaaacctttgacgaggctgagaaaggcttcgatgagaccttatccaaa
gagaagggtatgaaccgtgacgatagggtccatggcgccctcctcatcctcaacgagctg
gtccgcatcagcagcatggaaggagagcgcatgcgggaggagatggaggagatcacccag
cagcagctggtccacgacaagtactgcaaggagctgatgggcttcggcaccaagccgcgt
cacatcacccccttcaccagctttcagtcggtgcagccacagcagtccaatgccctgctg
ggtctcctgggctacagcacaccccagggcttcctcagcttcggggccacgccggtgccc
gccaagagctccctggtggagagccgctactgccgcgagctcatggaggagtgctttgac
caggtgtgccgctgggtgctgaagtacaggaccagtaagaaccctctgatccagatgacc
attctcaaccttctgccgcgcctcgccgctttccagccacacacttttacagaccagtac
ctggctgacaccatgggctacctgcttggctgtctgaagaaggagaaggagcgcacggcg
gccttccaagccctggggctgctggtggtggcggtacgcgctgagatccagccgtacctc
accaagattctggagatcatcaaggctgcgctgccccccaaggacttcgctcacaagaga
cagaagaccatgcaggtggatgccacagtgttcacctgtatcagtatgttgtccagagcc
atgggccctagcatccagcaagacatcaaggagctgctggagcccatgctggccgtggga
ctcagcccggccctgacggcggtgctgtacgacctgagtcggcagatcccccagctaaag
aaagacatccaggacggccttctgaagatgctctccctggtgctcatgcacaagccctta
cgccacccgggcatgcccaagggcctagcgcaacagctggcatcgcccagcctcaccaac
atccccgaggccagcgacgtgggcagcatcaccctggcactcaggacactgggcagcttt
gagtttgaaggccactcgctgacccagtttgtgcgccactgcgccgaccatttcctcaac
agcgagcacaaggagatccgcatggaggcggcacgcacctgctcccgcctactgacgccc
tccatccacctgatcagcggccatggccatgtggtcagccagacggccgtgcaggtggtg
gccgacgtgctcagcaaactgctggtagttggcatcacagatccagacccagatatccgc
tactgtgtgctggcctctctggacgagcgcttcgacgcccacctggcgcaggcggagaac
ctgcaagctctgttcgtggcgctgaacgatgaggtgtttgagatcagggaactggccatc
tgcaccatcggacgcctcagcagcatgaaccccgccttcgtcatgcccttcctgcgcaag
atgctcatccagattctgactgagctggagcacagtggcgtgggcaggaacaaggagcag
agtgcccgcatgctgggtcacctggtttccaatgccccccgcctcatacgcccatacatg
gagcccatcctaaaggccctgatcctgaagcttaaagacccagaccccaaccctggagtg
gtcatcagtgtcctggccactattggagagttggctcaggtgagcgggctggagatgagg
aagtggatggacgagctcttccccatcatcatggacatgctccaggactcctcctcattg
gccaagagacaggtggcgctgtggactttgggccagcaggttgctagcactggatacgtg
gtggagccctaccgcaagtacccctctcttctggaggtgctgctcaactttctcaagaca
gagcagaaccaggggatcagaagagaggctatccgtgtgctgggcttgctgggagccctg
gacccctacaagcacaaggtgaacattggcatgattgaccagtcacgagacgcttccgcc
gtcagcctctccgagtccaagtccagccaggactctgccgactacagtaccagtgagatg
ctggtgaacatgggcaacctccccctggacgagttctacccggcggtggccatcgtgacg
ttgatgcgcatcctgcgtgacccctccctctctaaccaccacaccatggtggtgcaggcg
gtcaccttcatcttcaagtccctgggcctgaagtgtgtccagttcctgccgcaggtcatg
cccaccttcctcaacgtcatccgcgtgtgcgacgctagcattcgagagtttctcttccag
cagatggggatggtcgtgtgctttgtaaaaatccacatccgcccctacatggatgacatc
ttcacactcatcagagagtactggacacctaacaatcccatgcagaacaccatcatcctg
ctgattgagcagatcgtggtggccttgggcggcgagttcaagctctacctgccgcagctc
atcccacacatgctgcgcgtcttcatgcacgacatgagcatgggccgcagtgtcaccatc
aagctcctcaatgccattcagctgttcggtgctaacctggacgactacctccacctgttg
ctgcctcccatcgtcaagctgtttgatgccccagacgtacctctacaggcccgcaaggtt
gccttggagacgctagaccggctgacggagtccctggacttcacggactatgcgtcgcgc
atcattcaccccatagtacgcgcgctggacaacacccccgagctacgcagcacagccatg
gacacgttgtcgtcgctcgttttccagctgggcaagaagtaccagatctttatccccatg
gtgaacaaagtgatgttgaagcacaggatcaatcaccagcgctatgacgtgctcatctgt
cggatcgtcaaggggtacactttggcggaggaggaagaggatcctttaatcttccagcat
cgccagctgcgcagtaaccagggcgatgtcggtagtggcccggcggaggcggggccaatg
aagaagctccacgtcagcaccacagccctgcagaaggcctggggcgccgctcggaaggtg
tccaaggacgactggctggagtggctgagacggctgagcgtggtcctgctgaaggagtca
tcgtcccctgccctgcgctcgtgctggtctctggcccaaacctacattcccctcgccagg
gacctgttcaacgcagccttcctgtcatgctggtctgagctgagtgaggatcagcaggat
gagctgatccgcagcatcgaactggccctcacctcccaggacatcgccgaggtcacccag
accctgctaaacctggctgagttcatggagcacagcgataagggtcctctgcctctgaga
gacgacaatggcattgttctactgggtgagagggctgccaaatgtcgtgcctacgccaag
gccctccactacaaagagctggagttccagaagggcgcctctcctctcatcctagagtcc
cttatcagcatcaataacaaactgcagcaaccagaggcagcatccggggtcctggagtac
gccatgaagcactttggcgaactggaaatccaggccacctggtacgagaagctccacgag
tgggaggatgcactggtggcgtacgacaagaagatcgacatcaacaaggatgaccctgag
ctgatcctggggcgcatgcgctgcttggaggccctgggcgaatggggccagttgcaccag
cagtgctgtgaggagtggactctggtcactgaggatacgcaggccaagatggcacggatg
gcagccgctgcagcctggggtctaggccactgggacagcatggaggagtatacatgtatg
atccccagggacacacacgatggagccttctacagggccgtgctcgctctgcatcaggac
ctcttctcattggctcagcagtgtatcgacaaggccagagatctattggatgcggagctg
acagccatggctggagagagttacagcagagcatatggggccatggtgtcgtgtcagatg
ctgtcggagctggaagaggtcatccagtacaagctggtcccagagaggagggacatcatc
cgagacacctggtgggaaaggctacagggttgccagcggatcgtggaggactggcagagg
atcctaatggttcgatcgctggtcatcaacccccacgaggacatgcggacctggctcaag
tacgccagtctctgtggcaagagtgggcgcctggcgttggcccacaagaccctggtcctt
ctcctgggggtggacccctcgaagcagctggaccacccgctgcccaccgcccacccccac
gttacctatgcctacatgaagtacatgtggaagagccaacacaagatcgaagccttccag
cacatgcagcactttgtccagggattgcagcagcagcgcccagcatgccatcgccgcgcg
gaccagcaacacaagcaggagctccacaagcttgtccagcggtgctttctgaagctgggt
gagtggcagctcagtcttcagggcattaatgagagcaccatccccaaagtgctgcagtac
tacaaccactccacggagcacgaccgcaactggtacaaggcctggcacgcatgggcggtg
atgaactttgaggcagtgctgcactacaagcaccagaaccagggccgggacgaaaagaag
aagaagcgccacgtcagcggcaccagcgcaaatagcgaggccagcaacagcgacagcgag
gtagacagcactgagcacagccctgtgccctcgccgggccagaagaaggccaacgaggac
ctctccaagacgttactcctctacacggttcctgctgtccagggcttcttccgctcaatc
tccctctccagagggaacaacctccaggacaccctgagggtcctgaccctctggtttgac
tatggacactggcctgaagtcaacgaggcactggtagagggtatcaaaaccattcagata
gacacctggctacaggtgatcccccagctgattgcccgcatcgacactccccgtgctctg
gttggccgcctcatccaccagctgctcaccgacattgggcgctaccacccccaggctttg
atctatccgttgaccgtggcctccaagtcaaccaccactgcccgccacaatgctgctaac
aagatcctcaagaacatgtgtgagcactgcaatacactggtccagcaggcgatcatggtg
agcgaggagctgatccgggtggccattctgtggcacgagatgtggcacgagggcctggag
gaggcctcccgactctactttggcgagcgcaacgtgaagggtatgtttgctgtgctggag
ccccttcacgccatgatggagaggggcccgcagaccctcaaagagacctccttcaaccag
gcctacgggagggacctcatggaggcccaggattggtgcaggaagtacatgcgctcgggc
aacgtgaaggacctgacccaagcgtgggacctgtactatcacgtcttcagacggatctcc
aagcagctaccacagctgacctccttggagctgcagtacgtgtcccccaagctgctgatg
tgcagggacctggagctggccgtgccggggacctacgaccccaaccagcccatcatccgc
atccagtccatcgccccctcgctgcaggtcatcacctccaagcagcggccgcgtaaactc
accatcatgggcagcaatggccatgagttcatgttcctcctgaagggccatgaggacctg
cggcaggacgagagggtcatgcaactctttggcctggttaacacactgctggccaatgac
ccagcctctctacgcaaaaacctcagcattcagcgctacgcagtgattcccctgtccacc
aactctggtctaattggctgggtgcctcactgcgacaccctccacgccctcatcagagat
taccgggagaagaagaagatcctgctcaacatcgagcaccgcattatgctcaggatggct
ccagactatgatcacctgaccctgatggagaaggtggaggtgtttgagcacgccgtcaac
aacacggccggagacgacctggccaagctgctgtggctgaagagccccagctctgaggtt
tggtttgacaggaggaccaattacacacgctccctggctgtgatgtcaatggtgggctac
atcctgggcctgggagacaggcatccatccaacttgatgttggacagactaagtggcaag
atcctccacattgattttggggattgctttgaggttgccatgaccagggagaagttcccg
gagaagattcctttcagactgacaagaatgctgacgaacgccatggaggtgacagggctg
gatgggaactacaggatcacatgtcacacggtgatggaggtgctgagggagcacagggac
agtgtcatggccgtactggaggccttcgtctacgacccactgctcaactggagactgatg
gacacgaacaccaagggaaacaagcgatccaggaccagaactgattcctacactgctgga
caatcagtcgaagcactggaggggatcgaccttggtgagaccacacacaagaaaccagga
actaccgtgcctgaatccattcattccttccttggagatggcactgtccagcctgaggcc
ctgaataaaaaggctatccagattatcaacagagtacgagacaagctgactgggcgtgat
ttctcacacgatgagactctggatgtgccaactcaagtggagctcctcatcaagcaggcg
acgtcgcacgagaacctatgccagtgttatattggatggtgtccattttggtag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112233028
Entry
112233028         CDS       T05605                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: serine/threonine-protein kinase mTOR-like
  KO
K07203  serine/threonine-protein kinase mTOR [EC:2.7.11.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04012  ErbB signaling pathway
otw04136  Autophagy - other
otw04140  Autophagy - animal
otw04150  mTOR signaling pathway
otw04218  Cellular senescence
otw04371  Apelin signaling pathway
otw04910  Insulin signaling pathway
otw04920  Adipocytokine signaling pathway
otw05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    112233028
   04371 Apelin signaling pathway
    112233028
   04150 mTOR signaling pathway
    112233028
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112233028
   04136 Autophagy - other
    112233028
  09143 Cell growth and death
   04218 Cellular senescence
    112233028
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112233028
   04920 Adipocytokine signaling pathway
    112233028
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    112233028
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112233028
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112233028
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112233028
Protein kinases [BR:otw01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   112233028
Membrane trafficking [BR:otw04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    112233028
SSDB
Motif
Pfam: FAT PI3_PI4_kinase DUF3385 FRB_dom FATC HEAT_2 HEAT EPSP_synthase Nipped-B_C HEAT_EZ
Other DBs
NCBI-GeneID: 112233028
NCBI-ProteinID: XP_024256146
LinkDB
Position
Unknown
AA seq 2517 aa
MVIMSGTATVLQQFVSGLKSRNEDTRAKSAKDLQHYVTTELRELSQDEATTFYDELNHHI
FELVSSSDVNEKKGGILAIVSLIGVEGGNATRISRFANYLRNLLPSSDSVVMEMASKAMG
HLSMAGDTFTAEYVEFEVKRALEWLGADRNEGRRHAAVLVLRELAVSAPTFFFQQVQPFF
DNIFYAVWDQKQAIREGAVAALRACLILTTQRETKEMQKPQWYKQTFDEAEKGFDETLSK
EKGMNRDDRVHGALLILNELVRISSMEGERMREEMEEITQQQLVHDKYCKELMGFGTKPR
HITPFTSFQSVQPQQSNALLGLLGYSTPQGFLSFGATPVPAKSSLVESRYCRELMEECFD
QVCRWVLKYRTSKNPLIQMTILNLLPRLAAFQPHTFTDQYLADTMGYLLGCLKKEKERTA
AFQALGLLVVAVRAEIQPYLTKILEIIKAALPPKDFAHKRQKTMQVDATVFTCISMLSRA
MGPSIQQDIKELLEPMLAVGLSPALTAVLYDLSRQIPQLKKDIQDGLLKMLSLVLMHKPL
RHPGMPKGLAQQLASPSLTNIPEASDVGSITLALRTLGSFEFEGHSLTQFVRHCADHFLN
SEHKEIRMEAARTCSRLLTPSIHLISGHGHVVSQTAVQVVADVLSKLLVVGITDPDPDIR
YCVLASLDERFDAHLAQAENLQALFVALNDEVFEIRELAICTIGRLSSMNPAFVMPFLRK
MLIQILTELEHSGVGRNKEQSARMLGHLVSNAPRLIRPYMEPILKALILKLKDPDPNPGV
VISVLATIGELAQVSGLEMRKWMDELFPIIMDMLQDSSSLAKRQVALWTLGQQVASTGYV
VEPYRKYPSLLEVLLNFLKTEQNQGIRREAIRVLGLLGALDPYKHKVNIGMIDQSRDASA
VSLSESKSSQDSADYSTSEMLVNMGNLPLDEFYPAVAIVTLMRILRDPSLSNHHTMVVQA
VTFIFKSLGLKCVQFLPQVMPTFLNVIRVCDASIREFLFQQMGMVVCFVKIHIRPYMDDI
FTLIREYWTPNNPMQNTIILLIEQIVVALGGEFKLYLPQLIPHMLRVFMHDMSMGRSVTI
KLLNAIQLFGANLDDYLHLLLPPIVKLFDAPDVPLQARKVALETLDRLTESLDFTDYASR
IIHPIVRALDNTPELRSTAMDTLSSLVFQLGKKYQIFIPMVNKVMLKHRINHQRYDVLIC
RIVKGYTLAEEEEDPLIFQHRQLRSNQGDVGSGPAEAGPMKKLHVSTTALQKAWGAARKV
SKDDWLEWLRRLSVVLLKESSSPALRSCWSLAQTYIPLARDLFNAAFLSCWSELSEDQQD
ELIRSIELALTSQDIAEVTQTLLNLAEFMEHSDKGPLPLRDDNGIVLLGERAAKCRAYAK
ALHYKELEFQKGASPLILESLISINNKLQQPEAASGVLEYAMKHFGELEIQATWYEKLHE
WEDALVAYDKKIDINKDDPELILGRMRCLEALGEWGQLHQQCCEEWTLVTEDTQAKMARM
AAAAAWGLGHWDSMEEYTCMIPRDTHDGAFYRAVLALHQDLFSLAQQCIDKARDLLDAEL
TAMAGESYSRAYGAMVSCQMLSELEEVIQYKLVPERRDIIRDTWWERLQGCQRIVEDWQR
ILMVRSLVINPHEDMRTWLKYASLCGKSGRLALAHKTLVLLLGVDPSKQLDHPLPTAHPH
VTYAYMKYMWKSQHKIEAFQHMQHFVQGLQQQRPACHRRADQQHKQELHKLVQRCFLKLG
EWQLSLQGINESTIPKVLQYYNHSTEHDRNWYKAWHAWAVMNFEAVLHYKHQNQGRDEKK
KKRHVSGTSANSEASNSDSEVDSTEHSPVPSPGQKKANEDLSKTLLLYTVPAVQGFFRSI
SLSRGNNLQDTLRVLTLWFDYGHWPEVNEALVEGIKTIQIDTWLQVIPQLIARIDTPRAL
VGRLIHQLLTDIGRYHPQALIYPLTVASKSTTTARHNAANKILKNMCEHCNTLVQQAIMV
SEELIRVAILWHEMWHEGLEEASRLYFGERNVKGMFAVLEPLHAMMERGPQTLKETSFNQ
AYGRDLMEAQDWCRKYMRSGNVKDLTQAWDLYYHVFRRISKQLPQLTSLELQYVSPKLLM
CRDLELAVPGTYDPNQPIIRIQSIAPSLQVITSKQRPRKLTIMGSNGHEFMFLLKGHEDL
RQDERVMQLFGLVNTLLANDPASLRKNLSIQRYAVIPLSTNSGLIGWVPHCDTLHALIRD
YREKKKILLNIEHRIMLRMAPDYDHLTLMEKVEVFEHAVNNTAGDDLAKLLWLKSPSSEV
WFDRRTNYTRSLAVMSMVGYILGLGDRHPSNLMLDRLSGKILHIDFGDCFEVAMTREKFP
EKIPFRLTRMLTNAMEVTGLDGNYRITCHTVMEVLREHRDSVMAVLEAFVYDPLLNWRLM
DTNTKGNKRSRTRTDSYTAGQSVEALEGIDLGETTHKKPGTTVPESIHSFLGDGTVQPEA
LNKKAIQIINRVRDKLTGRDFSHDETLDVPTQVELLIKQATSHENLCQCYIGWCPFW
NT seq 7554 nt   +upstreamnt  +downstreamnt
atggttatcatgtctggcacagccacggtgctgcaacaatttgtcagtggcctgaagagt
cgaaatgaagacacaagggcaaaatctgcgaaagatctccagcactatgtgacgacagag
ctcagagagttgagccaagatgaagccactactttctacgatgaattgaatcatcacatt
tttgagctggtttccagctctgatgtgaatgagaaaaaaggagggattcttgctatagtg
agtctgattggagtagaaggaggcaatgccacccgaatcagccgcttcgccaactacctc
cgcaacctgctgccctccagtgactcggtggtcatggagatggcctccaaggccatgggc
cacctgtccatggcaggggacaccttcaccgcagagtatgtggagtttgaggtgaagagg
gcactggagtggctgggcgccgacaggaacgagggcaggcgccatgctgcggttcttgtc
ctaagggagttggccgtcagcgcacccacctttttcttccagcaagtccagccctttttc
gacaacatcttctatgcggtgtgggaccagaagcaggccatccgtgaaggggccgtggcc
gctctcagggcctgcctcatcctcactacccaacgagagaccaaggagatgcagaaacca
cagtggtacaaacaaacctttgacgaggctgagaaaggcttcgatgagaccttatccaaa
gagaagggtatgaaccgtgacgatagggtccatggcgccctcctcatcctcaacgagctg
gtccgcatcagcagcatggaaggagagcgcatgcgggaggagatggaggagatcacccag
cagcagctggtccacgacaagtactgcaaggagctgatgggcttcggcaccaagccgcgt
cacatcacccccttcaccagctttcagtcggtgcagccacagcagtccaatgccctgctg
ggtctcctgggctacagcacaccccagggcttcctcagcttcggggccacgccggtgccc
gccaagagctccctggtggagagccgctactgccgcgagctcatggaggagtgctttgac
caggtgtgccgctgggtgctgaagtacaggaccagtaagaaccctctgatccagatgacc
attctcaaccttctgccgcgcctcgccgctttccagccacacacttttacagaccagtac
ctggctgacaccatgggctacctgcttggctgtctgaagaaggagaaggagcgcacggcg
gccttccaagccctggggctgctggtggtggcggtacgcgctgagatccagccgtacctc
accaagattctggagatcatcaaggctgcgctgccccccaaggacttcgctcacaagaga
cagaagaccatgcaggtggatgccacagtgttcacctgtatcagtatgttgtccagagcc
atgggccctagcatccagcaagacatcaaggagctgctggagcccatgctggccgtggga
ctcagcccggccctgacggcggtgctgtacgacctgagtcggcagatcccccagctaaag
aaagacatccaggacggccttctgaagatgctctccctggtgctcatgcacaagccctta
cgccacccgggcatgcccaagggcctagcgcaacagctggcatcgcccagcctcaccaac
atccccgaggccagcgacgtgggcagcatcaccctggcactcaggacactgggcagcttt
gagtttgaaggccactcgctgacccagtttgtgcgccactgcgccgaccatttcctcaac
agcgagcacaaggagatccgcatggaggcggcacgcacctgctcccgcctactgacgccc
tccatccacctgatcagcggccatggccatgtggtcagccagacggccgtgcaggtggtg
gccgacgtgctcagcaaactgctggtagttggcatcacagatccagacccagatatccgc
tactgtgtgctggcctctctggacgagcgcttcgacgcccacctggcgcaggcggagaac
ctgcaagctctgttcgtggcgctgaacgatgaggtgtttgagatcagggaactggccatc
tgcaccatcggacgcctcagcagcatgaaccccgccttcgtcatgcccttcctgcgcaag
atgctcatccagattctgactgagctggagcacagtggcgtgggcaggaacaaggagcag
agtgcccgcatgctgggtcacctggtttccaatgccccccgcctcatacgcccatacatg
gagcccatcctaaaggccctgatcctgaagcttaaagacccagaccccaaccctggagtg
gtcatcagtgtcctggccactattggagagttggctcaggtgagcgggctggagatgagg
aagtggatggacgagctcttccccatcatcatggacatgctccaggactcctcctcattg
gccaagagacaggtggcgctgtggactttgggccagcaggttgctagcactggatacgtg
gtggagccctaccgcaagtacccctctcttctggaggtgctgctcaactttctcaagaca
gagcagaaccaggggatcagaagagaggctatccgtgtgctgggcttgctgggagccctg
gacccctacaagcacaaggtgaacattggcatgattgaccagtcacgagacgcttccgcc
gtcagcctctccgagtccaagtccagccaggactctgccgactacagtaccagtgagatg
ctggtgaacatgggcaacctccccctggacgagttctacccggcggtggccatcgtgacg
ttgatgcgcatcctgcgtgacccctccctctctaaccaccacaccatggtggtgcaggcg
gtcaccttcatcttcaagtccctgggcctgaagtgtgtccagttcctgccgcaggtcatg
cccaccttcctcaacgtcatccgcgtgtgcgacgctagcattcgagagtttctcttccag
cagatggggatggtcgtgtgctttgtaaaaatccacatccgcccctacatggatgacatc
ttcacactcatcagagagtactggacacctaacaatcccatgcagaacaccatcatcctg
ctgattgagcagatcgtggtggccttgggcggcgagttcaagctctacctgccgcagctc
atcccacacatgctgcgcgtcttcatgcacgacatgagcatgggccgcagtgtcaccatc
aagctcctcaatgccattcagctgttcggtgctaacctggacgactacctccacctgttg
ctgcctcccatcgtcaagctgtttgatgccccagacgtacctctacaggcccgcaaggtt
gccttggagacgctagaccggctgacggagtccctggacttcacggactatgcgtcgcgc
atcattcaccccatagtacgcgcgctggacaacacccccgagctacgcagcacagccatg
gacacgttgtcgtcgctcgttttccagctgggcaagaagtaccagatctttatccccatg
gtgaacaaagtgatgttgaagcacaggatcaatcaccagcgctatgacgtgctcatctgt
cggatcgtcaaggggtacactttggcggaggaggaagaggatcctttaatcttccagcat
cgccagctgcgcagtaaccagggcgatgtcggtagtggcccggcggaggcggggccaatg
aagaagctccacgtcagcaccacagccctgcagaaggcctggggcgccgctcggaaggtg
tccaaggacgactggctggagtggctgagacggctgagcgtggtcctgctgaaggagtca
tcgtcccctgccctgcgctcgtgctggtctctggcccaaacctacattcccctcgccagg
gacctgttcaacgcagccttcctgtcatgctggtctgagctgagtgaggatcagcaggat
gagctgatccgcagcatcgaactggccctcacctcccaggacatcgccgaggtcacccag
accctgctaaacctggctgagttcatggagcacagcgataagggtcctctgcctctgaga
gacgacaatggcattgttctactgggtgagagggctgccaaatgtcgtgcctacgccaag
gccctccactacaaagagctggagttccagaagggcgcctctcctctcatcctagagtcc
cttatcagcatcaataacaaactgcagcaaccagaggcagcatccggggtcctggagtac
gccatgaagcactttggcgaactggaaatccaggccacctggtacgagaagctccacgag
tgggaggatgcactggtggcgtacgacaagaagatcgacatcaacaaggatgaccctgag
ctgatcctggggcgcatgcgctgcttggaggccctgggcgaatggggccagttgcaccag
cagtgctgtgaggagtggactctggtcactgaggatacgcaggccaagatggcacggatg
gcagccgctgcagcctggggtctaggccactgggacagcatggaggagtatacatgtatg
atccccagggacacacacgatggagccttctacagggccgtgctcgctctgcatcaggac
ctcttctcattggctcagcagtgtatcgacaaggccagagatctattggatgcggagctg
acagccatggctggagagagttacagcagagcatatggggccatggtgtcgtgtcagatg
ctgtcggagctggaagaggtcatccagtacaagctggtcccagagaggagggacatcatc
cgagacacctggtgggaaaggctacagggttgccagcggatcgtggaggactggcagagg
atcctaatggttcgatcgctggtcatcaacccccacgaggacatgcggacctggctcaag
tacgccagtctctgtggcaagagtgggcgcctggcgttggcccacaagaccctggtcctt
ctcctgggggtggacccctcgaagcagctggaccacccgctgcccaccgcccacccccac
gttacctatgcctacatgaagtacatgtggaagagccaacacaagatcgaagccttccag
cacatgcagcactttgtccagggattgcagcagcagcgcccagcatgccatcgccgcgcg
gaccagcaacacaagcaggagctccacaagcttgtccagcggtgctttctgaagctgggt
gagtggcagctcagtcttcagggcattaatgagagcaccatccccaaagtgctgcagtac
tacaaccactccacggagcacgaccgcaactggtacaaggcctggcacgcatgggcggtg
atgaactttgaggcagtgctgcactacaagcaccagaaccagggccgggacgaaaagaag
aagaagcgccacgtcagcggcaccagcgcaaatagcgaggccagcaacagcgacagcgag
gtagacagcactgagcacagccctgtgccctcgccgggccagaagaaggccaacgaggac
ctctccaagacgttactcctctacacggttcctgctgtccagggcttcttccgctcaatc
tccctctccagagggaacaacctccaggacaccctgagggtcctgaccctctggtttgac
tatggacactggcctgaagtcaacgaggcactggtagagggtatcaaaaccattcagata
gacacctggctacaggtgatcccccagctgattgcccgcatcgacactccccgtgctctg
gttggccgcctcatccaccagctgctcaccgacattgggcgctaccacccccaggctttg
atctatccgttgaccgtggcctccaagtcaaccaccactgcccgccacaatgctgctaac
aagatcctcaagaacatgtgtgagcactgcaatacactggtccagcaggcgatcatggtg
agcgaggagctgatccgggtggccattctgtggcacgagatgtggcacgagggcctggag
gaggcctcccgactctactttggcgagcgcaacgtgaagggtatgtttgctgtgctggag
ccccttcacgccatgatggagaggggcccgcagaccctcaaagagacctccttcaaccag
gcctacgggagggacctcatggaggcccaggattggtgcaggaagtacatgcgctcgggc
aacgtgaaggacctgacccaagcgtgggacctgtactatcacgtcttcagacggatctcc
aagcagctaccacagctgacctccttggagctgcagtacgtgtcccccaagctgctgatg
tgcagggacctggagctggccgtgccggggacctacgaccccaaccagcccatcatccgc
atccagtccatcgccccctcgctgcaggtcatcacctccaagcagcggccgcgtaaactc
accatcatgggcagcaatggccatgagttcatgttcctcctgaagggccatgaggacctg
cggcaggacgagagggtcatgcaactctttggcctggttaacacactgctggccaatgac
ccagcctctctacgcaaaaacctcagcattcagcgctacgcagtgattcccctgtccacc
aactctggtctaattggctgggtgcctcactgcgacaccctccacgccctcatcagagat
taccgggagaagaagaagatcctgctcaacatcgagcaccgcattatgctcaggatggct
ccagactatgatcacctgaccctgatggagaaggtggaggtgtttgagcacgccgtcaac
aacacggccggagacgacctggccaagctgctgtggctgaagagccccagctctgaggtt
tggtttgacaggaggaccaattacacacgctccctggctgtgatgtcaatggtgggctac
atcctgggcctgggagacaggcatccatccaacttgatgttggacagactaagtggcaag
atcctccacattgattttggggattgctttgaggttgccatgaccagggagaagttcccg
gagaagattcctttcagactgacaagaatgctgacgaacgccatggaggtgacagggctg
gatgggaactacaggatcacatgtcacacggtgatggaggtgctgagggagcacagggac
agtgtcatggccgtactggaggccttcgtctacgacccactgctcaactggagactgatg
gacacgaacaccaagggaaacaagcgatccaggaccagaactgattcctacactgctgga
caatcagtcgaagcactggaggggatcgaccttggtgagaccacacacaagaaaccagga
actaccgtgcctgaatccattcattccttccttggagatggcactgtccagcctgaggcc
ctgaataaaaaggctatccagattatcaacagagtacgagacaagctgactgggcgtgat
ttctcacacgatgagactctggatgtgccaactcaagtggagctcctcatcaagcaggcg
acgtcgcacgagaacctatgccagtgttatattggatggtgtccattttggtag

DBGET integrated database retrieval system