KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112216060
Entry
112216060         CDS       T05605                                 

Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform-like isoform X1
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw00562  Inositol phosphate metabolism
otw01100  Metabolic pathways
otw04012  ErbB signaling pathway
otw04068  FoxO signaling pathway
otw04070  Phosphatidylinositol signaling system
otw04140  Autophagy - animal
otw04150  mTOR signaling pathway
otw04210  Apoptosis
otw04218  Cellular senescence
otw04370  VEGF signaling pathway
otw04510  Focal adhesion
otw04620  Toll-like receptor signaling pathway
otw04625  C-type lectin receptor signaling pathway
otw04810  Regulation of actin cytoskeleton
otw04910  Insulin signaling pathway
otw04914  Progesterone-mediated oocyte maturation
otw05132  Salmonella infection
otw05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    112216060
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    112216060
   04370 VEGF signaling pathway
    112216060
   04068 FoxO signaling pathway
    112216060
   04070 Phosphatidylinositol signaling system
    112216060
   04150 mTOR signaling pathway
    112216060
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112216060
  09143 Cell growth and death
   04210 Apoptosis
    112216060
   04218 Cellular senescence
    112216060
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112216060
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112216060
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    112216060
   04625 C-type lectin receptor signaling pathway
    112216060
  09152 Endocrine system
   04910 Insulin signaling pathway
    112216060
   04914 Progesterone-mediated oocyte maturation
    112216060
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112216060
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    112216060
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112216060
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     112216060
Membrane trafficking [BR:otw04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    112216060
SSDB
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_p85B PI3K_C2 PI3K_rbd DUF4135
Other DBs
NCBI-GeneID: 112216060
NCBI-ProteinID: XP_024231456
LinkDB
Position
16
AA seq 1047 aa
MPPGEYGMLGEWEKEGDHDIMMDFLLPTGIFLKFPVSRNDTIGAIKKMVWRNASSEPLYG
ALSDADAYVFTCINSTAEREELEDETRRLCDVRLFMSVLRLVAREGDRVEKLTNTQISLL
IGKGLHEFDSQKNHEVNEFRVKMRSFCEEKAQDRQRLPWYQWMEYSFSCDLEPCVSLAEP
GGIKTKGTKKIFVNVKFEASDESFMLQQEPQDLPVILMRSALKKKATVFRSVRQEKPEDY
TLQVNGRWEFIYGKYPLCQFKYIFSCLRGGQTPHLTMVHHSTVVKYQEEQGCLGSQLSKS
RSLSKPPPLPVKKQNTSSLWSIEEPFHIHLLQGYRVNADEGMKLVVQAGLFHGSELLCKV
VTSGEVNVCSEPLWDQKLVFDISVSDLPRMSRLCFALYAVIEKAKKPRSTKKKNKKADCP
LAWVNTMVFDYKDQLKTGEFLLSTWPSVPDDKGDLLNPMGTVEKNPNVDSAAGLLIHFPN
IRPHPLYYPHFDKLRDLEKNGGKVIATKVEHMKLKEIVDNKNYTEFFEDEKELLWKLRGV
VRERYPESLSKLLLITKWNKHEDVAQMVTFLQKWPDLPALHALELLDYSFPDPMVRSFTI
RCLRKLRDEELLQYLLQLVQVLKYESYLDCDLATFLLERALSNKRIGHFLFWHLRSEMHV
SSVSLRFGLILEAYCRGNIYHIKSLWKQNEALNKMKALNDFVKSGWQKTSRQQMTDDMKL
CIKQEAYMEALSYLLSPLNPSIMLSEICADRCKFMDSKMKPLWLMYKNKWVQGDTVGIIF
KNGDDLRQDMLTLQMIQLMEILWKKEGLDLRMIPYGCLSTGNKTGLIEVVKNSDTIANIQ
RNNSNSAATAAFNKDALLNWLKSKNPDRDKLDQAIEEFTLSCAGYCVATYVLGIGDRHND
NIMIKETGQLFHIDFGHFLGNFKSKFGINRERVPFILTYDFVHVIQQGRTNNSEKFERFR
ECCEQAYKILCRNGTLFVNLFAMMKAAGLPELSSFKDIQYLKDSLALGKSEEEALKNFKV
KFNEALRESWKTKVNWMMHSLAKDSRL
NT seq 3144 nt   +upstreamnt  +downstreamnt
atgcccccgggggagtatgggatgctgggcgagtgggagaaggagggggaccatgacatc
atgatggacttcctgctgcccaccgggatcttcctgaaattccctgtgtctcgcaatgac
accatcggggccatcaaaaaaatggtgtggaggaacgctagcagcgagcccttgtatgga
gcgctgagcgacgcggacgcttacgtgttcacctgtatcaactcgacagcagagcgtgag
gagctagaagacgagacccgtcgtctgtgtgatgtccggctcttcatgtctgtcctgagg
ctggtggcccgggagggtgaccgtgtggagaagctcaccaacacccagatcagcctgctg
attggcaaaggtctgcacgaatttgactcccagaagaaccatgaggtgaacgagttccgg
gtgaagatgcggtccttctgtgaagagaaggcccaggaccgccagcggttgccatggtac
cagtggatggagtacagcttctcgtgtgatctagagccatgtgtttccctggcagagcct
gggggcatcaagacaaaaggcactaagaagatctttgtcaatgtcaagtttgaggccagc
gatgaaagctttatgcttcagcaggagccccaggacctgccggtgatcttaatgcggagt
gccctaaagaagaaggccactgtgtttcgctcagtgcgacaggagaagccagaggactac
actttacaggtcaatgggaggtgggaattcatatacgggaaataccccctgtgccagttc
aaatacatcttctcctgtttgagagggggtcaaaccccccacctgaccatggttcatcac
tccaccgttgtcaaataccaggaggagcagggctgcctgggcagccagctgtccaagagt
cgctccttgtctaagcccccccctctacccgtgaagaagcagaacacgtcgtctttgtgg
tccattgaggagcctttccacattcacttgctacaaggctaccgagtcaatgcagatgaa
ggaatgaagctggtcgtccaggcaggtctgttccacggcagtgagctgctgtgtaaggta
gtgaccagcggtgaggttaacgtgtgctccgagcccttgtgggaccagaagctggtgttt
gacatcagcgtgagcgacctgcctcgtatgagccgcctgtgctttgctctctacgccgtc
atcgagaaggccaagaagccccgctccaccaaaaagaagaacaagaaagctgactgtcca
ctagcctgggtaaacaccatggtgtttgactataaggatcagctgaagactggggagttc
cttctctccacctggccttcagtccctgatgataaaggcgacctcttgaatccaatgggc
acagtggagaaaaatcccaacgttgatagtgcagcaggactcctcattcacttccccaat
atccgacctcaccctctctactacccccatttcgacaagttgagggacctagaaaaaaat
ggagggaaggttatagccaccaaggtagagcatatgaagctaaaggaaatagtagacaat
aagaactacacagagttctttgaggacgagaaagagcttctgtggaagctacgcggtgtg
gtgcgggagcgctacccagagagtctgtccaaacttctcctcatcacaaaatggaataag
cacgaggatgtagcacagatggtgacatttctgcagaaatggccggacctccctgctctc
catgccctggagctgctggactacagtttccctgacccaatggtccgttccttcacaatc
agatgcctaaggaagctgagagatgaggagctgctccagtacttgctgcagttggttcag
gttctgaagtatgagtcttacctggactgtgaccttgctacttttctgctagagagagcc
ctctccaacaagaggataggtcacttcctcttctggcatctcaggtcagaaatgcacgta
tcctcggtcagtctgcgtttcggcctgattctagaggcttactgcaggggcaacatctat
cacatcaagagcttatggaaacagaacgaggctctgaacaagatgaaggctctgaatgac
tttgtgaagtcgggctggcagaagacatcgcgccagcagatgacagatgacatgaagctg
tgtatcaaacaggaggcctacatggaggccctctcatatctgctgtccccgctcaatccc
agcatcatgctctcagagatttgtgcggacagatgcaagttcatggactccaagatgaag
cccctgtggctcatgtacaagaacaaatgggtgcagggggacactgtgggcataatcttc
aagaacggagatgatctccgacaagacatgttgaccctccaaatgatccagctgatggaa
atcctttggaagaaagagggactagatctaaggatgatcccctacggctgcctctccacc
gggaacaagacaggcctcattgaggtggtgaaaaactcagacaccatcgccaacatccag
cgcaacaacagcaacagtgccgcgactgctgctttcaacaaagacgccctgctcaactgg
cttaaatccaagaacccagacagggataaacttgaccaggccattgaggagttcacacta
tcatgtgctggttactgtgtagccacttacgtgttgggtatcggagatcgccacaacgac
aatatcatgatcaaggagactgggcagctgttccacattgactttgggcactttctggga
aacttcaagagcaaatttgggatcaacagggaacgtgtgccttttattctgacgtacgac
tttgtccacgtcatccaacaagggaggaccaacaacagtgagaagtttgaaaggttcaga
gagtgctgtgagcaggcctataagatcttgtgtcgcaatgggactctgtttgttaacctg
tttgccatgatgaaagcagccggactgcctgagctgagctccttcaaggacatccagtac
ctaaaggactcattggctttggggaaatcggaggaagaagcgctgaagaatttcaaagtc
aagtttaacgaagctctgagagagagctggaagaccaaggtgaactggatgatgcactct
cttgccaaagatagcagactttga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112226747
Entry
112226747         CDS       T05605                                 

Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit gamma-like
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04012  ErbB signaling pathway
otw04068  FoxO signaling pathway
otw04070  Phosphatidylinositol signaling system
otw04140  Autophagy - animal
otw04150  mTOR signaling pathway
otw04210  Apoptosis
otw04218  Cellular senescence
otw04370  VEGF signaling pathway
otw04510  Focal adhesion
otw04620  Toll-like receptor signaling pathway
otw04625  C-type lectin receptor signaling pathway
otw04810  Regulation of actin cytoskeleton
otw04910  Insulin signaling pathway
otw04914  Progesterone-mediated oocyte maturation
otw05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    112226747
   04370 VEGF signaling pathway
    112226747
   04068 FoxO signaling pathway
    112226747
   04070 Phosphatidylinositol signaling system
    112226747
   04150 mTOR signaling pathway
    112226747
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112226747
  09143 Cell growth and death
   04210 Apoptosis
    112226747
   04218 Cellular senescence
    112226747
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112226747
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112226747
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    112226747
   04625 C-type lectin receptor signaling pathway
    112226747
  09152 Endocrine system
   04910 Insulin signaling pathway
    112226747
   04914 Progesterone-mediated oocyte maturation
    112226747
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    112226747
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112226747
Membrane trafficking [BR:otw04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    112226747
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 DUF4201 Exonuc_VII_L Spc7 TelA
Other DBs
NCBI-GeneID: 112226747
NCBI-ProteinID: XP_024247035
LinkDB
Position
28
AA seq 470 aa
MDQAPPALPPRSTKPMTSSMSHNCLREAPVFPLQDAEWYWGDISREEVNEKLCNTPDGSF
LVRDASTKTQGDFTLTLRKDGHSKLIKIYHREGKYGFSEPLTFSSVVELIWHYQHHPLVE
YNAVLDVMLTHPVSRFQQDELVEEDSVDVAGRKLQEYHSQYQEKSQEFDRLYEAYSKTSQ
EIQMKRTAIDAFNETMLIFEEQCREQERYGEECERSSRSEGTEKDLESFLMNYEKLKSRL
GEIYNSKVHLEQDLRSQVQDYRETDRRINSLRPDLIELRNIRDQYFNWLNHKGVRQKRIN
DWLGIQDDSSDDTYVLKGEREKLAHHDEGTWFVGELSRTQAEEMLMDKPTGTFLIRESSK
QGCYACSVVVNEEVKHCMIYSTPRGYGFAEPYDLHCSLKELVLHYRLNSLAQHNQALDVR
LVHPVHVTPVSSASPRTATEDCLRLKTEEHHLLQTSTKLPAGLPAAAPEM
NT seq 1413 nt   +upstreamnt  +downstreamnt
atggatcaggcacctccagctctccctcctaggtcaacaaagcccatgacctcctccatg
agccacaactgcctcagggaagcccccgtctttcccctgcaagatgctgagtggtactgg
ggagacatttccagggaggaagtcaacgagaagctctgcaacacacctgacggttccttc
ctagttcgtgacgcttccactaagacacaaggagacttcacgctaacgctgaggaaagac
ggccacagcaagttgataaagatctaccaccgtgaggggaagtacggattctcagagccc
ctgaccttcagctccgtggtggagctcatctggcactaccagcaccatcctctggtggag
tacaacgctgtgcttgacgtcatgctcacacaccccgtatcccgcttccaacaggatgag
ctggtggaagaggacagtgttgacgtggctggcaggaagctccaggagtaccacagtcag
tatcaggagaagagtcaagaatttgaccgtctatacgaggcctacagtaaaacctcacag
gagatccagatgaagagaacagcgatagatgccttcaacgagaccatgctgatcttcgag
gagcagtgtcgtgagcaggagcgttacggggaggagtgtgagaggagcagtcgatctgag
ggaacagagaaggacctggagagcttcctgatgaactatgagaagctgaagtctcggctg
ggggagatctacaatagtaaggtccacctggagcaggacttgaggtcccaggtccaggac
tatagagagacagacaggaggatcaacagcctcaggcctgacctcatagagctacgcaac
ataagggaccagtacttcaattggctgaatcacaaaggtgtgcgacagaaacgcattaac
gattggctggggatccaagacgatagcagtgatgacacctatgtgttgaagggggaacgg
gagaagctggcgcaccatgatgaggggacctggttcgtgggagagctgagcaggacgcag
gctgaggagatgctgatggacaaacccaccggaaccttcctgatccgagagagcagcaag
cagggctgctacgcctgctctgtggttgtgaatgaagaagtaaagcattgcatgatctac
agcacgccacgtggttacggctttgctgagccctacgacctccactgctctctgaaggag
ctcgttctgcactaccgcctcaactccctggcacagcacaaccaggccttggacgtccgg
ctggtgcaccccgtccacgtcacccctgtctcgtcagcttcgccccgcacagccacagag
gattgcctgcgactaaagacagaggaacaccatcttctacagacttctactaaactaccc
gcgggactccccgcagccgctccagagatgtag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112227144
Entry
112227144         CDS       T05605                                 

Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform-like
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw00562  Inositol phosphate metabolism
otw01100  Metabolic pathways
otw04012  ErbB signaling pathway
otw04068  FoxO signaling pathway
otw04070  Phosphatidylinositol signaling system
otw04140  Autophagy - animal
otw04150  mTOR signaling pathway
otw04210  Apoptosis
otw04218  Cellular senescence
otw04370  VEGF signaling pathway
otw04510  Focal adhesion
otw04620  Toll-like receptor signaling pathway
otw04625  C-type lectin receptor signaling pathway
otw04810  Regulation of actin cytoskeleton
otw04910  Insulin signaling pathway
otw04914  Progesterone-mediated oocyte maturation
otw05132  Salmonella infection
otw05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    112227144
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    112227144
   04370 VEGF signaling pathway
    112227144
   04068 FoxO signaling pathway
    112227144
   04070 Phosphatidylinositol signaling system
    112227144
   04150 mTOR signaling pathway
    112227144
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112227144
  09143 Cell growth and death
   04210 Apoptosis
    112227144
   04218 Cellular senescence
    112227144
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112227144
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112227144
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    112227144
   04625 C-type lectin receptor signaling pathway
    112227144
  09152 Endocrine system
   04910 Insulin signaling pathway
    112227144
   04914 Progesterone-mediated oocyte maturation
    112227144
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112227144
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    112227144
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112227144
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     112227144
Membrane trafficking [BR:otw04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    112227144
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_C2 PI3K_p85B DUF2321 DUF5314 C2
Other DBs
NCBI-GeneID: 112227144
NCBI-ProteinID: XP_024247768
LinkDB
Position
28
AA seq 1068 aa
MPPRPSSGELWGMHLMPPSIQVDCLLPNGMILTLVCTREATLISVKHELFKEARKYPLHH
LLQEETSYIFVSVTQEAEREEFYDETRRLCDLRLFQAFLKVIEPVGNREEKILNREIGFA
IGMPICEFDLVKDSEVQDFRRNILNVCKESVDLRDTNGPISRALYVYPPNVESSVELPKH
IFNKLDKGQIIVVIWVIVSPSNDKQKYTLKINHDCVPEHVIAEAIRKKTRSMLLSHEQLK
MCVQEYQGKYILKVCGCDEYLLEKYPLSQYKYVRSCIMLGRMPNLMLMAKDSLYSQLPID
TFTMPSYARRISTATPYMNGETATKSLWTINGTLRIRILCATYVNVNIRDIDKIYVRTGI
YHGGEQLCDNVNTQRVPCSNPRWNEWLNYDMYIPDIPRAARLCLSICSVKGRKGAKEEHC
PLAWGNINLFDYTHTLVAGKMALNLWPVPHGLEDLLNAIGVTGSNPNKETPCLELEFDHF
SNPVKFPDMPAIEEHANCNISRELGFNYCHTGLSNRLARDNPLTDSDNEQLRLVCNRDPL
SEITEQEKDFLWRHRHYCGTIPEILPKILLAVKWNSRDEVAQMYCLLKDWPAIKPEQAME
LLDCNFPDPMIRDFAVKCLEKYLTDDRLSQYLIQLVQVLKYEQYLDNPLARFLLKKALTN
QRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLSRQVEAMEKLINLTDLLK
QEKKDEAQKVQMKFLVEQMKRPDYMDALQSFTSPLNPAHQLGNLRLEECRMMSSAKRPLW
LNWENPDMMSELLFQSNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCLS
IGDCVGLIEVVRNSHTIMQIQCKGGLKGALQFNSHTLHQWLKDKNRGEMYDQAIDLFTRS
CAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDF
LIVISKGTQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIA
YIRKTLALDKTEQEALDYFMKQMNDAHHGGWTTKMDWIFHTIRQHAMN
NT seq 3207 nt   +upstreamnt  +downstreamnt
atgcctcccagaccgtcttctggggaactatggggcatgcacttgatgcccccaagcatc
caggtggactgccttctcccaaatgggatgattctgacattggtgtgcacacgcgaggca
acactcatctcagtcaaacacgaactcttcaaagaggccaggaagtatcctctccaccac
ctcctacaagaggagacctcctacatctttgtcagcgttacccaagaggctgagagagag
gagttctatgacgagacaaggagactgtgtgacctcaggctttttcaggccttcctgaaa
gtcatcgaaccagtgggcaaccgagaagagaagatactcaaccgagaaattggttttgca
ataggaatgcctatatgcgagtttgacctggtcaaggactcggaagtgcaggactttaga
agaaacatattgaatgtctgcaaggagtctgtggacctccgagacactaatggacccatc
agtagagcgttgtacgtctaccctcccaatgtagagtcgtcagtagaactgcccaagcac
atcttcaataagcttgacaaaggtcaaatcatagtggtcatctgggtcatcgtgtcaccg
agcaacgacaagcagaagtacaccctgaagatcaatcacgactgcgtgccggagcatgtg
atcgcagaggccatccgcaagaagacgcgtagcatgctgctgtcccacgagcagctcaag
atgtgtgtgcaggagtatcagggaaagtacatcctcaaggtgtgtggctgtgacgagtac
ctgctggagaagtacccccttagccagtacaagtacgtgaggagttgcatcatgctgggg
cgcatgcctaacctcatgctaatggccaaggatagcctttactcccagctgcccatcgac
acctttaccatgccctcgtacgcccgacgcatttccacggcaacgccctatatgaacggc
gagacggccaccaagtccctgtggaccatcaacggcacgctgaggatcaggatactgtgc
gcaacctatgtcaatgtaaacatcagggacattgacaagatctatgtccggactgggatc
taccacggtggggagcagctgtgtgacaatgtgaacactcagcgcgtgccatgctcaaat
cccagatggaatgagtggctgaactacgacatgtacattccagacatcccacgtgccgcc
cgcctctgtctgtccatctgctctgtgaaagggaggaagggggctaaagaggagcattgt
ccgctagcctggggcaacatcaatctgtttgactacacccacactctagtggccgggaag
atggccctcaacctgtggcctgtgccccatggcctggaagacctgctcaatgccatcgga
gtcactggctccaatccaaacaaggaaaccccttgcctggagctggagtttgatcacttc
agtaacccggtcaagttccccgacatgccggccatcgaggagcacgccaactgtaacata
tcccgggagctgggcttcaactactgccacaccggtttgagtaacagactggcgagggac
aaccccctgacagacagtgacaatgaacagctgcgcttggtgtgtaacagagacccactg
tctgaaatcactgagcaggagaaggacttcctgtggaggcacagacattactgcgggact
atcccagagatacttcccaagattctcctggcagtgaaatggaactccagagatgaggtt
gcacagatgtattgccttctgaaggactggccagccataaagccagaacaagccatggag
ttgctggactgcaacttccccgatcccatgattcgagactttgccgtgaagtgccttgag
aaatacttaacagacgacagactctctcaatacctcatccagctggtccaggttcttaag
tacgaacagtacctcgacaacccgctggcccgcttcctgctgaagaaggctttgaccaat
cagcggataggacatttcttcttttggcatctcaagtcggagatgcacaacaagactgtg
agccagcggtttggcctgctgctggagtcctactgccgggcctgtggcatgtacctcaag
cacctgagcagacaggtggaggccatggagaaactcatcaaccttaccgacctcctcaag
caggagaagaaggacgaggcccagaaggttcagatgaagttcctggtggagcagatgaaa
cggcctgactacatggatgccctacagagcttcacctctccactcaacccagcgcaccag
ctgggaaacctccgcttggaagagtgccggatgatgtcatcggccaagcggcccctgtgg
ctcaattgggagaaccccgacatgatgtcagagctgctcttccagagcaacgagatcata
tttaaaaacggagatgatctgaggcaggacatgctgactttgcagatcattagaataatg
gagaacatctggcagaaccagggccttgatctcaggatgctgccgtacggctgcctgtcc
atcggcgactgcgtgggcctgatagaggtggtgagaaactcccacaccatcatgcagatc
cagtgtaaaggaggcctgaagggggcgctgcagttcaacagccacacactgcaccagtgg
ctcaaggacaagaacaggggagagatgtacgaccaggccattgacttgttcacacggtcg
tgtgcgggctactgcgtagccaccttcatcctggggatcggtgacagacacaacagcaac
atcatggtcaaagatgatggacagctattccacatagactttggccatttcctggatcac
aagaagaagaagtttggctacaagcgagagcgggtgcccttcgtcttgacacaggacttc
ttaatcgtcatcagtaaaggaacccaggagtgcaccaaaaccagggagtttgagaggttc
caggagatgtgctacaaggcctacctggccatccggcagcacgccaacctcttcatcaac
ctgttttccatgatgctgggctcggggatgcccgaactgcagtccttcgacgacatcgct
tatatccgcaagaccctggcgctagacaagacggagcaggaggccctagactactttatg
aagcagatgaacgacgcccaccacggcggctggaccaccaagatggactggatcttccac
acaatccgccagcacgccatgaactga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112230790
Entry
112230790         CDS       T05605                                 

Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit alpha isoform X1
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04012  ErbB signaling pathway
otw04068  FoxO signaling pathway
otw04070  Phosphatidylinositol signaling system
otw04140  Autophagy - animal
otw04150  mTOR signaling pathway
otw04210  Apoptosis
otw04218  Cellular senescence
otw04370  VEGF signaling pathway
otw04510  Focal adhesion
otw04620  Toll-like receptor signaling pathway
otw04625  C-type lectin receptor signaling pathway
otw04810  Regulation of actin cytoskeleton
otw04910  Insulin signaling pathway
otw04914  Progesterone-mediated oocyte maturation
otw05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    112230790
   04370 VEGF signaling pathway
    112230790
   04068 FoxO signaling pathway
    112230790
   04070 Phosphatidylinositol signaling system
    112230790
   04150 mTOR signaling pathway
    112230790
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112230790
  09143 Cell growth and death
   04210 Apoptosis
    112230790
   04218 Cellular senescence
    112230790
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112230790
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112230790
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    112230790
   04625 C-type lectin receptor signaling pathway
    112230790
  09152 Endocrine system
   04910 Insulin signaling pathway
    112230790
   04914 Progesterone-mediated oocyte maturation
    112230790
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    112230790
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112230790
Membrane trafficking [BR:otw04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    112230790
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 Laminin_I Lant_dehydr_C Mod_r BRE1 CENP-Q PI_PP_I Bap31_Bap29_C
Other DBs
NCBI-GeneID: 112230790
NCBI-ProteinID: XP_024252851
LinkDB
Position
33
AA seq 460 aa
MCNNAVSETWEDLEDSCLRPEFDVDSEPLFYLEMDAPALPPKPPKPTAPAVTNNGMNNNM
ALQDGEWYWGDISREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLRKGGNNKLIKIFHR
DGKYGFSDPLTFNSVVELINHYRNESLAQYNPKLDVKLQFPVSKHQQDQVVKEDNIEAVG
KKLHEYHQQYQEKNREYDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFEEQCQTQERYSK
EYIEKFRREGNDKEIQRIMGNYEKLKSRISEIVDSKRRLEEDLKKQAADYREIDKRMNSI
KPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLEIKNENTEDQYSMVDDDEDLPHHDERSW
KLGNINRLQAEALLRGKRDGTFLVRDSSKAGCYACSVVVEGEVKHCVINKTPSGFGFAEP
YNLYNSLKELVLHYQHTSLVQHNDSLNVTLAHPVYAQQKR
NT seq 1383 nt   +upstreamnt  +downstreamnt
atgtgcaacaatgctgtctctgaaacatgggaggatttggaggactcttgtctgagaccc
gagtttgacgtcgattctgaacctttattttacctagagatggacgctccagccctacct
cccaagccgcccaaacccacagcccctgctgtcactaacaacggtatgaacaacaacatg
gcgctgcaggacggcgaatggtactggggagacatctcccgcgaggaggtcaacgagaag
ctgagggacacggccgacggtacgttcttggtccgtgatgcctccaccaagatgcacggc
gactacacgctcacgttgagaaaagggggtaacaataagctgatcaagatattccatcgg
gatgggaaatatggcttctctgaccccctgaccttcaactcagtggtggagctcatcaac
cactaccgcaacgagtcgctggcccaatacaaccccaagctagacgtcaagctgcagttc
cccgtctccaaacaccagcaggatcaggtggtgaaggaggacaacatcgaggctgtgggg
aagaagctccatgagtaccaccagcagtaccaggagaaaaaccgagagtacgaccgcctc
tacgaggagtacaccaggacgtcccaggaaatccaaatgaagaggacagcgatcgaagcc
ttcaacgaaaccatcaagatcttcgaggagcagtgccaaacgcaagagcggtacagcaaa
gagtacattgaaaagttcaggagggaaggcaatgacaaggaaatccagaggatcatgggc
aactatgagaagctgaagtctcgtatcagtgagatcgtggacagcaagcggcgtctggag
gaggatctgaagaagcaggccgctgactaccgagagatcgacaaacggatgaacagcatc
aagcccgacctcatccagctccgcaagaccagggatcagtacctcatgtggttgacccag
aagggtgtcaggcagaagaagctcaacgagtggctggaaatcaagaacgagaacacggaa
gatcaatactctatggtggatgacgatgaggacctcccacaccacgacgagcgctcctgg
aagctgggcaacatcaaccggctgcaggctgaggcactcctccgggggaagagagacgga
acattcctggtccgagacagcagcaaggcaggatgctacgcctgcagtgttgttgtggaa
ggtgaggtgaagcactgtgtcatcaacaagacgccctcagggtttggcttcgccgaacct
tacaacctgtacaactcactcaaagaactggtcctccactatcagcacacgtcactggtc
cagcacaatgactctctgaatgttacgttagcgcaccccgtctacgcacagcagaagcgg
tga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112232603
Entry
112232603         CDS       T05605                                 

Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform-like isoform X1
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw00562  Inositol phosphate metabolism
otw01100  Metabolic pathways
otw04012  ErbB signaling pathway
otw04068  FoxO signaling pathway
otw04070  Phosphatidylinositol signaling system
otw04140  Autophagy - animal
otw04150  mTOR signaling pathway
otw04210  Apoptosis
otw04218  Cellular senescence
otw04370  VEGF signaling pathway
otw04510  Focal adhesion
otw04620  Toll-like receptor signaling pathway
otw04625  C-type lectin receptor signaling pathway
otw04810  Regulation of actin cytoskeleton
otw04910  Insulin signaling pathway
otw04914  Progesterone-mediated oocyte maturation
otw05132  Salmonella infection
otw05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    112232603
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    112232603
   04370 VEGF signaling pathway
    112232603
   04068 FoxO signaling pathway
    112232603
   04070 Phosphatidylinositol signaling system
    112232603
   04150 mTOR signaling pathway
    112232603
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112232603
  09143 Cell growth and death
   04210 Apoptosis
    112232603
   04218 Cellular senescence
    112232603
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112232603
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112232603
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    112232603
   04625 C-type lectin receptor signaling pathway
    112232603
  09152 Endocrine system
   04910 Insulin signaling pathway
    112232603
   04914 Progesterone-mediated oocyte maturation
    112232603
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112232603
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    112232603
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112232603
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     112232603
Membrane trafficking [BR:otw04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    112232603
SSDB
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_p85B PI3K_C2 PI3K_rbd DUF4135
Other DBs
NCBI-GeneID: 112232603
NCBI-ProteinID: XP_024255489
LinkDB
Position
Unknown
AA seq 1047 aa
MPPGEYGMLGEWEKEGDHDIMMDFLLPTGIFLKFPVSRNDTIGAIKKMVWRNASSEPLYG
ALSDADAYVFTCINSTAEREELEDETRRLCDVRLFMSVLRLVAREGDRVEKLTNTQISLL
IGKGLHEFDSQKNHEVNEFRVKMRSFCEEKAQDRQRLPWYQWMEYSFSCDLEPCVSLAEP
GGIKTKGTKKIFVNVKFEASDESFMLQQEPQDLPVILMRSALKKKATVFRSVRQEKPEDY
TLQVNGRWEFIYGKYPLCQFKYIFSCLRGGQTPHLTMVHHSTVVKYQEEQGCLGSQLSKS
RSLSKPPPLPVKKQNTSSLWSIEEPFHIHLLQGYRVNADEGMKLVVQAGLFHGSELLCKV
VTSGEVNVCSEPLWDQKLVFDISVSDLPRMSRLCFALYAVIEKAKKPRSTKKKNKKADCP
LAWVNTMVFDYKDQLKTGEFLLSTWPSVPDDKGDLLNPMGTVEKNPNVDSAAGLLIHFPN
IRPHPLYYPHFDKLRDLEKNGGKVIATKVEHMKLKEIVDNKNYTEFFEDEKELLWKLRGV
VRERYPESLSKLLLITKWNKHEDVAQMVTFLQKWPDLPALHALELLDYSFPDPMVRSFTI
RCLRKLRDEELLQYLLQLVQVLKYESYLDCDLATFLLERALSNKRIGHFLFWHLRSEMHV
SSVSLRFGLILEAYCRGNIYHIKSLWKQNEALNKMKALNDFVKSGWQKTSRQQMTDDMKL
CIKQEAYMEALSYLLSPLNPSIMLSEICADRCKFMDSKMKPLWLMYKNKWVQGDTVGIIF
KNGDDLRQDMLTLQMIQLMEILWKKEGLDLRMIPYGCLSTGNKTGLIEVVKNSDTIANIQ
RNNSNSAATAAFNKDALLNWLKSKNPDRDKLDQAIEEFTLSCAGYCVATYVLGIGDRHND
NIMIKETGQLFHIDFGHFLGNFKSKFGINRERVPFILTYDFVHVIQQGRTNNSEKFERFR
ECCEQAYKILCRNGTLFVNLFAMMKAAGLPELSSFKDIQYLKDSLALGKSEEEALKNFKV
KFNEALRESWKTKVNWMMHSLAKDSRL
NT seq 3144 nt   +upstreamnt  +downstreamnt
atgcccccgggggagtatgggatgctgggcgagtgggagaaggagggggaccatgacatc
atgatggacttcctgctgcccaccgggatcttcctgaaattccctgtgtctcgcaatgac
accatcggggccatcaaaaaaatggtgtggaggaacgctagcagcgagcccttgtatgga
gcgctgagcgacgcggacgcttacgtgttcacctgtatcaactcgacagcagagcgtgag
gagctagaagacgagacccgtcgtctgtgtgatgtccggctcttcatgtctgtcctgagg
ctggtggcccgggagggtgaccgtgtggagaagctcaccaacacccagatcagcctgctg
attggcaaaggtctgcacgaatttgactcccagaagaaccatgaggtgaacgagttccgg
gtgaagatgcggtccttctgtgaagagaaggcccaggaccgccagcggttgccatggtac
cagtggatggagtacagcttctcgtgtgatctagagccatgtgtttccctggcagagcct
gggggcatcaagacaaaaggcactaagaagatctttgtcaatgtcaagtttgaggccagc
gatgaaagctttatgcttcagcaggagccccaggacctgccggtgatcttaatgcggagt
gccctaaagaagaaggccactgtgtttcgctcagtgcgacaggagaagccagaggactac
actttacaggtcaatgggaggtgggaattcatatacgggaaataccccctgtgccagttc
aaatacatcttctcctgtttgagagggggtcaaaccccccacctgaccatggttcatcac
tccaccgttgtcaaataccaggaggagcagggctgcctgggcagccagctgtccaagagt
cgctccttgtctaagcccccccctctacccgtgaagaagcagaacacgtcgtctttgtgg
tccattgaggagcctttccacattcacttgctacaaggctaccgagtcaatgcagatgaa
ggaatgaagctggtcgtccaggcaggtctgttccacggcagtgagctgctgtgtaaggta
gtgaccagcggtgaggttaacgtgtgctccgagcccttgtgggaccagaagctggtgttt
gacatcagcgtgagcgacctgcctcgtatgagccgcctgtgctttgctctctacgccgtc
atcgagaaggccaagaagccccgctccaccaaaaagaagaacaagaaagctgactgtcca
ctagcctgggtaaacaccatggtgtttgactataaggatcagctgaagactggggagttc
cttctctccacctggccttcagtccctgatgataaaggcgacctcttgaatccaatgggc
acagtggagaaaaatcccaacgttgatagtgcagcaggactcctcattcacttccccaat
atccgacctcaccctctctactacccccatttcgacaagttgagggacctagaaaaaaat
ggagggaaggttatagccaccaaggtagagcatatgaagctaaaggaaatagtagacaat
aagaactacacagagttctttgaggacgagaaagagcttctgtggaagctacgcggtgtg
gtgcgggagcgctacccagagagtctgtccaaacttctcctcatcacaaaatggaataag
cacgaggatgtagcacagatggtgacatttctgcagaaatggccggacctccctgctctc
catgccctggagctgctggactacagtttccctgacccaatggtccgttccttcacaatc
agatgcctaaggaagctgagagatgaggagctgctccagtacttgctgcagttggttcag
gttctgaagtatgagtcttacctggactgtgaccttgctacttttctgctagagagagcc
ctctccaacaagaggataggtcacttcctcttctggcatctcaggtcagaaatgcacgta
tcctcggtcagtctgcgtttcggcctgattctagaggcttactgcaggggcaacatctat
cacatcaagagcttatggaaacagaacgaggctctgaacaagatgaaggctctgaatgac
tttgtgaagtcgggctggcagaagacatcgcgccagcagatgacagatgacatgaagctg
tgtatcaaacaggaggcctacatggaggccctctcatatctgctgtccccgctcaatccc
agcatcatgctctcagagatttgtgcggacagatgcaagttcatggactccaagatgaag
cccctgtggctcatgtacaagaacaaatgggtgcagggggacactgtgggcataatcttc
aagaacggagatgatctccgacaagacatgttgaccctccaaatgatccagctgatggaa
atcctttggaagaaagagggactagatctaaggatgatcccctacggctgcctctccacc
gggaacaagacaggcctcattgaggtggtgaaaaactcagacaccatcgccaacatccag
cgcaacaacagcaacagtgccgcgactgctgctttcaacaaagacgccctgctcaactgg
cttaaatccaagaacccagacagggataaacttgaccaggccattgaggagttcacacta
tcatgtgctggttactgtgtagccacttacgtgttgggtatcggagatcgccacaacgac
aatatcatgatcaaggagactgggcagctgttccacattgactttgggcactttctggga
aacttcaagagcaaatttgggatcaacagggaacgtgtgccttttattctgacgtacgac
tttgtccacgtcatccaacaagggaggaccaacaacagtgagaagtttgaaaggttcaga
gagtgctgtgagcaggcctataagatcttgtgtcgcaatgggactctgtttgttaacctg
tttgccatgatgaaagcagccggactgcctgagctgagctccttcaaggacatccagtac
ctaaaggactcattggctttggggaaatcggaggaagaagcgctgaagaatttcaaagtc
aagtttaacgaagctctgagagagagctggaagaccaaggtgaactggatgatgcactct
cttgccaaagatagcagactttga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112244626
Entry
112244626         CDS       T05605                                 

Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit gamma-like
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04012  ErbB signaling pathway
otw04068  FoxO signaling pathway
otw04070  Phosphatidylinositol signaling system
otw04140  Autophagy - animal
otw04150  mTOR signaling pathway
otw04210  Apoptosis
otw04218  Cellular senescence
otw04370  VEGF signaling pathway
otw04510  Focal adhesion
otw04620  Toll-like receptor signaling pathway
otw04625  C-type lectin receptor signaling pathway
otw04810  Regulation of actin cytoskeleton
otw04910  Insulin signaling pathway
otw04914  Progesterone-mediated oocyte maturation
otw05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    112244626
   04370 VEGF signaling pathway
    112244626
   04068 FoxO signaling pathway
    112244626
   04070 Phosphatidylinositol signaling system
    112244626
   04150 mTOR signaling pathway
    112244626
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112244626
  09143 Cell growth and death
   04210 Apoptosis
    112244626
   04218 Cellular senescence
    112244626
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112244626
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112244626
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    112244626
   04625 C-type lectin receptor signaling pathway
    112244626
  09152 Endocrine system
   04910 Insulin signaling pathway
    112244626
   04914 Progesterone-mediated oocyte maturation
    112244626
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    112244626
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112244626
Membrane trafficking [BR:otw04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    112244626
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_9 SH3_1 V_ATPase_I
Other DBs
NCBI-GeneID: 112244626
NCBI-ProteinID: XP_024268122
LinkDB
Position
Unknown
AA seq 728 aa
MAVEGFQYRALYLYTKDLEEDVDLQPGDILTVSKASLLSLNFKEGDEERPELLGWLLGFN
ERTKQRGDFPGTYVQFVGYVRMSPPSSQPRSQRILPAAPGPELSQQAVSLLDLTEQFTPP
ETAPPTLVNLVEAIEKKGLDCKTLYRTRLASASDGLTQSQREEVESGPGSDVGAVSECLL
RYLRELPSPVIPPGVYPDLQAVLQQGAADWSKAVAASSSGGRELSLVLERATSMSLHHHL
TLHYLLTHLGKVIQTSHLNGLDLHTLGLVFGPLLIRHSSATGWEVGEEFPALALERLLME
MAIGQEVPHPALPAMPVKVKDTTPAMTESSILSDSEWYWGEISREEVNEKMRDTPDGTFM
VRDASSKLEGEYTLTLRKGGNNKLIKVCHREGRYGFSEPLTFITVVELINHYRHESLAQY
NAKLDTRLLYPVSKFQQEQLVKEDSTEAVGEQLKVYHEQYQEKSWEYDVLYEEYTRTSQE
LQMKRTAIEAFNETIKIFEEQCETQERYSKETIEKFRREGNDKEIQKIQSNSERLKSRVT
EIHDSKRKLEQDLKQQATDNREIDKRMNSLKPDLMQLRKIRDQYLVWLTQKGTRQKKINE
WLGIKNEAEDSYWLVEEDEGSPHHDDGTWYMGDIKRTQAEELLRDKCDGTFLIRESQTQK
GSYACSVVVDGDTKHCVIYKTDKGYGFAEPYNLYGSLKDLVLHYKHESLVQHNDQLNVTL
AYPVLTQT
NT seq 2187 nt   +upstreamnt  +downstreamnt
atggcggtcgagggttttcagtaccgtgccctctacttgtacaccaaggacttggaggaa
gatgttgatctgcagcccggggacattctgaccgtcagcaaggcctccctactctccctg
aacttcaaggagggggacgaggagcgtcccgagctcctaggctggctgctgggcttcaac
gagcggaccaaacagaggggggacttcccggggacatacgttcagtttgtgggctacgtg
aggatgtcaccgccatccagtcagcctcgctcccaaagaatcctcccagcagccccaggg
cctgagctgtcacagcaagctgtttctcttctggatttgactgagcagttcacaccgcca
gaaactgctccccctaccctggtgaacctagtggaggccattgagaagaaaggtctggac
tgcaagacattgtacaggacacgtctcgcatctgcctcagatggcctaacacagagtcag
agagaggaggtggagtcggggcctggtagtgacgtgggcgccgtgtcggagtgtttactc
cgctacctgcgggagctgccgtcccccgtcatcccccccggtgtttacccagacctgcag
gctgtgctgcagcagggcgccgcggactggtccaaggctgtggcggcgagcagcagtgga
ggcagggagctgagcctggtcctggagagggccaccagcatgtccctgcatcaccacctc
accctgcactacctgctcacacacctgggtaaggtgatccagacctcccatcttaatggc
ctggaccttcacaccctgggtctggtcttcgggccgctgctgatccggcacagctctgcc
actgggtgggaggtgggggaggagttccctgcactggcactggagaggcttctgatggag
atggccataggacaggaagtcccgcacccagctctaccagccatgccagtaaaggtcaaa
gatacaactccagccatgactgagagcagcatactgagtgattcggagtggtactggggt
gaaatctccagggaggaagtgaatgagaagatgagagacacccctgacgggacgttcatg
gtccgtgacgcctccagcaaactggagggagagtacacactgaccctcaggaaaggcgga
aacaacaagctgatcaaggtctgccaccgggaaggtcgctatggcttctcagagcctctc
acctttatcacggtggtggagctcatcaaccactaccgccatgagtccctggcccagtac
aacgccaagctggacacccggctcctctaccccgtctccaaattccagcaggagcagctg
gtgaaggaggacagcactgaggcggtgggcgagcagctgaaggtgtaccacgagcagtac
caggagaagagctgggagtacgacgtgctctacgaggagtacacacgtacctcacaggag
ctccagatgaagcgcacagccatcgaggccttcaacgagaccatcaagatcttcgaagag
cagtgtgagactcaggagcgctacagcaaagagaccatcgagaagttccgacgtgaaggc
aacgacaaagagatccagaagatccagagcaactcggagcgtctgaagtctcgggtgaca
gagatccacgacagcaagaggaagctggagcaggacctgaaacagcaggcaaccgacaac
agagagattgacaagaggatgaacagcctgaaaccagacctcatgcagctaaggaagatc
agggaccagtacctggtgtggttgacacagaaggggaccaggcagaagaagattaatgaa
tggctgggcataaagaatgaggcagaagactcctactggctggtggaggaggacgaaggc
tcgccccaccacgacgacggcacctggtacatgggcgacatcaagcgcacccaggcagag
gagctgctgagggacaagtgtgacggcaccttcctcatccgagagagccagacgcagaag
ggctcctatgcctgctctgtagttgtggacggcgacaccaaacactgcgtcatctacaag
acggacaaaggctatggcttcgccgagccctacaacctttacggctccctgaaggacctg
gtgctccactacaagcacgagtccctggtccaacacaacgaccagctgaatgtaaccctg
gcctacccggtcctcacccagacctag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112248937
Entry
112248937         CDS       T05605                                 

Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit alpha-like
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04012  ErbB signaling pathway
otw04068  FoxO signaling pathway
otw04070  Phosphatidylinositol signaling system
otw04140  Autophagy - animal
otw04150  mTOR signaling pathway
otw04210  Apoptosis
otw04218  Cellular senescence
otw04370  VEGF signaling pathway
otw04510  Focal adhesion
otw04620  Toll-like receptor signaling pathway
otw04625  C-type lectin receptor signaling pathway
otw04810  Regulation of actin cytoskeleton
otw04910  Insulin signaling pathway
otw04914  Progesterone-mediated oocyte maturation
otw05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    112248937
   04370 VEGF signaling pathway
    112248937
   04068 FoxO signaling pathway
    112248937
   04070 Phosphatidylinositol signaling system
    112248937
   04150 mTOR signaling pathway
    112248937
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112248937
  09143 Cell growth and death
   04210 Apoptosis
    112248937
   04218 Cellular senescence
    112248937
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112248937
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112248937
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    112248937
   04625 C-type lectin receptor signaling pathway
    112248937
  09152 Endocrine system
   04910 Insulin signaling pathway
    112248937
   04914 Progesterone-mediated oocyte maturation
    112248937
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    112248937
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112248937
Membrane trafficking [BR:otw04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    112248937
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP AAA_13 SH3_1 SH3_9 SH3_2 Transcrip_act Laminin_I V_ATPase_I Bap31_Bap29_C
Other DBs
NCBI-GeneID: 112248937
NCBI-ProteinID: XP_024274170
LinkDB
Position
4
AA seq 721 aa
MTSEGYQYRALYDYKKEREEDIDLHVGDILVVSKGALLALGCPNWAEEKPDEIGWLPGFN
ETTHEKGDFPGTYVEFVGRKIISPPTPKPRPPRPLPSTSDLARTDSESEGFMLPDLPEQF
APPETASPILVKLLEAIEGKGLECPTLYRTFTAACGLDMRQFTDCDLEPLDLQSLCDGLW
RYLQDLPNPVVPTSLQSEMIHAAQEVKDPKDCAQLLRRIASSSNHPPQYCLTFYCLIKHF
CRISQNTSKNQLCVRDLAEIFSPVLFRLQPASCEASLDSLIKILEILVNSELSETQAAPA
LPPKPPKATTPVPNNGFNNNMALQDGEWYWGDISREEVNEKLRDTADGTFLVRDASTKMH
GDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFNSVVELINHYRHESLAQYNPKLDVRLL
YPVSRLQQDQVVKEDNIEAVGKRLQEYHLQFQEKNREYDRLYEEYTRTSQEIQMKRTAIE
AFNETIKIFEEQCQTQERYSKEYIEKFRREGNDKEIQRIMGNYDKLKSRISEIVDSKRHL
EDDLKKQAADYREIDKKMNSIKPDLIQLRKTRDHYLMWLTQKGVRQKKLNEWLGIKNENP
EDEYSMVEDDEDLPHHDERSWRLGNINRLQAEALLRGKKDGTFLVRDSSKAGCYACSVVV
EGEVKHCVINKSHTGYGFAEPYNLYGSLKELVLHYHHTSLVQHNDSLNVTLAYPVYTQKR
R
NT seq 2166 nt   +upstreamnt  +downstreamnt
atgacttcggaaggataccagtacagagcactgtatgactataaaaaggagagggaggag
gacattgatttgcatgtaggcgatatacttgtggtgagcaagggtgctctgctggcccta
ggctgccctaattgggctgaagaaaaaccagatgagattgggtggctgccaggattcaat
gagacaactcatgaaaaaggtgactttcccgggacttacgttgagtttgtgggaagaaaa
ataatttcaccaccaacaccaaaaccaaggccacctaggcctcttccttccacatcagat
ctagccaggacagattcagaatcagagggcttcatgttgccagatctgccagaacagttt
gctcctccagagactgcatcacctatcctggtcaagcttctggaggcaatagaaggcaaa
ggtttggaatgtccaaccctttatagaactttcacagcagcttgtgggctggatatgaga
cagttcactgactgtgatttggagcctttggacctacagtcgctatgtgatggcctttgg
agatacctgcaggatttgcctaatccagttgttcccacctctctccaaagtgagatgatt
catgcagcacaggaggtaaaggatccaaaggactgtgcccagttgttgcgcagaatagcc
agctcatctaaccatccgccccaatactgcctcacgttctactgcctcatcaaacatttc
tgccggatttctcagaacaccagcaaaaaccaactctgcgtcagagacttggcggaaatc
tttagccctgtgcttttcaggcttcaaccagcaagctgtgaggccagcctggattccctt
atcaagattctagagatcttggtcaacagtgaattgagtgaaacccaggctgctccagct
ttgcccccgaaaccaccaaaggccactaccccagttccaaacaacgggttcaacaacaac
atggccttgcaagacggggagtggtactggggagacatctcaagggaggaggtgaatgag
aagctgagagacacagctgatggtacgtttctggtccgagatgcatccaccaaaatgcat
ggagactacacactgactctgaggaaaggagggaataacaaactgatcaaaatattccat
cgggatgggaaatacggcttctcggacccactgacattcaactcggtggttgagctcatc
aatcactacagacacgagtccttagcccagtacaacccaaagctggacgtgagactgctg
tacccagtgtcaaggctccagcaggaccaggttgttaaagaggacaacattgaagctgtc
ggtaaaaggctgcaggagtaccaccttcagttccaggagaagaaccgagagtacgatcgt
ctgtacgaggagtatacaagaacatcacaggaaattcaaatgaagagaacggccattgag
gcattcaatgaaaccattaagatctttgaggagcagtgccaaacccaagagcgctatagc
aaggagtacattgaaaagttcaggagagagggtaacgataaagaaatccagagaatcatg
ggaaactacgacaaactgaaatcgagaataagtgagattgtggacagtaaacggcacctg
gaggacgatctgaaaaagcaagcagcggattacagggagatagataagaagatgaacagc
atcaaacctgatctgattcagctccgcaagaccagagaccattacctaatgtggctgaca
caaaagggagtgaggcagaagaagctgaatgaatggttgggtatcaagaatgaaaaccca
gaggatgagtactcaatggttgaagatgacgaggacctcccacatcatgatgaacgttcg
tggaggctaggcaacatcaaccggctgcaggcagaagctctgctccgagggaagaaggac
ggaacattcctggtccgggacagtagcaaagctggctgctacgcctgcagtgttgttgtt
gagggtgaggtgaagcattgtgttatcaacaagagtcatacgggctatggatttgcagag
ccgtataacctgtatggctccctaaaagaactagtcctgcattaccaccacacgtcactc
gtacagcacaatgattctttaaatgtcacgctcgcctacccagtttacacacagaagagg
cggtga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112250738
Entry
112250738         CDS       T05605                                 

Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit gamma-like
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04012  ErbB signaling pathway
otw04068  FoxO signaling pathway
otw04070  Phosphatidylinositol signaling system
otw04140  Autophagy - animal
otw04150  mTOR signaling pathway
otw04210  Apoptosis
otw04218  Cellular senescence
otw04370  VEGF signaling pathway
otw04510  Focal adhesion
otw04620  Toll-like receptor signaling pathway
otw04625  C-type lectin receptor signaling pathway
otw04810  Regulation of actin cytoskeleton
otw04910  Insulin signaling pathway
otw04914  Progesterone-mediated oocyte maturation
otw05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    112250738
   04370 VEGF signaling pathway
    112250738
   04068 FoxO signaling pathway
    112250738
   04070 Phosphatidylinositol signaling system
    112250738
   04150 mTOR signaling pathway
    112250738
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112250738
  09143 Cell growth and death
   04210 Apoptosis
    112250738
   04218 Cellular senescence
    112250738
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112250738
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112250738
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    112250738
   04625 C-type lectin receptor signaling pathway
    112250738
  09152 Endocrine system
   04910 Insulin signaling pathway
    112250738
   04914 Progesterone-mediated oocyte maturation
    112250738
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    112250738
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112250738
Membrane trafficking [BR:otw04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    112250738
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP Biopterin_H PI_PP_I
Other DBs
NCBI-GeneID: 112250738
NCBI-ProteinID: XP_024276904
LinkDB
Position
5
AA seq 565 aa
MGQYDTQALSETLMGFLQDLPSPVIPKSIYPSLKTTLQEEEELSVGEIGRRLLKALEPPA
VPLPSLHYLLRHLDRVGQGLAHNGQSSAHNGLDPHTLAFLFSPLLLTTGSEEGHQVQVLE
RLLVARAWELDQMSSALPSKPSKTKAMASSVVNGDGSKMADAEWYWGDISRDEVNDKMRD
TPDGTFLVRDASSKVQGEYTLTLRKGGNNQLIKIFHQGGKYGFSEPLTFASVVELILYYH
HESLAQYNPKLDSRLLYPISKYPQDQVVTGDSVEAVGEQLKVYHEHCQETSREYDVLYEE
YTRTSQELQMNRTAIEAFNETIKISEEQCETQEGYSKENIDQFLREGNSKDTERIQSNWD
KLKSRVTEIHDRKRKLGQDLKEHAMDNREIDKKMSSLNTDLVQLKKIRDQYLLWLNQKGT
RQKKINEWLGIKNDMEGSSPLPPSLYSLVDEEEDLPHLDERTWYVGDITRSQAEELLRGK
GDGTFLIRDSQSQKGSYACSVVVDGDIKHCVIFKTSTGYGFAEPYDLYSSLRELVLHYRH
TSLVQHNDLLNVTLACPVLTQQQPR
NT seq 1698 nt   +upstreamnt  +downstreamnt
atgggccagtacgacacccaggctctctcagagaccctgatgggattcctgcaggacctg
ccatcccctgtcatcccaaagtctatctatcccagcctgaagactaccctgcaagaggaa
gaagagttgtccgtcggagagataggcaggcgtttgctgaaggctctggagcccccggct
gtgcccctgccgagcctgcattacctgctcagacacctggaccgagtgggccagggcttg
gcccacaacggccagagctcggcccacaacggcctggacccccacaccctcgcattcctc
ttcagccctcttctgctcaccactgggtcagaagaaggtcatcaggttcaggtgctagag
aggctgctggtggcaagggcctgggagctggaccagatgtcatcagccctaccttccaag
ccttccaaaaccaaagccatggcatcttctgtcgtcaatggggatggcagcaagatggct
gatgcagagtggtactggggagacatttccagagatgaggtgaatgacaagatgagagac
acaccagatggcactttcttggtccgagatgcctcaagcaaggtgcaaggagaatataca
ttgactctcaggaaaggaggaaacaaccagctgatcaagatcttccaccaaggaggcaag
tatggcttctctgagccgctgacctttgcttctgtggtggaactcatcctgtattatcac
catgagtcgctggcccagtacaaccccaagctggactcacggctactgtacccaatctcc
aaatatccgcaggatcaggtggtgacaggggacagcgtggaagcagtaggagagcaactg
aaggtgtaccacgaacattgccaggagacgagccgggaatatgacgtcttatatgaagag
tatactcgcacctctcaggagttacagatgaaccgcacggccatcgaggccttcaacgag
accatcaagatctccgaggagcagtgcgagacccaagaaggctatagcaaggagaacatt
gaccagttcctcagggagggaaacagcaaagatactgagagaatccaaagtaattgggat
aagctgaagtcgcgggtgactgagatccatgacaggaagaggaagctagggcaggacctg
aaggagcatgcgatggacaaccgagagatcgataagaagatgagtagcctgaatacggac
ctcgtgcagctgaaaaagattagagaccagtacctgttgtggctcaatcagaagggcacc
agacagaagaagattaacgagtggctggggatcaaaaatgacatggaaggttcttcccct
ctacctcccagcctgtattctctggtggatgaggaggaagacctgccgcacctcgacgag
cgcacttggtacgtgggcgacatcacgcgcagccaagccgaggagttgctgaggggaaag
ggtgacggcactttcctgatccgagacagccagtcccagaagggctcctacgcctgctct
gtagttgtggacggggacatcaagcactgtgtgatattcaagacctccacgggctacggc
tttgctgagccctacgacctatacagctccctgagagagctggtgcttcactatagacac
acctccctggtccagcacaatgacttgctgaatgtaactctggcatgtcctgtcctaacc
cagcagcaacccagatga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112250879
Entry
112250879         CDS       T05605                                 

Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit gamma
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04012  ErbB signaling pathway
otw04068  FoxO signaling pathway
otw04070  Phosphatidylinositol signaling system
otw04140  Autophagy - animal
otw04150  mTOR signaling pathway
otw04210  Apoptosis
otw04218  Cellular senescence
otw04370  VEGF signaling pathway
otw04510  Focal adhesion
otw04620  Toll-like receptor signaling pathway
otw04625  C-type lectin receptor signaling pathway
otw04810  Regulation of actin cytoskeleton
otw04910  Insulin signaling pathway
otw04914  Progesterone-mediated oocyte maturation
otw05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    112250879
   04370 VEGF signaling pathway
    112250879
   04068 FoxO signaling pathway
    112250879
   04070 Phosphatidylinositol signaling system
    112250879
   04150 mTOR signaling pathway
    112250879
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112250879
  09143 Cell growth and death
   04210 Apoptosis
    112250879
   04218 Cellular senescence
    112250879
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112250879
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112250879
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    112250879
   04625 C-type lectin receptor signaling pathway
    112250879
  09152 Endocrine system
   04910 Insulin signaling pathway
    112250879
   04914 Progesterone-mediated oocyte maturation
    112250879
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    112250879
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112250879
Membrane trafficking [BR:otw04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    112250879
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 DUF5638 Bap31_Bap29_C OB_RNB Mod_r Transcrip_act
Other DBs
NCBI-GeneID: 112250879
NCBI-ProteinID: XP_024277163
LinkDB
Position
1
AA seq 311 aa
MYPISRYQQDQLVKEDNIDAVGKKLQEYHNQYQEKSKEYDRLYEEYTKTSQEIQMKSTAI
EAFNETIKIFEEQCHTQERYSKEYIERFRREGNDKEIERIMMNYEKLKSRLGEIHDSKIR
LEQDLKTQALDNRETDKKMNSLKPDLIQLRKIRDQYLVWLNHKGVRQKRINDWLGIKNEN
TDEGYFVSTEEDENLPHYDEKSWFVGDLNRTQSEDLLLGKPDGAFLIRESSKKGCYACSV
VVEGEVKHCVIYSTQRGYGFAEPYNLYSSLKDLVLHYHQTSLVQHNDSLNVRLAYPVYAQ
MPSSSGPAPRR
NT seq 936 nt   +upstreamnt  +downstreamnt
atgtaccccatctcacgctaccagcaggatcagctggtgaaagaggacaacattgacgcg
gtggggaagaagctccaggagtaccacaatcaataccaggagaagagcaaggagtacgac
cggctttatgaggaatacaccaagacctcacaggagattcagatgaagagyacggccatc
gaggccttcaacgagaccatcaagatcttcgaggagcagtgtcacacgcaggagcgctac
agcaaagagtacatcgagcgcttccgccgggagggcaacgacaaggagatcgagaggatc
atgatgaactatgagaagcttaagtctcgtctaggggagatccacgacagtaagattcgt
ctggagcaggacctgaagacccaggcgctggacaaccgagagacggacaagaagatgaac
agcctcaaacctgacctcatccagctccgcaagatcagggaccagtaccttgtctggctc
aatcacaaaggagttcgacagaaacgaattaacgactggctggggatcaagaacgagaac
acagatgaagggtactttgtgagtacggaggaggatgaaaacctgccccactatgatgag
aagagctggtttgtaggagacctgaacagaacccagtctgaagaccttctactaggcaaa
cctgacggagccttcctcatcagggagagcagcaagaagggctgctacgcatgctccgta
gttgtggagggtgaggttaagcactgtgtgatttacagcacgcagaggggctacggcttc
gctgagccttacaacctgtacagctctctgaaagacctggtcctgcactaccaccagacc
tcccttgtccagcacaacgactcgctcaatgtgcgcctggcctaccctgtctacgcacag
atgccctcatcctccggccctgccccacggagatga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112251044
Entry
112251044         CDS       T05605                                 

Gene name
pik3ca
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform isoform X1
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw00562  Inositol phosphate metabolism
otw01100  Metabolic pathways
otw04012  ErbB signaling pathway
otw04068  FoxO signaling pathway
otw04070  Phosphatidylinositol signaling system
otw04140  Autophagy - animal
otw04150  mTOR signaling pathway
otw04210  Apoptosis
otw04218  Cellular senescence
otw04370  VEGF signaling pathway
otw04510  Focal adhesion
otw04620  Toll-like receptor signaling pathway
otw04625  C-type lectin receptor signaling pathway
otw04810  Regulation of actin cytoskeleton
otw04910  Insulin signaling pathway
otw04914  Progesterone-mediated oocyte maturation
otw05132  Salmonella infection
otw05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    112251044 (pik3ca)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    112251044 (pik3ca)
   04370 VEGF signaling pathway
    112251044 (pik3ca)
   04068 FoxO signaling pathway
    112251044 (pik3ca)
   04070 Phosphatidylinositol signaling system
    112251044 (pik3ca)
   04150 mTOR signaling pathway
    112251044 (pik3ca)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112251044 (pik3ca)
  09143 Cell growth and death
   04210 Apoptosis
    112251044 (pik3ca)
   04218 Cellular senescence
    112251044 (pik3ca)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112251044 (pik3ca)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112251044 (pik3ca)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    112251044 (pik3ca)
   04625 C-type lectin receptor signaling pathway
    112251044 (pik3ca)
  09152 Endocrine system
   04910 Insulin signaling pathway
    112251044 (pik3ca)
   04914 Progesterone-mediated oocyte maturation
    112251044 (pik3ca)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112251044 (pik3ca)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    112251044 (pik3ca)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112251044 (pik3ca)
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     112251044 (pik3ca)
Membrane trafficking [BR:otw04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    112251044 (pik3ca)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_C2 PI3K_p85B DUF2321 C2 Ribosomal_S15
Other DBs
NCBI-GeneID: 112251044
NCBI-ProteinID: XP_024277466
LinkDB
Position
5
AA seq 1068 aa
MPPRPSSGELWGIHLMPPRIFVDCLLPNGMILTLECLREATLITIKHEVFKEARKYPLHH
LLQEETSYIFVSVTQEAEREEFYDETRRLCDLRLFQPFLKVIEPVGNREEKILNREIGFA
IGMPVCEFDLVKDPEVQDFRRNILNVCKDSVELRDANGPHSRALYVYPPNVESTQELPKH
IHGKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLSPEQLK
MCVQEYQGKYILKVCGCDEYLLEKCPLSQYKYVRSCIMLGRMPNLMLMAKDSLYSQLPMD
NFTMPSYARRISTATPYMNGESSTKSLWTINGTLRIRVLCATYVNVNIRDIDKIYVRTGI
YHGGEQMCDNVNTQRVPCSNPRWNEWLTYDMYIPDIPRAARLCLSICSVKGRKGAKEEHC
PLAWGNVNLFDYTHTLVSGKMALNLWPVPHGLEDLLNPIGVTGSNPNRETPCLELEFDYF
SSPVKFPDMTTVEGHANWTISRELGFSYCQSGQSNRVARDHALTDSDNEQLRQVCNRDPL
SEITEQEKDFLWRHRHYCVNIPEILPKILLAVKWNSRDEVAQMYCLLKDWPAIKPEQAME
LLDCNYPDPMIRDFAVRCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNPLVRFLLKKALTN
QRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLSRQVEAMEKLINLTDILK
QEKKDETQKVQMKFLVEQMRRPDYMDALQNFTSPLNPAHQLGNIRLEECRIMSSAKRPLW
LNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCMS
LGDCVGLIEVVRSSHTIMQIQCKGGLKGALQFNSSTLHQWLKDKNKGEMYDLAVDLFTRS
CAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDF
LIVISKGTQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIA
YIRKTLALDKTEQEALDYFMKQMNDAHHGGWTTKMDWIFHTIRQHALN
NT seq 3207 nt   +upstreamnt  +downstreamnt
atgcctcctagaccttcttctggtgaattatggggcatccatttgatgcccccccggatc
tttgtggactgcttgttgccaaacgggatgatcctgaccctcgagtgcctccgtgaggct
acgctcatcaccatcaaacatgaagtgttcaaggaggccaggaagtaccccctgcatcac
ctactacaggaggagacctcttacatatttgtcagtgttacgcaggaggcagagcgagag
gagttctacgatgaaactaggagactatgtgatctcaggctctttcagccttttctgaag
gtcattgaaccggttggtaaccgagaggagaaaattctgaacagagaaattggattcgca
attggtatgcctgtttgcgagtttgacttagtaaaggaccctgaggtgcaggacttcagg
aggaatattcttaacgtctgtaaggattcagtagaactcagagatgccaatggaccccat
agtcgggctttatatgtctaccctcccaatgttgaatcgacacaagaacttccaaagcac
atccatggcaaactggacaaaggtcaaatcattgtagtgatctgggtgattgtctcaccc
aacaatgacaagcagaaatacaccctgaagatcaaccatgattgtgtgccagaacaggtg
atagctgaggccatcaggaagaagaccaggagcatgctgttgtcccctgaacaactcaag
atgtgtgtgcaggagtaccagggcaagtacatcctcaaggtgtgcggctgtgacgagtac
ctcctggagaaatgccccctgagtcaatataagtatgtgaggagttgcatcatgcttggc
aggatgcccaacctcatgctgatggcgaaggatagcctttattctcagttacccatggac
aacttcaccatgccctcgtacgcccggcgcatctccaccgccaccccgtacatgaacgga
gagtcctccaccaagtctctgtggaccatcaacggaaccctgcggatacgagtgctctgt
gccacatacgtgaatgtgaacattcgggatatagataagatttatgtgcgaaccggcatc
taccatggaggggagcagatgtgtgacaacgtgaacacgcagcgtgtgccctgctctaat
cccaggtggaacgagtggctgacctacgacatgtacattcccgacatcccccgggcggcc
cgcctctgtctctccatctgctctgtgaaaggcaggaaaggggcgaaggaggagcactgt
ccactggcgtgggggaacgtcaacctgtttgactacactcacaccctggtctctggtaaa
atggctctgaacctgtggcctgtacctcacggcctggaggacctactcaaccccatcgga
gtcacaggctccaaccccaacagggaaactccttgtctagagctggagtttgactacttc
agcagtcctgtcaagttcccagacatgaccaccgtggagggacatgctaactggaccata
tccagggagctaggtttcagctactgccagtcaggccagagtaacagagtggcacgagac
cacgccttaacggacagtgataacgagcagctgagacaggtgtgcaaccgagaccccctg
tctgagatcacagagcaggagaaggacttcctctggaggcacaggcactactgtgtaaat
atacccgaaatcctgcccaagatcctgctggctgtgaagtggaactccagagatgaagta
gcacagatgtattgccttctaaaggattggccagcaataaaaccagagcaagccatggag
ctgctggattgtaactatccagacccaatgatccgtgactttgctgttcggtgccttgag
aagtacttgaccgatgataaactctctcagtacctcattcagttggtccaggttctgaaa
tatgagcagtaccttgataacccactggtacgatttctactgaaaaaggccttgactaac
caaaggataggacacttctttttctggcacttaaagtctgagatgcacaataagacggtg
agtcagcggttcggcctgctgctggagtcctactgccgggcgtgtggcatgtacctgaag
cacctgagcagacaagtggaggccatggagaaactcatcaacctcaccgacattctcaaa
caggagaagaaggacgagactcagaaggtgcagatgaagtttctggtggagcagatgagg
aggccagactacatggacgccctgcagaattttacctcccccctcaaccctgcacaccag
ctgggaaacatacggcttgaggagtgcagaatcatgtcatctgccaaaagaccactgtgg
ctcaactgggaaaaccctgacatcatgtccgagctcctcttccagaataatgagatcata
ttcaaaaacggagacgacctgcgacaggacatgctaacacttcagatcatcagaatcatg
gagaacatttggcagaaccagggtctagacctcaggatgttgccgtacggctgcatgtct
ttaggtgactgtgtggggctgatcgaggtggtgcggagctctcacaccatcatgcagatc
cagtgtaaaggtggcttgaagggggcgctacagttcaacagctcaacactacaccagtgg
ctcaaagacaagaacaagggagagatgtatgaccttgccgttgacttgtttacacgatcc
tgtgctgggtattgcgtggcgactttcatcctaggcatcggtgacagacacaacagtaat
ataatggtgaaggatgatgggcagctttttcacatagattttggccatttcctggaccac
aagaaaaagaaatttggctacaagcgagagcgagttccgtttgtcctaactcaagacttc
ttgattgtgatcagcaaagggacccaggagtgcacgaagacaagagagtttgagagattt
caggagatgtgctataaggcctacttggccattcgtcagcatgccaacctcttcatcaac
ctgttctccatgatgctgggctccgggatgcccgagctgcagtccttcgatgacatcgcc
tacatccgtaaaaccctggccctggacaagactgagcaggaggccctggactacttcatg
aagcaaatgaacgacgcccaccatggcggctggaccaccaagatggactggattttccac
accatccgccagcacgcgcttaactaa

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112252131
Entry
112252131         CDS       T05605                                 

Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit gamma-like
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04012  ErbB signaling pathway
otw04068  FoxO signaling pathway
otw04070  Phosphatidylinositol signaling system
otw04140  Autophagy - animal
otw04150  mTOR signaling pathway
otw04210  Apoptosis
otw04218  Cellular senescence
otw04370  VEGF signaling pathway
otw04510  Focal adhesion
otw04620  Toll-like receptor signaling pathway
otw04625  C-type lectin receptor signaling pathway
otw04810  Regulation of actin cytoskeleton
otw04910  Insulin signaling pathway
otw04914  Progesterone-mediated oocyte maturation
otw05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    112252131
   04370 VEGF signaling pathway
    112252131
   04068 FoxO signaling pathway
    112252131
   04070 Phosphatidylinositol signaling system
    112252131
   04150 mTOR signaling pathway
    112252131
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112252131
  09143 Cell growth and death
   04210 Apoptosis
    112252131
   04218 Cellular senescence
    112252131
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112252131
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112252131
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    112252131
   04625 C-type lectin receptor signaling pathway
    112252131
  09152 Endocrine system
   04910 Insulin signaling pathway
    112252131
   04914 Progesterone-mediated oocyte maturation
    112252131
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    112252131
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112252131
Membrane trafficking [BR:otw04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    112252131
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_1 SH3_9 Mod_r pP_pnuc_1
Other DBs
NCBI-GeneID: 112252131
NCBI-ProteinID: XP_024278872
LinkDB
Position
6
AA seq 726 aa
MAVEGFQFIANYVYNKDWEEDLDLQPGDILTVSKTSLTSLGLKDGDEEHPDCLGWMVGVN
KRTKQRGDFPGTYVQYVGPVKMYVVPNQPLQQRPLPAAPRPQPPPAHQGTSAQEFVQPFP
PPENALPTLVKLIEAIENKGLECETLYRKSGSLAAGGHRQSLKFELSEPEMGQYDVQALS
EALMGFLQDLPFPIIPECVYPSLKIALQEEAELSVEETGKRLLKALEPPAVPLPGLLTLQ
YLLRHLDRVGQSSPHNGLDPHTLALLFSPLLLPAGSEEDCQVSAQVLERLLVVRAWELEE
MPPALPPKPSKTKAMASSVINGDGSKMADAEWYWGDISREEVNEKMRDMPDGTFLVRDAS
SKVQGEYTLTLRKGGNNKLIKIFHRGGRYGFSEPLTFSSVVELILHYHQESLAQYNPKLD
SRLLYPISKYQQDQVVKEDNVEAVGEQLKVYHEQYQEKSREYDVLYEEYTRTSQELQMKH
TAIEAFTETINIFEEQCETQERYSKEYIDKFHREGNSQEIERIQSNSDKLKSRVTEIHDS
KRKLEQDLKEQATDNREIDKKMNSLKPDLMQLRKIRDQYLVWLNQKGTRQKKINEWLGIK
NDVEDLYSLVDEMDDLPHHDERTWYVGDIKRGQAEELLRGRGDGTFLIRDSQSQKGSYAC
SVVVDGDVKHCVIFKTSTGYGFAEPYNLYSSLRELILHYRHTSLVQHNDSLNVTLAIPVL
TQQQPR
NT seq 2181 nt   +upstreamnt  +downstreamnt
atggctgtagagggcttccaattcatagcaaattatgtctataacaaagactgggaagag
gaccttgacctccagccaggggacatactgaccgtcagcaagacgtcactgacatctctt
gggctcaaggatggggacgaggagcacccggattgcctgggatggatggtgggagtcaac
aagcgcaccaagcagaggggagacttccctgggacgtatgtccagtatgtggggcctgtg
aagatgtatgtagtgcccaaccagcctctgcagcagagacccctcccagcagcccccagg
cctcagcctcccccagcacatcaagggacttcagctcaagagtttgtccagccttttcca
cccccagaaaatgccctccccactttggtaaagttgatagaggccatagagaacaaaggt
ttggagtgcgagacgctgtacaggaagtctggctccttggctgctggcggtcatagacag
agcctgaagtttgagctctcggagcctgagatgggccagtacgacgtccaggcgctctca
gaggccctgatgggattcctgcaggacttgcccttccccatcatcccagagtgtgtctat
cccagcctgaagattgccctgcaagaggaagcagagctgtctgtcgaggagacaggcaag
cgtttgctgaaggcactggagcccccagccgtgcccctgccaggcctgctcaccctgcag
tacctgctcagacacttggaccgagtgggccagagctcgccccacaatggcctggaccct
cacaccctcgcactcctcttcagccctctgctgctccccgctgggtcagaagaagattgt
caggtttctgcccaggtgctggagagactgctggtggtgagggcctgggagctggaagaa
atgccaccagccctacctcccaaaccttccaaaaccaaagccatggcatcctctgtgatc
aatggagacggcagcaagatggccgatgcagagtggtactggggagacatttccagagag
gaggtgaatgagaagatgagagacatgccggatgggactttcttggtccgagacgcctca
agcaaggtgcaaggagaatacacattgactctcagaaaaggaggaaacaacaagctgatc
aagatcttccaccgaggcggcaggtacggcttctctgagccgctgacgttttcctctgtg
gtggagctcatcctgcattatcaccaggagtcgctggcccagtacaaccccaagctggac
tcacggctactgtatcccatctccaaatatcagcaggaccaggtggtgaaagaggacaat
gtggaagcagtaggagagcaactgaaggtgtaccatgaacagtaccaggagaagagccgg
gaatatgacgtcttgtatgaagagtacactcgcacctctcaggagttacagatgaagcac
acggccatcgaggccttcaccgagaccatcaatatctttgaggagcagtgcgagacccaa
gagcgctacagcaaagagtacattgacaagttccacagggagggcaacagccaagagatt
gagagaatccaaagtaattcagataagctgaagtctcgtgtgactgagatccatgacagc
aaacggaagctggagcaggacctgaaggagcaggcgacggacaaccgagagatcgacaag
aagatgaacagtctgaaaccagacctcatgcagctgaggaagatcagagaccagtacctg
gtgtggctcaatcagaagggcaccagacagaagaagattaacgagtggcttgggatcaag
aacgacgtggaagacctatattctctggtggatgagatggatgacctgccacaccatgac
gagcgcacctggtacgtgggcgacatcaagcgaggccaggccgaagagctgctaaggggc
aggggtgacggcaccttcctgatccgagacagccagtcccagaagggctcctatgcctgc
tctgtagtcgtggacggggacgtcaagcactgtgtgatattcaagacctccacgggctac
ggtttcgccgagccttacaacctgtacagctccctgagagagctgattctccactacaga
cacacttccctggtccagcacaacgactcgctgaatgtaactctggcaattcctgtccta
acccagcagcaacccagatga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112260202
Entry
112260202         CDS       T05605                                 

Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform-like
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw00562  Inositol phosphate metabolism
otw01100  Metabolic pathways
otw04012  ErbB signaling pathway
otw04068  FoxO signaling pathway
otw04070  Phosphatidylinositol signaling system
otw04140  Autophagy - animal
otw04150  mTOR signaling pathway
otw04210  Apoptosis
otw04218  Cellular senescence
otw04370  VEGF signaling pathway
otw04510  Focal adhesion
otw04620  Toll-like receptor signaling pathway
otw04625  C-type lectin receptor signaling pathway
otw04810  Regulation of actin cytoskeleton
otw04910  Insulin signaling pathway
otw04914  Progesterone-mediated oocyte maturation
otw05132  Salmonella infection
otw05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    112260202
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    112260202
   04370 VEGF signaling pathway
    112260202
   04068 FoxO signaling pathway
    112260202
   04070 Phosphatidylinositol signaling system
    112260202
   04150 mTOR signaling pathway
    112260202
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112260202
  09143 Cell growth and death
   04210 Apoptosis
    112260202
   04218 Cellular senescence
    112260202
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112260202
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112260202
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    112260202
   04625 C-type lectin receptor signaling pathway
    112260202
  09152 Endocrine system
   04910 Insulin signaling pathway
    112260202
   04914 Progesterone-mediated oocyte maturation
    112260202
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112260202
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    112260202
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112260202
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     112260202
Membrane trafficking [BR:otw04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    112260202
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_C2 PI3K_p85B DUF2321 DUF5314 C2
Other DBs
NCBI-GeneID: 112260202
NCBI-ProteinID: XP_024290895
LinkDB
Position
10
AA seq 1068 aa
MPPRPSSGELWGMHLMPPSIMVDCLLPNGMILTLECTREATLISVKHELFKEARKYPLHH
LLQEETSYIFVSVTQEAEREEFYDETRRLCDLRLFQAFLKVIEPVGNREEKILNREIGFA
IGMPICEFDLVKDAEVQDFRRNILNVCKESVDLRDTNGPISRALYVYPPNVESSVELPKH
IFNKLDKGQIIVVIWVIVSPSNDKQKYTLKINHDCVPEHVIAEAIRKKTRSMLLSHEQLK
MCVQEYQGKYILKVCGCDEYLLEKYPLSQYKYVRSCIMLGRMPNLMLMAKDSLYSQLPID
TFTMPSYARRISTATPYMNGETATKSLWTINGTLRIRILCATYVNVNIRDIDKIYVRTGI
YHGGEQLCDNVNTQRVPCSNPRWNEWLNYDMYIPDIPRAARLCLSICSVKGRKGAKEEHC
PLAWGNINLFDYTHTLVAGKMALNLWPVPHGLEDLLNAIGVTGSNPNKETPCLELEFDHF
SNPVKFPDMPAIEEHANWNISRELGFNYCHTGLSNRLARDNPLTDSDNEQLRLVCNRDPL
SEITEQEKDFLWRHRHYCVSIPEILPKILLAVKWNSRDEVAQMYCLLKDWPAIKPEQAME
LLDCNFPDPMIRDFAVKCLEKYLTDDRLSQYLIQLVQVLKYEQYLDNPLARFLLKKALTN
QRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLSRQVEAMEKLINLTDLLK
QEKKDEAQKVQMKFLVEQMKRPDYMDALQSFTSPLNPAHQLGNLRLEECRMMSSAKRPLW
LNWENPDMMSELLFQSNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCLS
IGDCVGLIEVVRNSHTIMQIQCKGGLKGALQFNSHTLHQWLKDKNRGEMYDQAIDLFTRS
CAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDF
LIVISKGTQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIA
YIRKTLALDKTEQEALDYFMKQMNDAHHGGWTTKMDWIFHTIRQHAMN
NT seq 3207 nt   +upstreamnt  +downstreamnt
atgcctcccaggccatcttcaggggaactatggggcatgcacttgatgcccccaagcatc
atggtggactgccttctccccaatgggatgattctgacattggagtgcacacgtgaggcc
acactcatttcggtgaaacacgaactcttcaaggaggccaggaagtatccgctccaccac
ctcctacaggaggagacctcctacatctttgtcagcgttacccaagaggctgagagagag
gagttctacgatgagacgaggagactgtgcgacctaaggctttttcaggccttcctgaaa
gtcatcgagccagtaggcaaccgagaggagaaaatactaaaccgagaaattggttttgcc
ataggaatgcccatatgcgagtttgacctggtcaaggacgcagaggtccaggactttaga
aggaacatattaaatgtctgcaaggagtctgtggacctccgagacactaacggacccatc
agtagagcgttgtacgtctaccctcccaatgtagagtcgtcagtagaactacctaagcac
atcttcaataagcttgacaaaggtcaaatcatagtggtcatatgggtcatcgtgtcaccg
agcaacgacaagcagaagtacacgctgaagatcaaccatgactgtgtgccggagcacgtg
atcgcagaggccatccgcaagaagacacgtagcatgctgctgtcccacgagcagctcaag
atgtgcgtgcaggagtatcagggcaagtacatcctcaaggtgtgcggctgcgacgagtac
ctgctggagaaataccccctgagtcaatacaagtacgtgaggagttgcatcatgctgggg
cgcatgcccaacctaatgctaatggccaaggacagcctgtactcacagctgcccatcgat
acctttaccatgccctcgtatgcccgccgcatctccacggccactccctacatgaacggc
gagacggccaccaagtctctgtggaccatcaacggcactctgaggataaggatactgtgt
gccacctacgtcaatgtcaacatcagggacattgacaagatctacgtccggactgggatt
taccacggtggggagcagctgtgtgacaacgtgaacactcagcgcgtgccatgctcaaac
cccaggtggaacgagtggctgaactacgacatgtacattccagacatcccccgcgctgca
cgactctgtctgtcaatctgttctgtgaaagggaggaagggggccaaagaggagcactgt
ccactagcctggggaaacatcaacctgtttgattacacccacacgctggtggctggaaag
atggccctcaacctatggcccgtgccccacggcctggaagacctgctcaatgctatcgga
gtcaccggctccaatccgaacaaggaaaccccttgcctggagctggagtttgaccatttc
agtaacccagtgaagttccccgacatgccggccatcgaggagcacgccaactggaacata
tcccgggagctgggcttcaactattgccacaccggtttgagtaacagactggcaagggac
aaccctctgacggacagcgacaacgaacagctgcgcctggtgtgtaacagagacccactg
tctgaaataactgagcaggagaaggacttcctctggaggcacagacattactgcgtcagt
atcccggagatactgcccaagattctcctggcagtgaaatggaactccagggatgaggtt
gcacagatgtattgccttttaaaggactggccagccataaagccagaacaagccatggag
ttgctggactgcaacttccccgatcccatgatccgagactttgctgtgaagtgccttgaa
aaatacttaacggacgacagactctctcaatacctcattcagctggtccaggttctgaag
tacgagcagtacctcgataacccactggcccgctttctgctgaagaaggctttgaccaat
cagaggataggccatttcttcttttggcatctcaagtctgagatgcacaacaagacagtg
agccaacgttttggtctgttgctggagtcctactgccgggcctgtggcatgtacctgaag
cacctgagcagacaggtggaggccatggagaagctcatcaacctcacagacctcctcaag
caggagaagaaggacgaggcccagaaggttcagatgaagttcttggtggagcagatgaaa
aggcctgactacatggatgccctacagagcttcacctctccgctcaacccagctcaccag
ctgggaaacctccgcttggaagagtgccggatgatgtcatcggccaaacggcctctgtgg
ctcaactgggagaatcccgacatgatgtcagagctgctcttccagagcaacgagatcatc
ttcaaaaatggagacgatctgaggcaggacatgctgactctgcagatcattaggataatg
gagaacatctggcagaaccaggggcttgatctcaggatgttgccgtacggctgcctgtcc
atcggcgactgcgtgggcctgatcgaggtggtgaggaactcccacaccatcatgcagatc
cagtgtaaaggaggcctgaagggggcgctgcagttcaacagccacacgctgcaccagtgg
ctcaaggacaagaacaggggagagatgtatgaccaggccattgacttgttcacacggtcg
tgtgcgggatactgcgtagccaccttcatcctggggatcggtgaccgacacaacagcaac
atcatggtcaaagatgatggacagctattccacatcgactttggccatttcctggatcac
aagaagaagaagtttggctacaagcgagagcgggtgccttttgtcttgacacaggacttc
ttaatcgttatcagcaaaggaacccaggagtgcacaaaaaccagggagtttgagaggttt
caggagatgtgctacaaggcctacttggccatccggcagcacgccaacctcttcatcaac
ctgttctccatgatgctgggctctggcatgcccgagctgcagtcgttcgacgacatcgcc
tacatccgtaagacccttgccctggacaagacggagcaggaggccctggactacttcatg
aagcagatgaatgacgcccaccacggcggctggaccaccaaaatggactggatctttcac
accatccgccagcacgccatgaactga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112260309
Entry
112260309         CDS       T05605                                 

Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit gamma-like isoform X1
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04012  ErbB signaling pathway
otw04068  FoxO signaling pathway
otw04070  Phosphatidylinositol signaling system
otw04140  Autophagy - animal
otw04150  mTOR signaling pathway
otw04210  Apoptosis
otw04218  Cellular senescence
otw04370  VEGF signaling pathway
otw04510  Focal adhesion
otw04620  Toll-like receptor signaling pathway
otw04625  C-type lectin receptor signaling pathway
otw04810  Regulation of actin cytoskeleton
otw04910  Insulin signaling pathway
otw04914  Progesterone-mediated oocyte maturation
otw05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    112260309
   04370 VEGF signaling pathway
    112260309
   04068 FoxO signaling pathway
    112260309
   04070 Phosphatidylinositol signaling system
    112260309
   04150 mTOR signaling pathway
    112260309
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112260309
  09143 Cell growth and death
   04210 Apoptosis
    112260309
   04218 Cellular senescence
    112260309
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112260309
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112260309
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    112260309
   04625 C-type lectin receptor signaling pathway
    112260309
  09152 Endocrine system
   04910 Insulin signaling pathway
    112260309
   04914 Progesterone-mediated oocyte maturation
    112260309
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    112260309
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112260309
Membrane trafficking [BR:otw04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    112260309
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_9 Ribosomal_L22e SH3_1
Other DBs
NCBI-GeneID: 112260309
NCBI-ProteinID: XP_024291078
LinkDB
Position
10
AA seq 725 aa
MEVDGFQYRALYIYTKDLEEDIDLQPGDILTVSKASLGFKEWDEERPELLGWLLGFNERT
KQRGDFPGTYVQFVGPVRMAPPPSQPRSQRLLPAAPGPEPQQDVSLLDLTEQFTPPETAP
HTLVNLVEAIEKKGLDCRTLYRTPVASSNSESPTQSWSGEVESGSDVGALSECVVRYLRE
LPSPVIPPGVYPDLQAALQHGAADLAASSSGGRELSLVLERATSVPLHHRLTLQYLLTHL
GKVGQGSQLNGLDPHTLGLVFGPLLIRPSSTTGWEVGEEFPALALERLLMERAMGQEVPP
PALPVKPMKAKTTTPAMTETRILSDSEWYWGEISREEVNEKMRDTPDGTFMVRDASSKLE
GEYTLTLRKGGNNKLIKICHRGGRYGFSEPLTFTTVVELINHYRHDSLAQYNAKLDTRLL
YPVSKYQQEQLVKEDSIEAVGEQLKVYHEQYQEKSREYDVLYEEYTRTSQELQMKRTAIE
AFGETIKIFEEQCETQERYSKESIEKFLREGNDKEIQKIQSNSERLKSRVTEIHDSKRKL
EQDLKQQATDNREIDKRMNSLKPDLIQLRKIRDQYLVWLTQKGTRQKSINEWLGIKNEAE
DSYSLVEEDEGSPHHDECTWYVGDIKRTQAEELLRDKCDGTFLIRESQTQKGSYACSVVV
DGDAKHCVIYKTDKGYGFAEPYNLYGSLKDLVLHYKQESLVQHNDQLNVTLAYPVLTQTL
QQHPR
NT seq 2178 nt   +upstreamnt  +downstreamnt
atggaggttgatggtttccagtatcgtgccctctacatctacaccaaggacttggaggag
gacattgacctgcagcccggggacattctgaccgtcagcaaggcctccctgggcttcaag
gagtgggatgaggagcgtcctgagctcctgggctggctgctgggcttcaacgaacgcact
aagcagaggggggacttcccggggacatatgtccagtttgtgggccctgtgaggatggca
ccgccgcccagtcagcctcgctcccaaagactcctcccagcagccccggggcctgagcca
caacaagatgtttctcttctggatttgaccgagcagttcacaccaccagaaactgctccc
cacaccctggtgaacctagtggaggccattgagaagaaaggtctggactgcaggacacta
tacaggacacctgtggcatcctccaactctgagagcccaacacagagctggagtggtgag
gtggagtcgggtagtgacgtgggtgccttgtcggagtgtgtggtccgctacctgagggag
ctgccgtcccccgtcatcccccccggtgtttacccagacctgcaggctgcgctgcagcac
ggcgccgcggacttggcggcaagcagcagcggaggcagggagctgagcctggtcctggag
agggccactagtgtgcccctgcaccatcgcctcactctgcagtacctactcacacacctg
ggcaaggtgggccagggctcccagctcaacggcctggaccctcacaccctgggcctggtc
tttgggccgctgctgatccggcccagttctactactgggtgggaggtgggggaggagttc
cctgcacttgcgctggagaggctgctgatggagagggccatgggacaggaagtcccgccc
cctgctctaccagtcaagccaatgaaggccaaaaccacgactccagccatgactgagact
cgcatactgagtgattccgagtggtactggggggaaatctccagggaggaggtgaacgag
aagatgagagacacccctgacgggacgttcatggtccgtgacgcctccagcaaactggaa
ggagagtacacactgaccctcaggaaaggaggcaacaacaagctgataaagatctgccac
cggggcggtcgctatggcttctccgagccgctcaccttcaccacggtggtggagctcatc
aaccactaccgccacgattccctggcccagtacaacgctaagctagacacccggctcctc
taccccgtctccaaataccaacaggagcagctggtgaaagaggacagcattgaggcggtg
ggcgagcagctgaaggtgtaccacgagcagtaccaggagaagagccgggagtacgacgtg
ctctacgaggagtacacacgcacctcacaggagctccagatgaagcgcacggctatcgag
gcctttggcgagaccatcaagatcttcgaggagcagtgtgagacccaggagcgctacagc
aaagagtccatcgagaagttcctacgcgaaggcaacgacaaggagatccagaagatccag
agcaactccgagcgcctgaagtctagggtgacggagatccacgacagcaagagaaagctg
gagcaggatctgaagcagcaggccactgacaaccgagagattgacaagaggatgaacagc
ctgaagccggacctcattcagctaaggaagatcagggaccagtacctggtatggttgaca
cagaaggggacgaggcagaagagtataaatgagtggctgggcataaagaacgaggcagaa
gactcatactcgctggtggaggaggatgagggctcgccccaccacgacgagtgcacatgg
tacgtgggcgacatcaagcgcacccaggcagaggagctgcttagggacaagtgtgacggc
accttcctcatccgagagagccagacgcagaagggctcctacgcctgctccgtggttgtg
gacggcgatgccaaacactgtgtcatctacaagacggataaaggctacggcttcgccgaa
ccttacaacctgtacggctccctgaaggacctggtgctccactacaagcaagagtccctg
gtccaacacaacgaccagctgaatgtaaccctggcctacccagtcctcacccagaccctg
cagcagcaccctagatga

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112260699
Entry
112260699         CDS       T05605                                 

Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit gamma-like
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04012  ErbB signaling pathway
otw04068  FoxO signaling pathway
otw04070  Phosphatidylinositol signaling system
otw04140  Autophagy - animal
otw04150  mTOR signaling pathway
otw04210  Apoptosis
otw04218  Cellular senescence
otw04370  VEGF signaling pathway
otw04510  Focal adhesion
otw04620  Toll-like receptor signaling pathway
otw04625  C-type lectin receptor signaling pathway
otw04810  Regulation of actin cytoskeleton
otw04910  Insulin signaling pathway
otw04914  Progesterone-mediated oocyte maturation
otw05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    112260699
   04370 VEGF signaling pathway
    112260699
   04068 FoxO signaling pathway
    112260699
   04070 Phosphatidylinositol signaling system
    112260699
   04150 mTOR signaling pathway
    112260699
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112260699
  09143 Cell growth and death
   04210 Apoptosis
    112260699
   04218 Cellular senescence
    112260699
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112260699
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112260699
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    112260699
   04625 C-type lectin receptor signaling pathway
    112260699
  09152 Endocrine system
   04910 Insulin signaling pathway
    112260699
   04914 Progesterone-mediated oocyte maturation
    112260699
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    112260699
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112260699
Membrane trafficking [BR:otw04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    112260699
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 Exonuc_VII_L
Other DBs
NCBI-GeneID: 112260699
NCBI-ProteinID: XP_024291762
LinkDB
Position
10
AA seq 482 aa
MFYPSEVLFYIEMDQAPPALPPRSAKPITSFMNDNCLREAPVYPLQDAEWYWGDISREEV
NEKLRDTPDGSFLVRDASTKIQGDFTLTLRKDGHSKLIKIYHREGKYGFSEPLTFCSVVE
LIWHYQHHPLVEYNAVLDVMLTHPVSRFQQDEQVKVDSVDVAGRKLQEYHSQYQEKSQQF
DCLYEAYTKTSQEIQMKRTAIEAFNETMLIFEEQCREQERYGEECERSIRSKGTEKDLER
FLMNYEKLKSRLGEIYDSKVHLEQDLRTQVQDYRETDRRINSLRPDLIELRNIRDEYLNW
LNHEGVQQKRINDWLGFQDNSSDNTYVLKGESERLAHHDEGSWFVGELSRTQAEEMLMDK
PTGTFLIRESSKQGCYACSVVVNVEVKHCMIYSTPRGYGFAEPYDLHCSLKELVLHYRLN
SLAQHNQALDVRLEHPVHVTPVSSALLHTATEDSLLQQTEEHHLLQTQTKLPAGLPAAAP
EM
NT seq 1449 nt   +upstreamnt  +downstreamnt
atgttttatccctctgaagtcttattctacatcgaaatggatcaagcacctccagctctc
cctcccaggtcagccaaacccattacctccttcatgaatgacaactgcctaagggaagcc
ccagtatatcccctgcaggatgctgagtggtactggggagacatttccagggaggaagtc
aacgagaagctccgcgacacacctgatggttccttcctggttcgtgacgcttccactaag
atacaaggagacttcacgctaacgctgaggaaagacgggcacagcaagctgattaagatc
taccaccgtgaggggaagtatggcttttcagagcccctgaccttctgctctgtagtggag
ctcatctggcactaccagcaccatcctctggtggaatacaacgctgtactggacgtcatg
ctcacacaccctgtttcccgcttccaacaggatgagcaggtgaaagtggacagtgttgat
gttgccgggaggaagctacaggagtaccacagtcagtaccaggagaagagtcaacagttt
gactgtctgtacgaggcctacactaaaacctcacaggagatccagatgaagagaactgcg
atagaggcctttaacgagaccatgctgatcttcgaggaacagtgtcgcgagcaggagcgt
tatggggaggagtgtgagaggagcattcgatctaagggaacagagaaggacttggagaga
ttcctgatgaactatgagaagctaaagtctcggctgggggagatctatgacagtaaggtc
catctggaacaggacctgaggacccaggtccaggactacagagagacagacaggaggatc
aacagcctcaggcctgacctcatagagctacgcaacatcagagacgagtacctcaattgg
ctgaatcacgaaggtgtgcaacagaaacgcattaacgattggctggggttccaagacaat
agcagtgacaacacctacgtgttgaagggtgagagtgagagactggcgcaccatgacgag
gggagctggtttgtgggcgagctgagcaggacccaggctgaggagatgctgatggacaaa
cccaccggaaccttcctgattcgcgagagcagcaagcagggttgctacgcctgttccgta
gttgttaatgtagaagtgaagcattgcatgatttatagcacgccacgtggctatggcttt
gctgagccctacgacctccactgctctctgaaagagctcgttctgcactatcgcctcaac
tccctggcacagcacaaccaggccctggacgtccggctggagcaccctgtccacgtcact
cctgtctcgtcagccttgctacacacagccacagaggacagcctgctacaacagacggag
gaacaccaccttctacagactcaaactaaactacctgctggactccctgcagcagctccg
gagatgtag

KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112267269
Entry
112267269         CDS       T05605                                 

Gene name
pik3cb
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform isoform X1
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw00562  Inositol phosphate metabolism
otw01100  Metabolic pathways
otw04012  ErbB signaling pathway
otw04068  FoxO signaling pathway
otw04070  Phosphatidylinositol signaling system
otw04140  Autophagy - animal
otw04150  mTOR signaling pathway
otw04210  Apoptosis
otw04218  Cellular senescence
otw04370  VEGF signaling pathway
otw04510  Focal adhesion
otw04620  Toll-like receptor signaling pathway
otw04625  C-type lectin receptor signaling pathway
otw04810  Regulation of actin cytoskeleton
otw04910  Insulin signaling pathway
otw04914  Progesterone-mediated oocyte maturation
otw05132  Salmonella infection
otw05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    112267269 (pik3cb)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    112267269 (pik3cb)
   04370 VEGF signaling pathway
    112267269 (pik3cb)
   04068 FoxO signaling pathway
    112267269 (pik3cb)
   04070 Phosphatidylinositol signaling system
    112267269 (pik3cb)
   04150 mTOR signaling pathway
    112267269 (pik3cb)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112267269 (pik3cb)
  09143 Cell growth and death
   04210 Apoptosis
    112267269 (pik3cb)
   04218 Cellular senescence
    112267269 (pik3cb)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112267269 (pik3cb)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112267269 (pik3cb)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    112267269 (pik3cb)
   04625 C-type lectin receptor signaling pathway
    112267269 (pik3cb)
  09152 Endocrine system
   04910 Insulin signaling pathway
    112267269 (pik3cb)
   04914 Progesterone-mediated oocyte maturation
    112267269 (pik3cb)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112267269 (pik3cb)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    112267269 (pik3cb)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112267269 (pik3cb)
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     112267269 (pik3cb)
Membrane trafficking [BR:otw04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    112267269 (pik3cb)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_p85B PI3K_rbd PI3K_C2 RWD DUF4135 Tom37_C
Other DBs
NCBI-GeneID: 112267269
NCBI-ProteinID: XP_024301290
LinkDB
Position
14
AA seq 1080 aa
MPPAMTNLMDLWAAHSQLSGEDLVTVDFLLPTGIYIQMDVPREATIQHIKLLLWKQAQSY
PLFPSLGEMEGHMFECVNQAAVHEELEDETRRLCDVRPFWPMLKLVTRNCGRAERLLDSK
IGVLIGKGLHELDALQDQEVKDFRSKMFRISEEKMQRVQLMTWSEWLQACFSPQLEPGGG
ATPVTDGVNDKQAEASLKVTMHFDQSQDTASLKVWPSTSPSELMEQALRKWLTTHGPEEE
GRQAEQYVLRVSDKLEFLCGDHPLIQYKYIKACLQAKECPHLTLVQVSTVQAMFEKEISA
IGAVVNRKSSNPPLPLPPKRRGPSQVNTCVWEVSTHFKIVLIKGSKVNAEETAKIQVRAG
LFHGTELLCKPAVSSESSGRSEHVWNRTLEFDITVSDLPRMARLCFAVYAVMDKVKKQKS
TKNAHINKYQTIRKSGKVHYPVAWVNTMVFDYKGQLKTGDIILHSWSSFPDELEEMLNPI
GTIQTNPYTENTTALHIHLPDYNPHTILFPPFDKILEKAAEIAGSSDCLPMGRGGKKFHI
ELKEIMERDPLSQLCENEKDLIWTLRYDCMENFPQSLPKLLLSVKWSKHEDMAQLQALLQ
IWPKLSPRDALELLDFNYPDQYVREYAVGCLRDMSDEELSQYLLQLVQVLRYEPYYDCAL
TRFLLNRAQCNRNIGHFLFWHLRSEMHMPAVAVQFSLILEAYCRGSIPHIEVLKKQVEAL
SKLKSVNELIKLGTIKNARSKTKEAMLTKEAMMTCLRQSGYTETLSDLHSPLNPSVLLSG
INVERCRYMDSKMKPLWIVYNNKLLGGDTLGIIFKNGDDLRQDMLTLQILRLMDLLWKEA
NLDLRIVPYGCLATGDRSGLIEVVSSADTIANIQLTSSNVAAAAAFNKDALLNWLKEKNS
GDALEKAIEEFTLSCAGYCVATYVLGIGDRHSDNIMVRSTGQLFHIDFGHILGNFKSKFG
IKRERVPFILTHDFIHVIQQGKTGNTEKFGSFRNYCEQAYLILRRNGNLFITLFALMLTA
GLPELTSVKDIQYLKDSLALGKTDDEALKQFRQKFDEALRESWTTKVNWMAHNVVKDNRS
NT seq 3243 nt   +upstreamnt  +downstreamnt
atgcctcctgccatgacaaacctcatggacttgtgggcagcccactcccagctgtctgga
gaggacctggtcactgtagacttcctgttacccaccggcatctacattcagatggacgtc
cccagagaggccaccatacaacacatcaaactgctcctatggaagcaggcccagtcatac
cccctgttcccttctctgggggagatggagggccacatgtttgagtgtgtgaaccaggca
gcggtgcacgaggagctggaggatgagaccaggcgcctctgtgacgtcaggcccttctgg
cccatgctcaaactggtcacacgtaactgtggccgcgccgaacgcctactcgactccaag
atcggcgtgctcatcggaaaaggtctccacgagctggacgctctgcaggaccaggaggtg
aaggacttccgcagtaagatgttccgtatcagcgaggagaagatgcagcgggtacagctg
atgacctggagcgagtggctgcaggcctgcttctctccgcagctggagccagggggagga
gccacacccgtcacagacggtgtcaacgacaaacaggccgaggccagcctcaaagtcacc
atgcacttcgaccagtcccaggacacagccagtctgaaggtgtggcccagcaccagtccc
agtgagctgatggaacaggcgttgaggaaatggctgacgacccacggccccgaggaggag
ggacgccaggccgagcagtacgttctgagggtcagcgataagctggagttcctctgtgga
gaccaccccctgatacagtacaagtacatcaaagcctgtctccaggctaaggagtgtccc
cacctgaccctggtccaggtcagcacagtccaggccatgttcgagaaggagatctcggcc
atcggagctgtggtcaaccgcaagagctccaacccccccttacccctgccccccaagagg
agggggccctcgcaagtgaatacgtgtgtatgggaggtgtctacccattttaagatcgtc
ctaatcaaaggcagcaaggtgaacgctgaggagacggccaagatccaggtacgtgcaggc
ttgttccatggcacagagctgctgtgtaagccagcggtgagcagcgagagcagcggacgc
tctgaacacgtgtggaatcgcacgctagagttcgacattaccgtgagcgacctgccacgc
atggcccgcctctgctttgccgtctacgccgtcatggacaaggtcaagaagcagaagtcc
accaagaacgcccacatcaacaagtaccagaccatccgcaagtctggcaaagtgcactac
cctgtagcctgggtgaacaccatggtgtttgactataaaggacagctgaagactggagat
atcatccttcacagctggtcttcctttcctgatgaacttgaagagatgctgaaccccata
ggaaccatccagaccaacccttacactgagaacacgacagcactccacatccacctccct
gactacaacccccacactatcctgttcccccccttcgacaagattctggagaaagctgca
gagatcgccgggtcaagcgactgcttgcccatgggccgaggcggtaagaagttccacatc
gagctgaaggagatcatggagagggaccctctgtcccagctgtgtgagaatgagaaggac
ctcatctggacactacgctacgactgcatggagaacttcccccagtcactgcccaaactg
ctgctctccgtcaagtggagcaaacatgaggacatggcccagctccaggccttgctgcag
atctggcccaagctgagtcccagggacgctctggagctgcttgactttaactatccagac
cagtacgtcagagagtacgctgtgggctgcctgagggatatgagtgatgaggagttgtct
cagtacctgctccagctggtccaggtgttacgttatgaaccctactatgactgtgccctc
acccgcttcctactgaacagagcccagtgcaaccgcaacataggacactttctcttctgg
catctcaggtcagagatgcacatgccagcagtcgctgtccagttctctctcattctggag
gcttactgtcgcggcagcatccctcacattgaggtcctgaagaaacaggtggaggctctg
agcaagctgaagtctgtaaatgagctgatcaagctgggcaccatcaagaacgcccgcagt
aagaccaaggaggccatgctcaccaaagaggccatgatgacttgtctgagacagagtggc
tacacagagaccctctctgacctgcactcccctctcaaccccagtgtcctgctctctgga
atcaatgtggagaggtgtcggtacatggactcgaagatgaagcctctgtggatcgtctac
aacaacaagcttctggggggagacaccctgggaatcatcttcaagaacggagacgacctg
agacaagacatgttgacactgcagatcttgaggttgatggacctgctatggaaggaggcc
aatctggacctcagaattgtaccttacggttgcctagcaactggggaccggtcagggctg
atcgaggtggtgtcgtcggcggataccatcgccaacatccagctgaccagcagcaacgtg
gcagccgccgcagctttcaacaaggatgcgctacttaactggctcaaagagaagaactct
ggagatgctctggagaaggcgatcgaggagttcaccctgtcatgtgcaggctactgcgtg
gccacctacgtcctggggataggtgaccgccacagtgacaacatcatggtccgcagcact
gggcagctcttccacatagactttgggcatatcctggggaacttcaagtccaagtttggc
atcaagagggaacgcgtccccttcatcctgacccatgacttcatccacgtcatccaacag
ggaaagacgggcaacactgagaagtttggcagtttccgtaattactgtgaacaagcctac
ctgattctaaggcggaatgggaacctcttcatcaccctctttgccctcatgctgactgct
ggactgcctgagctcacctccgtcaaggatatacagtacctaaaggactctctggccctg
gggaagaccgacgacgaggcactgaaacagttccgccaaaagtttgacgaggcgctgaga
gagagctggaccaccaaagtcaactggatggcccacaacgtggtcaaagacaaccgctcc
tag

DBGET integrated database retrieval system